[BioPython] parsing the blastoutput and printing the alingment
Muthuraman, Manickam
manickam.muthuraman at wur.nl
Thu Jun 15 17:29:51 EDT 2006
Dear Peter
In this mail i am attaching three files :seq file,python script file and the blast output. I am using python Python 2.4.1 (#2, Aug 25 2005, 18:20:57)and biopython 1.40
i spent almost the whole evening to upgarde the python and biopython in mandriva linux but i failed.
let me know is the version of python and biopython matter here
thanks for helping me out of this
from
manickam
-----Original Message-----
From: Peter [mailto:biopython at maubp.freeserve.co.uk]
Sent: Thu 6/15/2006 5:01 PM
To: Muthuraman, Manickam
Cc: biopython at lists.open-bio.org
Subject: Re: [BioPython] parsing the blastoutput and printing the alingment
Muthuraman, Manickam wrote:
> Dear peter
>
> here is the code my_blast.out and the error. My need is to get all the
> blast hit sequences in fasta format. By parsing and i can extract
> accession number from it.
I made an example fasta file containing just this one sequence twice:
>example1
VPKIDVSPLFGDDQAAKMRVAQQIDAASRDTGFFYAVNHGINVQRLSQKTKEFHMSITP
EEKWDLAIRAYNKEHQDQVRAGYYLSIPGKKAVESFCYLNPNFTPDHPRIQAKTPTHEV
NVWPDETKHPGFQDFAEQYYWDVFGLSSALLKGYALALGKEENFFARHFKPDDTLASVV
LIRYPYLDPYPEAAIKTAADGTKLSFEWHEDVSLITVLYQSNVQNLQVETAAGYQDIEA
DDTGYLINCGSYMAHLTNNYYKAPIHRVKWVNAERQSLPFFVNLGYDSVI
>example2
VPKIDVSPLFGDDQAAKMRVAQQIDAASRDTGFFYAVNHGINVQRLSQKTKEFHMSITP
EEKWDLAIRAYNKEHQDQVRAGYYLSIPGKKAVESFCYLNPNFTPDHPRIQAKTPTHEV
NVWPDETKHPGFQDFAEQYYWDVFGLSSALLKGYALALGKEENFFARHFKPDDTLASVV
LIRYPYLDPYPEAAIKTAADGTKLSFEWHEDVSLITVLYQSNVQNLQVETAAGYQDIEA
DDTGYLINCGSYMAHLTNNYYKAPIHRVKWVNAERQSLPFFVNLGYDSVI
I then edited the filenames in your example, and ran the code. It
worked for me using a fresh install of BioPython 1.41 on Linux with
Python 2.4.2
So the good news is your code seems fine.
Maybe there is something "funny" with your fasta file? Accented
characters for example - which would then be in the output XML file?
Could you send me the fasta file and the XML file (in full, as
attachments), off the mailing list to avoid clogging up everyone's inboxes.
Thanks
Peter
-------------- next part --------------
A non-text attachment was scrubbed...
Name: not available
Type: application/ms-tnef
Size: 164714 bytes
Desc: not available
Url : http://lists.open-bio.org/pipermail/biopython/attachments/20060615/2f04b211/attachment-0001.bin
More information about the BioPython
mailing list