[Biopython-dev] [Bug 2542] AlignInfo.py fails a test
bugzilla-daemon at portal.open-bio.org
bugzilla-daemon at portal.open-bio.org
Fri Jul 11 04:49:08 EDT 2008
http://bugzilla.open-bio.org/show_bug.cgi?id=2542
------- Comment #1 from biopython-bugzilla at maubp.freeserve.co.uk 2008-07-11 04:49 EST -------
Going over your example code:
>>> from Bio import Alphabet
>>> from Bio.Align.Generic import Alignment
>>> from Bio.Align.AlignInfo import SummaryInfo
>>> seq1 = 'MHQAIFIYQIGYPLKSGYIQSIRSPEYDNW'
>>> seq2 = 'MH--IFIYQIGYALKSGYIQSIRSPEY-NW'
>>> a = Alignment(Alphabet.ProteinAlphabet)
First problem, you gave the Alignment object an Alphabet class, rather than an
instance of the class. I guess we should an explicit check to the Alignment
object...
You should have used:
>>> a = Alignment(Alphabet.ProteinAlphabet())
Or, if you prefer perhaps:
>>> a = Alignment(Alphabet.generic_protein)
Then when we get to the information_content, there is another issue:
>>> a.add_sequence("asp",seq1)
>>> a.add_sequence("unk",seq2)
>>> summary = SummaryInfo(a)
>>> summary.information_content()
Traceback (most recent call last):
...
AttributeError: ProteinAlphabet instance has no attribute 'gap_char'
The trouble here is that SummaryInfo class is looking for a declared gap
character in the protein alphabet - and none has been declared. Your example
sequences appear to use "-" as a gap, but you haven't declared this.
Try this:
from Bio import Alphabet
from Bio.Align.Generic import Alignment
from Bio.Seq import Seq
from Bio.Align.AlignInfo import SummaryInfo
seq1 = 'MHQAIFIYQIGYPLKSGYIQSIRSPEYDNW'
seq2 = 'MH--IFIYQIGYALKSGYIQSIRSPEY-NW'
a = Alignment(Alphabet.Gapped(Alphabet.generic_protein, "-"))
a.add_sequence("asp",seq1)
a.add_sequence("unk",seq2)
summary = SummaryInfo(a)
print summary.information_content()
You mentioned having a similar issue with Bio.AlignIO - could you attached the
example file to this bug with some trivial code showing your problem?
Thanks, Peter.
P.S. Please update to Biopython 1.47 rather than using 1.46
--
Configure bugmail: http://bugzilla.open-bio.org/userprefs.cgi?tab=email
------- You are receiving this mail because: -------
You are the assignee for the bug, or are watching the assignee.
More information about the Biopython-dev
mailing list