[Biopython] Using the Bio.SeqUtils.ProtParam module
Andrew Maher
amaher at fas.harvard.edu
Fri Jul 23 15:22:32 UTC 2010
I'm a beginner with python, and I'm having trouble with something relatively
simple:
I'm trying to find the isoelectric point of a protein with the
sequence: VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPEASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
So, when I load python 2.6.2 with bipython v1.54 and then type in "from
Bio.SeqUtils import ProtParam" on one line and then "X =
ProteinAnalysis("VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPEASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC")
on the next line, I get the following error message:
NameError: name 'ProteinAnalysis' is not defined
But, looking at the source code for ProtParam (
http://biopython.org/DIST/docs/api/Bio.SeqUtils.ProtParam-pysrc.html#ProteinAnalysis),
isn't the ProteinAnalysis class clearly defined? What am I doing wrong?
More information about the Biopython
mailing list