BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33388008|gb|CA851215.1|CA851215 D11D02_G14_07.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11D02 5', mRNA
sequence
         (682 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1S5Y8 Hypothetical protein - Medicago truncatula (Barrel medic)      219   8e-57
Q9AR56 Putative membrane protein - Solanum tuberosum (Potato)         178   2e-44
Q9AR57 Putative membrane protein - Solanum tuberosum (Potato)         176   8e-44
Q9AR54 Putative membrane protein - Solanum tuberosum (Potato)         176   8e-44
Q9AR55 Putative membrane protein - Solanum tuberosum (Potato)         175   1e-43

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33388007|gb|CA851214.1|CA851214 D11D01_G13_07.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11D01 5', mRNA
sequence
         (290 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q93X72 Leucine-rich repeat resistance protein-like protein - Gos...    35   0.085
Q9FLK9 Leucine-rich repeat disease resistance protein-like (Cf-5...    34   0.14 
Q9LMG6 F16A14.12 - Arabidopsis thaliana (Mouse-ear cress)              29   4.6  
Q8GYK0 Putative disease resistance protein - Arabidopsis thalian...    29   4.6  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33388006|gb|CA851213.1|CA851213 D11C12_E24_06.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11C12 5', mRNA
sequence
         (643 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q0DXJ1 Os02g0750600 protein - Oryza sativa (japonica cultivar-gr...   140   3e-33
Q9ZRD0 NTGP5 - Nicotiana tabacum (Common tobacco)                     133   5e-31
Q0DR15 Os03g0426800 protein - Oryza sativa (japonica cultivar-gr...   119   8e-27
Q10JB5 Ubiquitin-fusion protein, putative, expressed - Oryza sat...   114   2e-25
Q949H3 Putative class I chitinase (Fragment) - Hevea brasiliensi...    32   2.2  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33388005|gb|CA851212.1|CA851212 D11C11_E23_06.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11C11 5', mRNA
sequence
         (688 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q5VQF8 Hypothetical protein OJ1276_B06.19 (Os01g0168500 protein)...   182   1e-45
Q9AS72 P0028E10.20 protein - Oryza sativa (japonica cultivar-group)   179   7e-45
Q9LXZ6 Hypothetical protein T5P19_90 - Arabidopsis thaliana (Mou...   176   8e-44
Q0WPK3 Hypothetical protein At3g56440 - Arabidopsis thaliana (Mo...   176   8e-44
Q8GYD7 Hypothetical protein At2g40810 (At2g40810) - Arabidopsis ...   165   1e-40

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33388004|gb|CA851211.1|CA851211 D11C10_E22_05.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11C10 5', mRNA
sequence
         (29 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33388003|gb|CA851210.1|CA851210 D11C09_E21_05.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11C09 5', mRNA
sequence
         (673 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9SP38 NADH ubiquinone oxidoreductase PSST subunit - Lupinus lut...   290   2e-78
Q9LKH4 NADH-ubiquinone oxidoreductase subunit PSST - Lupinus lut...   285   7e-77
Q9LKG9 NADH-ubiquinone oxidoreductase subunit PSST (Fragment) - ...   282   6e-76
Q6I5H0 Putative NADH-ubiquinone oxidoreductase 20 kDa subunit (O...   275   1e-73
Q8W0E8 Putative NADH2 dehydrogenase (Ubiquinone) chain PSST (Os0...   274   2e-73

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33388002|gb|CA851209.1|CA851209 D11C08_E20_06.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11C08 5', mRNA
sequence
         (388 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q94LQ6 Putative transcription factor (Os10g0557600 protein) (GAT...    34   0.14 
Q1S9S7 Zinc finger, GATA-type - Medicago truncatula (Barrel medic)     33   0.19 
Q76DY1 AG-motif binding protein-3 - Nicotiana tabacum (Common to...    33   0.32 
Q7FYS6 T10I18.7 protein - Arabidopsis thaliana (Mouse-ear cress)       32   0.55 
Q8LIZ3 Putative AG-motif binding protein-4 (Os01g0745700 protein...    32   0.72 

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33388001|gb|CA851208.1|CA851208 D11C07_E19_06.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11C07 5', mRNA
sequence
         (21 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33388000|gb|CA851207.1|CA851207 D11C06_E18_05.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11C06 5', mRNA
sequence
         (378 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9SUE2 Hypothetical protein T13J8.80 (Hypothetical protein AT4g2...    28   6.1  
Q9ASQ7 AT4g27970/T13J8_80 - Arabidopsis thaliana (Mouse-ear cress)     28   6.1  
Q1SBV5 RNA-directed DNA polymerase homolog F21E10.5-Arabidopsis ...    28   8.0  
Q1XAT8 Phosphoenolpyruvate carboxylase (EC 4.1.1.3) - Alternanth...    28   8.0  
O49470 Resistance protein RPP5-like - Arabidopsis thaliana (Mous...    28   8.0  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387999|gb|CA851206.1|CA851206 D11C05_E17_05.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11C05 5', mRNA
sequence
         (552 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9SRT2 F21O3.5 protein (At3g07340) (Putative bHLH transcription ...    43   7e-04
Q8S3E0 Putative bHLH transcription factor - Arabidopsis thaliana...    43   7e-04
Q67Y05 Putative bHLH transcription factor (BHLH062) - Arabidopsi...    40   0.005
Q5N802 Putative bHLH transcription factor (Os01g0915600 protein)...    39   0.008
Q8S3D4 Putative bHLH transcription factor - Arabidopsis thaliana...    33   0.56 

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387998|gb|CA851205.1|CA851205 D11C04_E16_06.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11C04 5', mRNA
sequence
         (444 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q8LKU3 Putative 60S ribosomal protein - Sorghum bicolor (Sorghum...   159   4e-39
Q2V3X8 Protein At3g07110 - Arabidopsis thaliana (Mouse-ear cress)     158   5e-39
Q6RH10 60S ribosomal protein L13a - Capsicum annuum (Bell pepper)     156   2e-38
Q3HRW1 60S ribosomal protein L13a-like protein - Solanum tuberos...   156   2e-38
Q5I7L1 Ribosomal protein L13a - Triticum aestivum (Wheat)             155   3e-38

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387997|gb|CA851204.1|CA851204 D11C03_E15_06.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11C03 5', mRNA
sequence
         (255 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q0D613 Os07g0518300 protein - Oryza sativa (japonica cultivar-gr...    30   2.7  

>Q0D613 Os07g0518300 protein - Oryza sativa (japonica cultivar-group)
          Length = 1473

 Score = 29.6 bits (65), Expect = 2.7
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%)
 Frame = -3

Query: 136  RKGSTRVSAPRFKGNETSPSSKLPVXRVC--XLLQXLXPG 23
            RKG +  +A     N+T PSS++P   VC   LLQ +  G
Sbjct: 1018 RKGISNAAADALSRNDTIPSSEVPAISVCTPLLLQEVVQG 1057


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387996|gb|CA851203.1|CA851203 D11C02_E14_05.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11C02 5', mRNA
sequence
         (637 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q93Z89 Matrix metalloproteinase MMP2 - Glycine max (Soybean)           32   1.3  
Q10Q51 RhoGAP domain containing protein, expressed (Os03g0209800...    31   2.9  
Q10Q50 RhoGAP domain containing protein, expressed - Oryza sativ...    31   2.9  
Q5WMQ0 Hypothetical protein OSJNBa0053E01.2 - Oryza sativa (japo...    30   6.4  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387995|gb|CA851202.1|CA851202 D11C01_E13_05.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11C01 5', mRNA
sequence
         (651 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q6YUA2 Hypothetical protein B1370C05.1 (Os02g0100200 protein) (H...    30   5.0  
Q1EP07 Hypothetical protein - Musa acuminata (Banana)                  30   8.5  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387994|gb|CA851201.1|CA851201 D11B12_C24_04.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11B12 5', mRNA
sequence
         (442 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9AYL3 Putative carnitine/acylcarnitine translocase - Oryza sati...   171   8e-43
Q7XBY4 Mitochondrial carnitine/acylcarnitine carrier, putative, ...   171   8e-43
Q9AYL2 Putative carnitine/acylcarnitine translocase - Oryza sati...   169   3e-42
Q0IVF6 Os10g0573800 protein - Oryza sativa (japonica cultivar-gr...   169   3e-42
Q1SK80 Mitochondrial carrier protein - Medicago truncatula (Barr...    62   9e-10

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387993|gb|CA851200.1|CA851200 D11B11_C23_04.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11B11 5', mRNA
sequence
         (646 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q7XUV4 OSJNBa0072F16.12 protein (Os04g0461100 protein) - Oryza s...   157   4e-38
Q01II5 H0219H12.12 protein - Oryza sativa (Rice)                      157   4e-38
Q1KUY8 Hypothetical protein - Cleome spinosa                          155   1e-37
Q1XDD6 Hypothetical protein 99 - Porphyra yezoensis                   103   6e-22
Q0R3K4 Ycf65 - Euglena stellata                                        96   1e-19

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387992|gb|CA851199.1|CA851199 D11B10_C22_03.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11B10 5', mRNA
sequence
         (24 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387991|gb|CA851198.1|CA851198 D11B09_C21_03.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11B09 5', mRNA
sequence
         (631 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

O22124 Proton pyrophosphatase - Phaseolus aureus (Mung bean) (Vi...   204   1e-52
Q8H616 Putative inorganic pyrophosphatase (Os06g0178900 protein)...   201   2e-51
P93410 Vacuolar H+-pyrophosphatase (EC 3.6.1.1) (Ovp2) - Oryza s...   201   2e-51
Q75U53 Vacuolar proton pyrophosphatase (Os02g0802500 protein) (P...   200   3e-51
Q704F4 Proton translocating pyrophosphatase - Oryza sativa (Rice)     200   3e-51

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387990|gb|CA851197.1|CA851197 D11B08_C20_04.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11B08 5', mRNA
sequence
         (393 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q7FYS6 T10I18.7 protein - Arabidopsis thaliana (Mouse-ear cress)       32   0.55 
Q94LQ6 Putative transcription factor (Os10g0557600 protein) (GAT...    31   1.2  
Q84S92 Hypothetical protein B1015H11.109 - Oryza sativa (japonic...    31   1.2  
Q1S9S7 Zinc finger, GATA-type - Medicago truncatula (Barrel medic)     30   1.6  
Q01GU9 [IR] KOG0059 Lipid exporter ABCA1 and related proteins - ...    30   1.6  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387989|gb|CA851196.1|CA851196 D11B07_C19_04.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11B07 5', mRNA
sequence
         (660 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q8L5Q7 Putative quinone oxidoreductase (EC 1.6.5.5) - Cicer arie...   380   e-105
Q9XH74 Hypothetical protein p78RF - Prunus armeniaca (Apricot)        359   4e-99
Q6NQE2 Hypothetical protein At4g27270 - Arabidopsis thaliana (Mo...   353   3e-97
Q9LSQ5 1,4-benzoquinone reductase-like; Trp repressor binding pr...   352   6e-97
Q207T5 Quinone oxidoreductase - Gymnadenia conopsea                   350   3e-96

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387988|gb|CA851195.1|CA851195 D11B06_C18_03.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11B06 5', mRNA
sequence
         (706 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q940E9 Pathogenesis-related protein PR10a (Fragment) - Nicotiana...   124   4e-28
Q7Y083 Pathogenesis-related protein PR10A - Datisca glomerata (D...   115   1e-25
Q5VJQ7 Mal d 1-like - Malus domestica (Apple) (Malus sylvestris)      114   4e-25
Q4VPL0 Major allergen Mal d 1.04 (Mal d 1.0404) - Malus domestic...   112   9e-25
Q9ZRU8 Stress and pathogenesis-related protein - Fagus sylvatica...   112   2e-24

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387987|gb|CA851194.1|CA851194 D11B05_C17_03.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11B05 5', mRNA
sequence
         (85 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387986|gb|CA851193.1|CA851193 D11B04_C16_04.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11B04 5', mRNA
sequence
         (559 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1S8Y4 Ribosomal protein S3 - Medicago truncatula (Barrel medic)      159   7e-39
Q2VCJ9 Hypothetical protein - Solanum tuberosum (Potato)              136   5e-32
Q2PYZ0 40S ribosomal protein-like protein - Solanum tuberosum (P...   132   5e-31
Q75G91 Putative ribosomal protein (Os03g0577000 protein) (40S ri...   127   2e-29
Q10HT1 40S ribosomal protein S3, putative, expressed - Oryza sat...   127   2e-29

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387985|gb|CA851192.1|CA851192 D11B03_C15_04.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11B03 5', mRNA
sequence
         (64 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387984|gb|CA851191.1|CA851191 D11B02_C14_03.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11B02 5', mRNA
sequence
         (681 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9FNN2 WD-repeat protein-like - Arabidopsis thaliana (Mouse-ear ...   315   1e-85
Q9FND4 WD-repeat protein-like - Arabidopsis thaliana (Mouse-ear ...   229   6e-60
Q6K5C8 Putative WD repeat protein (Os02g0294600 protein) - Oryza...   211   2e-54
Q7G2L6 WD-repeat protein 26, putative, expressed - Oryza sativa ...   200   3e-51
Q0IX55 Os10g0465000 protein (Fragment) - Oryza sativa (japonica ...   200   3e-51

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387983|gb|CA851190.1|CA851190 D11B01_C13_03.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11B01 5', mRNA
sequence
         (559 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q7XYC9 60s ribosomal protein L21 (Fragment) - Triticum aestivum ...   163   3e-40
Q9ZSU8 60S ribosomal protein L21 - Oryza sativa (Rice)                157   2e-38
Q9AV87 60S ribosomal protein L21 (Os10g0465800 protein) (60S rib...   157   2e-38
Q10RZ3 60S ribosomal protein L21, putative, expressed - Oryza sa...   155   8e-38
Q0WSS0 Hypothetical protein At1g57860 - Arabidopsis thaliana (Mo...   155   1e-37

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387982|gb|CA851189.1|CA851189 D11A12_A24_02.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11A12 5', mRNA
sequence
         (547 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q8GT83 Fiber protein Fb9 (Fragment) - Gossypium barbadense (Sea-...   174   2e-43
Q9M5X2 Heat-shock protein 80 (Fragment) - Euphorbia esula (Leafy...   171   1e-42
Q6UJX5 Molecular chaperone Hsp90-2 - Nicotiana benthamiana            170   2e-42
Q8H158 Putative heat shock protein 81-2 (HSP81-2) - Arabidopsis ...   167   1e-41
Q6UJX4 Molecular chaperone Hsp90-1 - Solanum lycopersicum (Tomat...   166   3e-41

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387981|gb|CA851188.1|CA851188 D11A11_A23_02.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11A11 5', mRNA
sequence
         (675 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1RUG6 Ribosomal protein L7Ae/L30e/S12e/Gadd45 - Medicago trunca...   248   1e-65
Q8H2J8 Putative 40S ribosomal protein S12 (Os07g0229900 protein)...   209   5e-54
Q6ZLP8 Putative ribosomal protein S12 (Os07g0150200 protein) - O...   208   1e-53
Q2M3Z1 Ribosomal protein S12 - Phytophthora infestans (Potato la...   147   3e-35
Q7EY39 Putative 40S ribosomal protein S12 - Oryza sativa (japoni...   145   1e-34

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387980|gb|CA851187.1|CA851187 D11A10_A22_01.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11A10 5', mRNA
sequence
         (650 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9FQF0 Glutathione S-transferase GST 8 (EC 2.5.1.18) - Glycine m...   266   4e-75
Q84T17 Glutathione S-transferase - Phaseolus acutifolius (Tepary...   231   8e-64
Q43678 Auxin-induced protein (Fragment) - Vigna radiata               233   1e-63
Q9FQF1 Glutathione S-transferase GST 7 (EC 2.5.1.18) - Glycine m...   219   5e-61
Q9FQF2 Glutathione S-transferase GST 6 (EC 2.5.1.18) - Glycine m...   210   4e-58

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387979|gb|CA851186.1|CA851186 D11A09_A21_01.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11A09 5', mRNA
sequence
         (311 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387978|gb|CA851185.1|CA851185 D11A08_A20_02.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11A08 5', mRNA
sequence
         (719 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1SL28 RNA-binding region RNP-1 (RNA recognition motif) - Medica...   201   2e-51
Q8RWY8 Hypothetical protein At1g27750 - Arabidopsis thaliana (Mo...    43   0.001
Q651Y0 Transducin / WD-40 repeat protein family-like protein - O...    35   0.24 
Q5JN15 Ubiquitin system component Cue domain-containing protein-...    34   0.42 
Q0JJ15 Os01g0765300 protein (Fragment) - Oryza sativa (japonica ...    34   0.42 

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387977|gb|CA851184.1|CA851184 D11A07_A19_02.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11A07 5', mRNA
sequence
         (702 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q84XU4 Protein disulphide isomerase (Fragment) - Elaeis guineens...   371   e-102
Q9FF55 Protein disulphide isomerase-like protein (At5g60640) (Pr...   366   e-101
Q8LAM5 Protein disulfide isomerase-like - Arabidopsis thaliana (...   366   e-101
Q8VX13 ERp72 precursor (Protein disulfide-isomerase-like protein...   350   2e-96
Q67IX6 Hypothetical protein OSJNOa183H18.2 (Os02g0100100 protein...   337   2e-92

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387976|gb|CA851183.1|CA851183 D11A06_A18_01.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11A06 5', mRNA
sequence
         (701 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1T474 HMG-I and HMG-Y, DNA-binding; Plant MuDR transposase - Me...    31   3.4  
Q0JIM3 Os01g0790900 protein - Oryza sativa (japonica cultivar-gr...    26   5.9  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387975|gb|CA851182.1|CA851182 D11A05_A17_01.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11A05 5', mRNA
sequence
         (355 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387974|gb|CA851181.1|CA851181 D11A04_A16_02.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11A04 5', mRNA
sequence
         (71 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387973|gb|CA851180.1|CA851180 D11A03_A15_02.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11A03 5', mRNA
sequence
         (644 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9XGG6 Putative tonoplast intrinsic protein - Pisum sativum (Gar...   311   2e-86
Q39882 Nodulin-26 - Glycine max (Soybean)                             308   1e-85
Q9LKJ6 Water-selective transport intrinsic membrane protein 1 - ...   300   1e-82
Q41616 Gamma-TIP-like protein (Fragment) - Trifolium repens (Cre...   293   4e-81
Q5DVT4 Tonoplast intrinsic protein 1;1 - Mimosa pudica (Sensitiv...   291   1e-80

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387972|gb|CA851179.1|CA851179 D11A02_A14_01.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11A02 5', mRNA
sequence
         (429 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9SSD2 F18B13.15 protein - Arabidopsis thaliana (Mouse-ear cress)      30   3.3  
Q3E7K0 Protein At2g28940 - Arabidopsis thaliana (Mouse-ear cress)      29   4.4  
O81064 Hypothetical protein At2g28940 - Arabidopsis thaliana (Mo...    29   4.4  
Q9LUT5 Kinesin-related centromere protein-like - Arabidopsis tha...    28   9.7  
Q27IK7 Kinesin POK1 - Arabidopsis thaliana (Mouse-ear cress)           28   9.7  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387971|gb|CA851178.1|CA851178 D11A01_A13_01.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D11A01 5', mRNA
sequence
         (66 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387970|gb|CA851177.1|CA851177 D10H12_P12_16.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10H12 5', mRNA
sequence
         (621 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9FJ98 DNA-directed RNA polymerase II subunit-like protein - Ara...   212   7e-55
Q8LI69 Putative DNA-directed RNA polymerase Iia (Os07g0463100 pr...   204   2e-52
Q9SJ96 Putative DNA-directed RNA polymerase II subunit (At2g0463...   204   2e-52
Q9S7Q6 DNA-directed RNA polymerase IIb (DNA-directed RNA polymer...   202   5e-52
Q6F2V1 Putative DNA-directed RNA polymerase II subunit (Os03g058...   199   4e-51

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387969|gb|CA851176.1|CA851176 D10H11_P11_16.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10H11 5', mRNA
sequence
         (654 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9ZRW9 Polyubiquitin - Vicia faba (Broad bean)                        325   1e-88
Q9SNZ1 Ubiquitin - Hevea brasiliensis (Para rubber tree)              325   1e-88
Q9SB19 Ubiquitin - Pisum sativum (Garden pea)                         325   1e-88
Q9S7H2 Ubiquitin - Glycine max (Soybean)                              325   1e-88
Q84JH1 Putative polyubiquitin (Fragment) - Gossypium barbadense ...   325   1e-88

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387968|gb|CA851175.1|CA851175 D10H10_P10_15.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10H10 5', mRNA
sequence
         (537 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q6WAU1 (-)-isopiperitenone reductase - Mentha piperita (Peppermint)    87   2e-17
Q06ZW2 (-)-menthone:(+)-neomenthol reductase (EC 1.1.1.208) (Fra...    82   1e-15
Q5CAF4 Menthol dehydrogenase - Mentha piperita (Peppermint)            80   3e-15
Q7XNZ0 OSJNBa0081C01.18 protein - Oryza sativa (japonica cultiva...    77   3e-14
Q0JBH4 Os04g0531700 protein (Fragment) - Oryza sativa (japonica ...    77   3e-14

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387967|gb|CA851174.1|CA851174 D10H08_P08_16.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10H08 5', mRNA
sequence
         (667 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9FQF0 Glutathione S-transferase GST 8 (EC 2.5.1.18) - Glycine m...   402   e-112
Q9FQF1 Glutathione S-transferase GST 7 (EC 2.5.1.18) - Glycine m...   365   e-101
Q84T17 Glutathione S-transferase - Phaseolus acutifolius (Tepary...   356   4e-98
Q9FQF2 Glutathione S-transferase GST 6 (EC 2.5.1.18) - Glycine m...   340   2e-93
Q43678 Auxin-induced protein (Fragment) - Vigna radiata               333   4e-91

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387966|gb|CA851173.1|CA851173 D10H07_P07_16.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10H07 5', mRNA
sequence
         (711 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q8LNG5 Putative ribosomal protein (Os10g0500500 protein) (Riboso...    30   5.9  
Q8S1U9 Putative xylanase inhibitor (Os01g0937200 protein) - Oryz...    30   7.7  
Q01JU0 H0505F09.1 protein - Oryza sativa (Rice)                        30   7.7  
Q2QMB7 Hypothetical protein - Oryza sativa (japonica cultivar-gr...    30   7.7  
O48949 Protein disulfide isomerase RB60 (EC 5.3.4.1) (Protein di...    30   7.7  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387965|gb|CA851172.1|CA851172 D10H06_P06_15.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10H06 5', mRNA
sequence
         (525 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q8RW12 Iron transport protein 2 - Ricinus communis (Castor bean)       32   1.1  
Q9M603 Cold acclimation responsive protein BudCAR5 - Medicago sa...    32   1.5  
Q941N0 Drought-induced protein - Retama raetam                         32   1.5  
Q1SR50 Dehydrin - Medicago truncatula (Barrel medic)                   32   1.5  
Q10BV2 Expressed protein - Oryza sativa (japonica cultivar-group)      32   1.5  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387964|gb|CA851171.1|CA851171 D10H05_P05_15.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10H05 5', mRNA
sequence
         (601 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q93YH4 ATP citrate lyase a-subunit (EC 4.1.3.8) - Lupinus albus ...   219   7e-57
Q9C522 ATP citrate lyase, putative; 3734-7120 (Putative ATP citr...   212   8e-55
Q93VT8 Putative ATP citrate lyase a-subunit (Os01g0300200 protei...   211   1e-54
Q9FGX1 ATP citrate lyase (ATP-citrate lyase subunit B) - Arabido...   211   2e-54
Q9AXR6 ATP:citrate lyase - Capsicum annuum (Bell pepper)              205   8e-53

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387963|gb|CA851170.1|CA851170 D10H04_P04_16.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10H04 5', mRNA
sequence
         (706 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q6I583 Putative peroxisomal Ca-dependent solute carrier (Os05g05...   255   1e-67
Q2PYY0 Mitochondrial carrier-like protein - Solanum tuberosum (P...   245   9e-65
O04619 A_IG002N01.16 protein (Putative carrier protein) (AT4g011...   241   2e-63
Q01C81 [C] KOG0749 Mitochondrial ADP/ATP carrier proteins - Ostr...   115   1e-25
Q9LY28 Peroxisomal Ca-dependent solute carrier-like protein - Ar...    82   2e-15

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387962|gb|CA851169.1|CA851169 D10H03_P03_16.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10H03 5', mRNA
sequence
         (616 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q8H189 40S ribosomal protein S20 - Arabidopsis thaliana (Mouse-e...   216   3e-56
Q10P27 40S ribosomal protein S20, putative, expressed (Os03g0249...   198   1e-50
Q8LNL2 Putative ribosomal protein S10p/S20e (Os10g0170200 protei...   196   5e-50
Q0DEU6 Os06g0134000 protein - Oryza sativa (japonica cultivar-gr...   191   2e-48
Q5UCF6 Ribosomal protein S10p/S20e - Zea mays (Maize)                 189   6e-48

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387961|gb|CA851168.1|CA851168 D10H02_P02_15.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10H02 5', mRNA
sequence
         (671 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1SU87 Zinc finger, C2H2-type - Medicago truncatula (Barrel medic)    205   1e-52
Q1T1Z0 Zinc finger, C2H2-type - Medicago truncatula (Barrel medic)    200   4e-51
Q1SU88 Zinc finger, C2H2-type - Medicago truncatula (Barrel medic)    176   6e-44
Q4LBA1 Putative Cys2-His2 zinc finger transcription factor - Jug...   144   3e-34
O22086 ZPT2-14 - Petunia hybrida (Petunia)                            137   4e-32

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387960|gb|CA851167.1|CA851167 D10H01_P01_15.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10H01 5', mRNA
sequence
         (149 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387959|gb|CA851166.1|CA851166 D10G12_N12_14.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10G12 5', mRNA
sequence
         (298 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387958|gb|CA851165.1|CA851165 D10G11_N11_14.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10G11 5', mRNA
sequence
         (663 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1SU87 Zinc finger, C2H2-type - Medicago truncatula (Barrel medic)    205   9e-53
Q1T1Z0 Zinc finger, C2H2-type - Medicago truncatula (Barrel medic)    200   4e-51
Q1SU88 Zinc finger, C2H2-type - Medicago truncatula (Barrel medic)    176   6e-44
Q4LBA1 Putative Cys2-His2 zinc finger transcription factor - Jug...   144   3e-34
O22086 ZPT2-14 - Petunia hybrida (Petunia)                            137   2e-32

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387957|gb|CA851164.1|CA851164 D10G10_N10_13.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10G10 5', mRNA
sequence
         (190 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q7Y0Z7 Bell-like homeodomain protein 2 - Solanum lycopersicum (T...    28   7.8  
Q1SHQ8 Putative fatty acid elongase - Medicago truncatula (Barre...    28   7.8  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387956|gb|CA851163.1|CA851163 D10G09_N09_13.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10G09 5', mRNA
sequence
         (167 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387955|gb|CA851162.1|CA851162 D10G08_N08_14.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10G08 5', mRNA
sequence
         (629 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1SWL9 Ribosomal protein L27e; KOW - Medicago truncatula (Barrel...   225   8e-59
Q9MAV8 Ribosomal protein L27 - Panax ginseng (Korean ginseng)         211   2e-54
Q0WRB8 Ribosomal protein - Arabidopsis thaliana (Mouse-ear cress)     211   2e-54
Q6K4T1 Putative 60S ribosomal protein L27 (Os02g0284600 protein)...   202   5e-52
Q7XC31 60S ribosomal protein L27, putative, expressed (Os10g0564...   201   1e-51

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387954|gb|CA851161.1|CA851161 D10G06_N06_13.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10G06 5', mRNA
sequence
         (14 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387953|gb|CA851160.1|CA851160 D10G05_N05_13.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10G05 5', mRNA
sequence
         (470 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q2HRR6 Hypothetical protein - Medicago truncatula (Barrel medic)       58   1e-08
Q67Z65 Low temperature and salt responsive protein LTI6B (At3g05...    58   1e-08
Q6EJA5 Clt1 - Poncirus trifoliata (Hardy orange)                       57   3e-08
Q2HRS6 Hypothetical protein - Medicago truncatula (Barrel medic)       56   4e-08
Q2HRT4 Hypothetical protein - Medicago truncatula (Barrel medic)       55   7e-08

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387952|gb|CA851159.1|CA851159 D10G04_N04_14.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10G04 5', mRNA
sequence
         (580 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9SMK5 Plasma membrane intrinsic polypeptide - Cicer arietinum (...    31   3.1  
Q9M3U5 DREPP2 protein - Nicotiana tabacum (Common tobacco)             30   5.3  
O49911 Plasma membrane polypeptide - Nicotiana tabacum (Common t...    30   5.3  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387951|gb|CA851158.1|CA851158 D10G03_N03_14.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10G03 5', mRNA
sequence
         (354 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q94LQ6 Putative transcription factor (Os10g0557600 protein) (GAT...    34   0.14 
Q1S9S7 Zinc finger, GATA-type - Medicago truncatula (Barrel medic)     33   0.19 
Q76DY1 AG-motif binding protein-3 - Nicotiana tabacum (Common to...    33   0.32 
Q7FYS6 T10I18.7 protein - Arabidopsis thaliana (Mouse-ear cress)       32   0.55 
Q8LIZ3 Putative AG-motif binding protein-4 (Os01g0745700 protein...    32   0.72 

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387950|gb|CA851157.1|CA851157 D10G02_N02_13.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10G02 5', mRNA
sequence
         (682 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1SU87 Zinc finger, C2H2-type - Medicago truncatula (Barrel medic)    205   1e-52
Q1T1Z0 Zinc finger, C2H2-type - Medicago truncatula (Barrel medic)    200   4e-51
Q1SU88 Zinc finger, C2H2-type - Medicago truncatula (Barrel medic)    176   6e-44
Q4LBA1 Putative Cys2-His2 zinc finger transcription factor - Jug...   144   3e-34
O22086 ZPT2-14 - Petunia hybrida (Petunia)                            137   4e-32

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387949|gb|CA851156.1|CA851156 D10G01_N01_13.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10G01 5', mRNA
sequence
         (688 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9LVF1 Emb|CAB45066.1 (AT3g21550/MIL23_11) - Arabidopsis thalian...   204   2e-52
Q9LVF4 Emb|CAB45066.1 (Hypothetical protein At3g21520) - Arabido...   192   6e-49
Q9FRC7 Hypothetical protein OSJNBa0013M12.6 - Oryza sativa (Rice)     179   6e-45
Q10KU0 Expressed protein (Os03g0370400 protein) - Oryza sativa (...   179   6e-45
Q7EYL4 Hypothetical protein P0503D09.101 (Os07g0645300 protein) ...   176   6e-44

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387948|gb|CA851155.1|CA851155 D10F12_L12_12.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10F12 5', mRNA
sequence
         (638 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q5QM03 Hypothetical protein P0455H03.1 (Os01g0508100 protein) (H...    37   0.068

>Q5QM03 Hypothetical protein P0455H03.1 (Os01g0508100 protein)
           (Hypothetical protein OSJNBa0094H06.34) - Oryza sativa
           (japonica cultivar-group)
          Length = 158

 Score = 36.6 bits (83), Expect = 0.068
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 4/94 (4%)
 Frame = +3

Query: 246 METFFALVRNFRDTRDRWMGLRSGDRKSKRGKIITA----KEENIVWKPTFQLEDFADEQ 413
           ++ F+AL+   R+ R+ W   R+GD  + +   +      ++   +W+PTF +EDFA E 
Sbjct: 77  VDRFYALLDEVREMRELWR--RNGDCVATKRTSVDGGQKKQDRQQLWRPTFVMEDFAFE- 133

Query: 414 ARCRNSLEPSASSQSKNCDKEDAAEKGIDLSLSL 515
                       SQ    +K+  +   +DLSLS+
Sbjct: 134 ---------LKGSQVVQPEKKVDSAPNLDLSLSM 158


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387947|gb|CA851154.1|CA851154 D10F11_L11_12.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10F11 5', mRNA
sequence
         (627 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q67IT9 Putative Phytosulfokine receptor (Os02g0153100 protein) -...    30   6.1  
Q66RK3 Putative leucine-rich repeat receptor-like kinase - Oryza...    30   6.1  
Q5UD34 Putative leucine-rich repeat receptor-like kinase - Oryza...    30   6.1  
Q67IT8 Putative Phytosulfokine receptor - Oryza sativa (japonica...    30   8.0  
Q0E3U9 Os02g0153200 protein - Oryza sativa (japonica cultivar-gr...    30   8.0  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387946|gb|CA851153.1|CA851153 D10F10_L10_11.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10F10 5', mRNA
sequence
         (37 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387945|gb|CA851152.1|CA851152 D10F09_L09_11.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10F09 5', mRNA
sequence
         (627 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1WCP1 Cytochrome P450 monooxygenase CYP94D24 (Fragment) - Glyci...   185   1e-46
Q9SAE8 F3F19.17 protein - Arabidopsis thaliana (Mouse-ear cress)       92   3e-32
Q84WE8 Putative cytochrome P450 - Arabidopsis thaliana (Mouse-ea...    92   3e-32
Q1SJU2 E-class P450, group I - Medicago truncatula (Barrel medic)     133   4e-31
Q9LYZ5 Cytochrome P450-like protein - Arabidopsis thaliana (Mous...    71   9e-26

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387944|gb|CA851151.1|CA851151 D10F08_L08_12.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10F08 5', mRNA
sequence
         (632 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q93Z89 Matrix metalloproteinase MMP2 - Glycine max (Soybean)           32   1.3  
Q5WMQ0 Hypothetical protein OSJNBa0053E01.2 - Oryza sativa (japo...    30   6.3  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387943|gb|CA851150.1|CA851150 D10F07_L07_12.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10F07 5', mRNA
sequence
         (304 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9XF70 Thioredoxin h - Hevea brasiliensis (Para rubber tree)          115   3e-26
Q1SGR2 Thioredoxin domain 2 - Medicago truncatula (Barrel medic)      100   9e-22
Q4ACU9 Thioredoxin h - Codonopsis lanceolata                           98   6e-21
Q2HIL3 At1g11530 - Arabidopsis thaliana (Mouse-ear cress)              97   2e-20
Q0J9V5 Os04g0629500 protein - Oryza sativa (japonica cultivar-gr...    87   1e-17

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387942|gb|CA851149.1|CA851149 D10F06_L06_11.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10F06 5', mRNA
sequence
         (334 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387941|gb|CA851148.1|CA851148 D10F05_L05_11.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10F05 5', mRNA
sequence
         (480 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q5GMM4 60S ribosomal protein L37a - Capsicum chinense (Scotch bo...   186   2e-47
Q0JKE6 Os01g0679700 protein (Os05g0557000 protein) - Oryza sativ...   184   8e-47
Q00VK4 [J] KOG0402 60S ribosomal protein L37 - Ostreococcus tauri     145   6e-35
Q2M3Z0 Ribosomal protein L37 - Phytophthora infestans (Potato la...   128   9e-30
Q9AVW4 60S ribosomal protein L37A - Guillardia theta (Cryptomona...   114   1e-25

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387940|gb|CA851147.1|CA851147 D10F04_L04_12.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10F04 5', mRNA
sequence
         (731 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q41063 Pea shoot-specific protein - Pisum sativum (Garden pea)         98   2e-20
Q9SJ99 Putative retroelement pol polyprotein - Arabidopsis thali...    52   2e-06
O24569 HOX1B protein - Zea mays (Maize)                                40   0.006
O80560 Putative inositol polyphosphate 5'-phosphatase (Inositol ...    39   0.017
Q712G3 Inositol 1,4,5-trisphosphate 5-phosphatase - Arabidopsis ...    39   0.023

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387939|gb|CA851146.1|CA851146 D10F03_L03_12.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10F03 5', mRNA
sequence
         (627 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q2PEQ5 Hypothetical protein - Trifolium pratense (Red clover)         140   4e-33
O04237 Transcription factor - Vicia faba var. minor                   135   8e-32
Q2PEZ8 Putative nuclear antigen homolog - Trifolium pratense (Re...   131   2e-30
Q2PES2 Putative nuclear antigen homolog - Trifolium pratense (Re...   131   2e-30
Q711N3 Salt tolerance protein 2 - Beta vulgaris (Sugar beet)          118   1e-26

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387938|gb|CA851145.1|CA851145 D10F02_L02_11.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10F02 5', mRNA
sequence
         (701 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9FKY8 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:...   267   3e-71
Q84WU3 Hypothetical protein At5g66930 - Arabidopsis thaliana (Mo...   239   6e-63
Q0INI1 Os12g0446700 protein - Oryza sativa (japonica cultivar-gr...   238   1e-62
Q93ZX0 Hypothetical protein At5g66930 - Arabidopsis thaliana (Mo...   238   2e-62
Q2QSI0 Glycosyl hydrolase family 9 protein, expressed (Os12g0428...    86   9e-17

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387937|gb|CA851144.1|CA851144 D10F01_L01_11.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10F01 5', mRNA
sequence
         (584 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q2HRK3 T-snare - Medicago truncatula (Barrel medic)                   163   4e-40
Q9SFY9 T22C5.15 - Arabidopsis thaliana (Mouse-ear cress)              134   3e-31
Q940U5 At1g27700/T22C5_14 - Arabidopsis thaliana (Mouse-ear cress)    134   3e-31
Q9SUM0 Hypothetical protein F9N11.90 (Hypothetical protein AT4g3...   119   9e-27
Q944G8 AT4g30240/F9N11_90 - Arabidopsis thaliana (Mouse-ear cress)    119   9e-27

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387936|gb|CA851143.1|CA851143 D10E12_J12_10.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10E12 5', mRNA
sequence
         (378 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q4TZ00 Ubiquitinating enzyme - Arabidopsis thaliana (Mouse-ear c...   115   5e-26
Q4TYZ9 Ubiquitinating enzyme (Putative ubiquitin conjugating enz...   114   8e-26
Q5YJR0 Ubiquitin-conjugating enzyme 9 (Fragment) - Hyacinthus or...   114   1e-25
Q4VSV2 Ubiquitin-conjugating enzyme UBC1 - Picea abies (Norway s...   114   1e-25
Q4TZ01 Ubiquitinating enzyme - Arabidopsis thaliana (Mouse-ear c...   114   1e-25

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387935|gb|CA851142.1|CA851142 D10E11_J11_10.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10E11 5', mRNA
sequence
         (208 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q8RV37 Putative serine/threonine kinase - Oryza sativa (Rice)          28   6.1  
Q7G719 Putative receptor-like protein kinase (Receptor-like prot...    28   6.1  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387934|gb|CA851141.1|CA851141 D10E10_J10_09.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10E10 5', mRNA
sequence
         (6 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387933|gb|CA851140.1|CA851140 D10E09_J09_09.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10E09 5', mRNA
sequence
         (343 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q6J338 Copper chaperone - Populus alba x Populus tremula var. gl...    37   0.013
Q6ZCF3 Putative copper chaperone (Os08g0205400 protein) - Oryza ...    37   0.022
Q9C7U6 Copper homeostasis factor, putative; 27145-26758 - Arabid...    36   0.028
Q94BT9 At1g66240/T6J19_6 - Arabidopsis thaliana (Mouse-ear cress)      36   0.028
Q5QL92 Putative copper chaperone - Oryza sativa (japonica cultiv...    34   0.11 

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387932|gb|CA851139.1|CA851139 D10E08_J08_10.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10E08 5', mRNA
sequence
         (391 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q75LF2 Putative reverse transcriptase (Retrotransposon protein, ...    44   2e-04
O82066 Proline-rich protein - Solanum tuberosum (Potato)               32   0.42 
Q9LPT2 F11F12.6 protein - Arabidopsis thaliana (Mouse-ear cress)       30   2.1  
Q9C6P8 Hypothetical protein F17J6.14 - Arabidopsis thaliana (Mou...    30   2.1  
Q9FH74 Similarity to protein kinase - Arabidopsis thaliana (Mous...    29   4.6  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387931|gb|CA851138.1|CA851138 D10E07_J07_10.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10E07 5', mRNA
sequence
         (257 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1S8I3 RNA-directed DNA polymerase (Reverse transcriptase); Expa...    29   4.6  

>Q1S8I3 RNA-directed DNA polymerase (Reverse transcriptase); Expansin/Lol pI
            - Medicago truncatula (Barrel medic)
          Length = 1306

 Score = 28.9 bits (63), Expect = 4.6
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 4/51 (7%)
 Frame = -3

Query: 198  GKTRSASCPLN----KNTHHITMCCHTCIVMSGYSKAIGPFIPP*SLCRKW 58
            G +   SCPL     ++ +H+ + C     +  +S  +G  IPP S+CR+W
Sbjct: 943  GISLDQSCPLCNSGLEDLNHLFLHCPAAKAV-WFSSPLGIHIPPNSMCREW 992


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387930|gb|CA851137.1|CA851137 D10E06_J06_09.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10E06 5', mRNA
sequence
         (75 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387929|gb|CA851136.1|CA851136 D10E05_J05_09.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10E05 5', mRNA
sequence
         (658 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387928|gb|CA851135.1|CA851135 D10E04_J04_10.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10E04 5', mRNA
sequence
         (678 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q0PIW2 HyPRP2 - Gossypium hirsutum (Upland cotton)                    118   2e-26
Q42487 Extensin like protein - Populus nigra (Lombardy poplar)        118   2e-26
Q6EAL9 Arachidonic acid-induced DEA1 - Solanum lycopersicum (Tom...   115   2e-25
Q9SAP3 Hybrid proline-rich protein - Catharanthus roseus (Rosy p...   113   6e-25
Q39574 14 kDa polypeptide - Catharanthus roseus (Rosy periwinkle...   113   6e-25

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387927|gb|CA851134.1|CA851134 D10E03_J03_10.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10E03 5', mRNA
sequence
         (656 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q7XUT3 OSJNBa0042L16.5 protein - Oryza sativa (Rice)                  144   2e-34
Q948Y8 VMP2 protein - Volvox carteri f. nagariensis                    38   0.032
Q6UU00 Hypothetical protein - Oryza sativa (japonica cultivar-gr...    33   1.0  
Q5ZDY5 Hypothetical protein P0410E01.26 - Oryza sativa (japonica...    31   3.0  
Q0JLA3 Os01g0613300 protein - Oryza sativa (japonica cultivar-gr...    31   3.0  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387926|gb|CA851133.1|CA851133 D10E02_J02_09.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10E02 5', mRNA
sequence
         (93 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387925|gb|CA851132.1|CA851132 D10E01_J01_09.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10E01 5', mRNA
sequence
         (59 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387924|gb|CA851131.1|CA851131 D10D12_H12_08.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10D12 5', mRNA
sequence
         (576 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9SWP6 Hypersensitive reaction associated Ca2+-binding protein -...   216   3e-56
Q9FDX6 NaCl-inducible Ca2+-binding protein-like; calmodulin-like...   157   2e-38
O22368 NaCl-inducible Ca2+-binding protein - Arabidopsis thalian...   145   1e-34
Q10MF3 EF hand family protein, expressed (Os03g0310800 protein) ...   143   3e-34
Q0IQB6 Os12g0132300 protein - Oryza sativa (japonica cultivar-gr...    64   3e-10

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387923|gb|CA851130.1|CA851130 D10D11_H11_08.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10D11 5', mRNA
sequence
         (573 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q7M213 Metallothionein - Glycine max (Soybean)                         99   7e-21
Q75NI1 Type 2 metallothionein - Glycine max (Soybean)                  93   6e-19
Q75NI3 Type 2 metallothionein - Phaseolus aureus (Mung bean) (Vi...    92   1e-18
Q45W72 Metallothionein-like protein (Type 2 metallothionein) - A...    91   2e-18
Q75NH9 Type 2 metallothionein - Phaseolus angularis (Adzuki bean...    89   9e-18

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387922|gb|CA851129.1|CA851129 D10D10_H10_07.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10D10 5', mRNA
sequence
         (479 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q945L0 AT4g28060/T13J8_170 (Hypothetical protein At5g57815) (Hyp...   155   5e-38
Q8LD51 Cytochrome c oxidase subunit 6b - Arabidopsis thaliana (M...   154   2e-37
Q9SXV0 Cytochrome c oxidase subunit 6b-1 (Os03g0390400 protein) ...   152   6e-37
Q8LHA3 Putative cytochrome c oxidase subunit 6b-1 (Os07g0621600 ...   150   2e-36
Q01IC1 OSIGBa0092E01.14 protein - Oryza sativa (Rice)                 149   3e-36

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387921|gb|CA851128.1|CA851128 D10D09_H09_07.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10D09 5', mRNA
sequence
         (586 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q8S4C0 Isoflavone synthase - Pueraria lobata (Kudzu vine)              30   5.4  
Q9SD53 Hypothetical protein F13I12.250 (Hypothetical protein At3...    30   7.0  
Q56YU5 Hypothetical protein At3g47200 - Arabidopsis thaliana (Mo...    30   7.0  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387920|gb|CA851127.1|CA851127 D10D08_H08_08.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10D08 5', mRNA
sequence
         (450 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9ZPP5 Berberine bridge enzyme (EC 1.21.3.3) - Berberis stolonif...    29   5.0  
Q014G4 [J] KOG0465 Mitochondrial elongation factor - Ostreococcu...    29   6.5  
Q2QVZ3 Retrotransposon protein, putative, unclassified - Oryza s...    29   6.6  
Q9LJN4 Beta-1,4-xylosidase - Arabidopsis thaliana (Mouse-ear cress)    28   8.4  
Q336Y0 Amine oxidase, flavin-containing family protein, expresse...    28   8.4  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387919|gb|CA851126.1|CA851126 D10D07_H07_08.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10D07 5', mRNA
sequence
         (634 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q6T6J0 Pathogenesis-related class 10 protein SPE-16 (Fragment) -...   221   2e-57
Q9SMK8 Putative ABA-responsive protein - Cicer arietinum (Chickp...   215   8e-56
Q8W1M7 Drought-induced protein RPR-10 - Retama raetam                 213   3e-55
Q6YNP8 Cold responsive protein TRVSP - Trifolium repens (Creepin...   211   2e-54
Q9SPB2 LlPR10.1C - Lupinus luteus (European yellow lupin)             210   3e-54

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387918|gb|CA851125.1|CA851125 D10D06_H06_07.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10D06 5', mRNA
sequence
         (660 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q3LHL1 Short chain dehydrogenase - Solanum tuberosum (Potato)         234   1e-61
Q9SQR4 Putative short-chain type dehydrogenase/reductase - Arabi...   232   9e-61
Q9FK50 Brn1-like protein - Arabidopsis thaliana (Mouse-ear cress)     220   4e-57
Q9SQR2 Putative short-chain type dehydrogenase/reductase - Arabi...   202   1e-51
Q9SVQ9 Short-chain alcohol dehydrogenase like protein (AT4g13180...   201   1e-51

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387917|gb|CA851124.1|CA851124 D10D05_H05_07.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10D05 5', mRNA
sequence
         (656 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q6BCT8 Phototropin - Physcomitrella patens (Moss)                      30   5.1  

>Q6BCT8 Phototropin - Physcomitrella patens (Moss)
          Length = 1133

 Score = 30.4 bits (67), Expect = 5.1
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 7/55 (12%)
 Frame = +3

Query: 12  GQIPSKKLNNPTQTYPLHSNQAKPSP-------APQSNSIN*TSR*ASLPWQITI 155
           G  PS+ +  P  T P+ S+ +KP+P        PQS     T   A LPW I +
Sbjct: 90  GPKPSQNVQ-PASTLPMSSSASKPAPLPQIPPAVPQSYMSETTKAKAPLPWDINL 143


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387916|gb|CA851123.1|CA851123 D10D04_H04_08.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10D04 5', mRNA
sequence
         (707 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q10LL5 Pre-mRNA splicing factor SF2, putative, expressed - Oryza...   276   4e-74
Q10LL4 Pre-mRNA splicing factor SF2, putative, expressed - Oryza...   276   4e-74
Q0DRZ2 Os03g0344100 protein - Oryza sativa (japonica cultivar-gr...   276   4e-74
Q64HC3 ASF/SF2-like pre-mRNA splicing factor SRP32 - Zea mays (M...   270   4e-72
Q64HC2 ASF/SF2-like pre-mRNA splicing factor SRP32' - Zea mays (...   270   4e-72

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387915|gb|CA851122.1|CA851122 D10D03_H03_08.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10D03 5', mRNA
sequence
         (549 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q10LL5 Pre-mRNA splicing factor SF2, putative, expressed - Oryza...   100   6e-43
Q0DRZ2 Os03g0344100 protein - Oryza sativa (japonica cultivar-gr...   100   6e-43
Q10LL4 Pre-mRNA splicing factor SF2, putative, expressed - Oryza...   100   6e-43
Q64HC3 ASF/SF2-like pre-mRNA splicing factor SRP32 - Zea mays (M...   100   1e-42
Q64HC2 ASF/SF2-like pre-mRNA splicing factor SRP32' - Zea mays (...   100   1e-42

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387914|gb|CA851121.1|CA851121 D10D02_H02_07.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10D02 5', mRNA
sequence
         (262 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q8RV37 Putative serine/threonine kinase - Oryza sativa (Rice)          28   6.0  
Q7G719 Putative receptor-like protein kinase (Receptor-like prot...    28   6.0  
Q0E469 Os02g0133500 protein - Oryza sativa (japonica cultivar-gr...    28   7.8  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387913|gb|CA851120.1|CA851120 D10D01_H01_07.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10D01 5', mRNA
sequence
         (567 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q41908 Photosystem II 7kD protein - Arabidopsis thaliana (Mouse-...    87   4e-17
O04338 Photosystem II reaction center 6.1KD protein (At2g30570/T...    87   4e-17
Q39194 Component of 6.1 kDa polypeptide of photosystem II reacti...    85   1e-16
Q8W536 Photosystem II reaction center (Fragment) - Retama raetam       79   1e-14
Q5ZBY9 Putative photosystem II reaction center W protein (Os01g0...    74   2e-13

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387912|gb|CA851119.1|CA851119 D10C12_F12_06.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10C12 5', mRNA
sequence
         (333 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q6Y1E9 Cysteine protease 14 - Trifolium repens (Creeping white c...    58   9e-09
Q6Y1F0 Cysteine protease 14 - Trifolium repens (Creeping white c...    56   4e-08
Q1SXV1 Peptidase C1A, papain - Medicago truncatula (Barrel medic)      55   8e-08
Q0WT15 Putative cysteine proteinase - Arabidopsis thaliana (Mous...    47   2e-05
Q84M26 Cysteine protease-4 - Helianthus annuus (Common sunflower)      46   3e-05

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387911|gb|CA851118.1|CA851118 D10C11_F11_06.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10C11 5', mRNA
sequence
         (729 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9M451 Calmodulin-binding protein (Fragment) - Cicer arietinum (...   293   3e-79
P93370 Calmodulin-binding protein - Nicotiana tabacum (Common to...   228   2e-59
Q9FKL6 Calmodulin-binding protein - Arabidopsis thaliana (Mouse-...   213   5e-55
Q944Q2 At2g18750/MSF3.13 - Arabidopsis thaliana (Mouse-ear cress)     188   1e-47
Q9SW03 Putative calmodulin-binding protein - Arabidopsis thalian...   184   3e-46

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387910|gb|CA851117.1|CA851117 D10C10_F10_05.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10C10 5', mRNA
sequence
         (707 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9ZS53 Apgm protein (EC 5.4.2.1) - Malus domestica (Apple) (Malu...   403   e-112
Q9SDL3 Cofactor-independent phosphoglyceromutase (EC 5.4.2.1) - ...   397   e-110
Q5KQH5 'putative 2,3-bisphosphoglycerate-independent phosphoglyc...   395   e-110
Q94AY0 At1g09780/F21M12_17 - Arabidopsis thaliana (Mouse-ear cress)   394   e-109
Q93ZF2 Putative 2,3-bisphosphoglycerate-independent phosphoglyce...   394   e-109

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387909|gb|CA851116.1|CA851116 D10C09_F09_05.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10C09 5', mRNA
sequence
         (303 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9T0C6 Hypothetical protein AT4g11580 - Arabidopsis thaliana (Mo...    28   7.8  

>Q9T0C6 Hypothetical protein AT4g11580 - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 333

 Score = 28.1 bits (61), Expect = 7.8
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 1/51 (1%)
 Frame = +3

Query: 63  WHTVQLSLLNSFD*P-VFSFAGSNVLIFFF*QTFTYKYIANNILFSLVATF 212
           W+TV L+ L   D   +F+F      IFF+     +K+   N+L  +++ F
Sbjct: 55  WNTVDLTNLQELDVSRIFNFKDKERPIFFYKHPVDHKHGLTNLLTKIISRF 105


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387908|gb|CA851115.1|CA851115 D10C08_F08_06.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10C08 5', mRNA
sequence
         (737 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q39882 Nodulin-26 - Glycine max (Soybean)                             397   e-110
Q9XGG6 Putative tonoplast intrinsic protein - Pisum sativum (Gar...   391   e-108
Q9LKJ6 Water-selective transport intrinsic membrane protein 1 - ...   379   e-105
Q41616 Gamma-TIP-like protein (Fragment) - Trifolium repens (Cre...   374   e-103
Q5DVT4 Tonoplast intrinsic protein 1;1 - Mimosa pudica (Sensitiv...   372   e-103

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387907|gb|CA851114.1|CA851114 D10C07_F07_06.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10C07 5', mRNA
sequence
         (637 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1T4I0 Plant lipid transfer/seed storage/trypsin-alpha amylase i...   162   6e-40
Q41125 Proline-rich 14 kDa protein - Phaseolus vulgaris (Kidney ...   148   2e-35
Q42044 Expressed protein (At2g45180) (Putative proline-rich prot...   129   8e-30
Q9ZWI6 ZmGR1a protein - Zea mays (Maize)                              121   2e-27
Q9ST25 ZmGR1b protein - Zea mays (Maize)                              120   5e-27

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387906|gb|CA851113.1|CA851113 D10C05_F05_05.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10C05 5', mRNA
sequence
         (441 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q8L5T1 Peptidylprolyl isomerase (Cyclophilin) (EC 5.2.1.8) - Bet...    96   3e-20
Q708X2 Cyclophilin-type peptidyl-prolyl cis-trans isomerase (EC ...    95   7e-20
Q52UN0 Cyclophilin - Cucumis sativus (Cucumber)                        95   7e-20
Q41119 Cyclophilin - Phaseolus vulgaris (Kidney bean) (French bean)    95   7e-20
Q8W435 CYP1 - Vigna radiata                                            95   9e-20

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387905|gb|CA851112.1|CA851112 D10C04_F04_06.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10C04 5', mRNA
sequence
         (662 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1T4I0 Plant lipid transfer/seed storage/trypsin-alpha amylase i...   162   7e-40
Q41125 Proline-rich 14 kDa protein - Phaseolus vulgaris (Kidney ...   148   2e-35
Q42044 Expressed protein (At2g45180) (Putative proline-rich prot...   129   8e-30
Q9ZWI6 ZmGR1a protein - Zea mays (Maize)                              121   2e-27
Q9ST25 ZmGR1b protein - Zea mays (Maize)                              120   5e-27

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387904|gb|CA851111.1|CA851111 D10C03_F03_06.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10C03 5', mRNA
sequence
         (392 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q0PY03 Glutathione S-transferase isoform 2 - Castanea crenata (J...    74   1e-13
Q8H9E7 Glutathione S-transferase - Cucurbita maxima (Pumpkin) (W...    74   1e-13
Q84VH2 Glutathione S-transferase U1 - Malva pusilla (Dwarf mallow)     72   4e-13
O49821 Glutathione transferase (EC 2.5.1.18) - Carica papaya (Pa...    72   4e-13
Q9AYN3 Glutathione S-transferase - Matricaria chamomilla               72   5e-13

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387903|gb|CA851110.1|CA851110 D10C02_F02_05.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10C02 5', mRNA
sequence
         (698 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9SEW5 Amino acid transporter c (Fragment) - Vicia faba (Broad b...   304   2e-82
Q8S3N9 Putative amino acid transport protein AAP2 (Os04g0659800 ...   250   4e-66
Q01HZ8 OSIGBa0132E09-OSIGBa0108L24.20 protein - Oryza sativa (Rice)   248   1e-65
Q8GZV3 Amino acid transporter - Solanum lycopersicum (Tomato) (L...   233   6e-61
P93561 Amino acid transporter - Solanum tuberosum (Potato)            224   2e-58

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387902|gb|CA851109.1|CA851109 D10C01_F01_05.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10C01 5', mRNA
sequence
         (157 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387901|gb|CA851108.1|CA851108 D10B12_D12_04.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10B12 5', mRNA
sequence
         (238 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q0PJH3 MYB transcription factor MYB83 - Glycine max (Soybean)          32   0.56 
Q0PJK8 MYB transcription factor MYB75 - Glycine max (Soybean)          30   2.8  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387900|gb|CA851107.1|CA851107 D10B11_D11_04.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10B11 5', mRNA
sequence
         (436 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9M7E6 Elongation factor 1 alpha - Zea mays (Maize)                    36   0.050
Q9M7E5 Elongation factor 1 alpha - Zea mays (Maize)                    36   0.050
Q9M7E3 Elongation factor 1 alpha - Zea mays (Maize)                    36   0.050
Q9M7E2 Elongation factor 1 alpha - Zea mays (Maize)                    36   0.050
Q9FYV3 Elongation factor - Saccharum officinarum (Sugarcane)           36   0.050

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387899|gb|CA851106.1|CA851106 D10B10_D10_03.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10B10 5', mRNA
sequence
         (366 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387898|gb|CA851105.1|CA851105 D10B09_D09_03.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10B09 5', mRNA
sequence
         (106 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387897|gb|CA851104.1|CA851104 D10B08_D08_04.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10B08 5', mRNA
sequence
         (518 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q6Z2M5 Putative small nuclear ribonucleoprotein polypeptide E (O...   159   5e-39
Q9ZV45 Putative small nuclear ribonucleoprotein E - Arabidopsis ...   158   8e-39
Q8LAK5 Small nuclear ribonucleoprotein homolog (At4g30330) - Ara...   158   8e-39
Q9M0C7 Small nuclear ribonucleoprotein homolog - Arabidopsis tha...   154   1e-37
Q0J803 Os08g0151400 protein (Fragment) - Oryza sativa (japonica ...   121   1e-27

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387896|gb|CA851103.1|CA851103 D10B07_D07_04.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10B07 5', mRNA
sequence
         (679 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q06A73 PHD1 - Glycine max (Soybean)                                   288   9e-78
Q06A77 PHD3 - Glycine max (Soybean)                                   248   1e-65
Q1SCT5 Zinc finger, RING-type; Zinc finger, FYVE/PHD-type (PHD3)...   238   1e-62
Q06A74 PHD6 - Glycine max (Soybean)                                   228   2e-59
Q0WWI3 Nucleic acid binding protein-like - Arabidopsis thaliana ...   227   3e-59

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387895|gb|CA851102.1|CA851102 D10B06_D06_03.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10B06 5', mRNA
sequence
         (224 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9LN68 F18O14.2 (At1g19300) (At1g19300/F18O14_13) - Arabidopsis ...    28   7.8  
Q8L5Z6 Hypothetical protein At1g19300 - Arabidopsis thaliana (Mo...    28   7.8  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387894|gb|CA851101.1|CA851101 D10B05_D05_03.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10B05 5', mRNA
sequence
         (708 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q69NP6 Hypothetical protein OSJNBb0015B15.9 - Oryza sativa (japo...    32   2.6  
Q4ABZ4 117M18_26 - Brassica campestris (Field mustard)                 31   3.4  
Q1SYP3 Leucine Rich Repeat, putative - Medicago truncatula (Barr...    31   4.5  
Q0WWY1 Regulator of chromosome condensation-like protein - Arabi...    31   4.5  
O80604 T27I1.15 protein - Arabidopsis thaliana (Mouse-ear cress)       30   5.8  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387893|gb|CA851100.1|CA851100 D10B04_D04_04.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10B04 5', mRNA
sequence
         (684 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387892|gb|CA851099.1|CA851099 D10B03_D03_04.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10B03 5', mRNA
sequence
         (464 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1S278 Proteinase inhibitor I13, potato inhibitor I - Medicago t...   120   2e-27
Q8LNY1 Protease inhibitor 1 (Fragment) - Zinnia elegans (Zinnia)       97   2e-20
Q8LNY0 Protease inhibitor 2 (Fragment) - Zinnia elegans (Zinnia)       92   7e-19
Q41361 Pathogenesis-related protein PR-6 type (Fragment) - Sambu...    88   1e-17
Q6YEY6 Protease inhibitor - Vitis vinifera (Grape)                     87   3e-17

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387891|gb|CA851098.1|CA851098 D10B02_D02_03.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10B02 5', mRNA
sequence
         (447 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q5TKD9 Hypothetical protein OSJNBa0017O06.10 - Oryza sativa (jap...    30   2.2  
Q94HZ3 Putative transcription factor - Oryza sativa (Rice)             30   2.8  
Q8S773 Hypothetical protein OSJNBa0093I09.24 - Oryza sativa (Rice)     30   2.8  
Q8S602 Hypothetical protein OSJNBa0073L20.4 - Oryza sativa (japo...    30   2.8  
Q337B6 Expressed protein - Oryza sativa (japonica cultivar-group)      30   2.8  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387890|gb|CA851097.1|CA851097 D10B01_D01_03.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10B01 5', mRNA
sequence
         (63 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387889|gb|CA851096.1|CA851096 D10A12_B12_02.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10A12 5', mRNA
sequence
         (318 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387888|gb|CA851095.1|CA851095 D10A11_B11_02.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10A11 5', mRNA
sequence
         (708 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q76N23 Histone H3 - Nicotiana tabacum (Common tobacco)                264   2e-70
Q6LB28 Histone H3 variant H3.3 - Solanum lycopersicum (Tomato) (...   264   2e-70
Q3ZDK1 Histone 3 - Picea abies (Norway spruce) (Picea excelsa)        264   2e-70
Q3YMQ6 Histone H3.1 (Histone H3.2) - Craterostigma plantagineum       264   2e-70
Q06AS1 Histone H3 - Robinia pseudoacacia (Black locust)               264   2e-70

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387887|gb|CA851094.1|CA851094 D10A10_B10_01.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10A10 5', mRNA
sequence
         (686 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q2QQW2 DEAD/DEAH box helicase family protein, expressed - Oryza ...    39   0.012
Q0INC5 Os12g0481100 protein (Fragment) - Oryza sativa (japonica ...    39   0.012
Q9M9S5 F14L17.15 protein - Arabidopsis thaliana (Mouse-ear cress)      37   0.045
Q8LAE0 Hypothetical protein - Arabidopsis thaliana (Mouse-ear cr...    37   0.045
Q8GZ87 Hypothetical protein At1g14380/F14L17_12 - Arabidopsis th...    37   0.045

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387886|gb|CA851093.1|CA851093 D10A09_B09_01.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10A09 5', mRNA
sequence
         (439 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1SJ90 E-class P450, group I - Medicago truncatula (Barrel medic)     115   7e-26
P93148 Cytochrome P450 (Fragment) - Glycyrrhiza echinata (Licorice)   104   9e-23
Q69WX6 Putative cytochrome P450 (Os06g0613600 protein) - Oryza s...    94   1e-19
Q1SJ88 E-class P450, group I - Medicago truncatula (Barrel medic)      83   4e-16
Q93XJ3 Flavone synthase II - Perilla frutescens var. crispa            82   6e-16

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387885|gb|CA851092.1|CA851092 D10A08_B08_02.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10A08 5', mRNA
sequence
         (697 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1S7P5 Ribosomal protein L15e - Medicago truncatula (Barrel medic)    343   2e-94
Q8H8S1 Ribosomal protein L15 (Os03g0598800 protein) (60S ribosom...   333   2e-91
Q2A9A8 60S ribosomal protein L15 - Brassica oleracea (Wild cabbage)   332   9e-91
Q0WWU9 60S ribosomal protein L15 homolog - Arabidopsis thaliana ...   332   9e-91
Q6L5M2 Ribosomal protein - Bromus inermis (Smooth brome grass)        324   2e-88

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387884|gb|CA851091.1|CA851091 D10A07_B07_02.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10A07 5', mRNA
sequence
         (80 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387883|gb|CA851090.1|CA851090 D10A06_B06_01.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10A06 5', mRNA
sequence
         (387 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q94LQ6 Putative transcription factor (Os10g0557600 protein) (GAT...    34   0.14 
Q1S9S7 Zinc finger, GATA-type - Medicago truncatula (Barrel medic)     33   0.19 
Q76DY1 AG-motif binding protein-3 - Nicotiana tabacum (Common to...    33   0.32 
Q7FYS6 T10I18.7 protein - Arabidopsis thaliana (Mouse-ear cress)       32   0.55 
Q8LIZ3 Putative AG-motif binding protein-4 (Os01g0745700 protein...    32   0.72 

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387882|gb|CA851089.1|CA851089 D10A05_B05_01.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10A05 5', mRNA
sequence
         (684 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q8H812 Putative DNAJ protein - Oryza sativa (japonica cultivar-g...   138   2e-32

>Q8H812 Putative DNAJ protein - Oryza sativa (japonica cultivar-group)
          Length = 515

 Score =  138 bits (347), Expect = 2e-32
 Identities = 57/87 (65%), Positives = 71/87 (81%)
 Frame = +1

Query: 157 DAQVRKNKLQCYADIDSGLWGWSCKSTMIARENCALRCLSPACYELIYESDPLEEGEKDF 336
           D ++R+ K  CY D+++GLWGW+CKS+   +ENC LRCLSP CY+LIY  DPLEEGE D+
Sbjct: 427 DNEIREKKSACYTDVENGLWGWACKSSATEKENCVLRCLSPECYDLIYGGDPLEEGELDY 486

Query: 337 IRSQEYKYCMHKLSMGESLEGVKGAFS 417
           IR  EYKYCMHK S+GESL+GVKG+FS
Sbjct: 487 IRGHEYKYCMHKSSLGESLDGVKGSFS 513


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387881|gb|CA851088.1|CA851088 D10A04_B04_02.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10A04 5', mRNA
sequence
         (616 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q5Z6T9 Hypothetical protein P0551A03.36 - Oryza sativa (japonica...    32   1.5  
Q9SIN4 Hypothetical protein At2g42550 - Arabidopsis thaliana (Mo...    32   2.0  
Q8H9A3 Similar to A. thaliana AT4g08590 - Arabis gemmifera             31   3.5  
Q6Z5I2 Zinc finger (C3HC4-type RING finger)-like protein - Oryza...    31   3.5  
Q84S46 Hypothetical protein OJ9990_A01.121 (Hypothetical protein...    30   5.9  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387880|gb|CA851087.1|CA851087 D10A03_B03_02.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10A03 5', mRNA
sequence
         (633 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q58NA5 Plus agglutinin (Fragment) - Chlamydomonas incerta              44   5e-04
Q8LPG9 Putative SF16 protein (SF16 protein (Helianthus annuus) l...    43   7e-04
O22835 Putative SF16 protein (Helianthus annuus) - Arabidopsis t...    43   7e-04
Q9FTC2 Gamma-gliadin (Fragment) - Aegilops speltoides (Goatgrass)      43   0.001
Q9FR41 Secalin - Secale cereale (Rye)                                  42   0.002

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387879|gb|CA851086.1|CA851086 D10A02_B02_01.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10A02 5', mRNA
sequence
         (419 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387878|gb|CA851085.1|CA851085 D10A01_B01_01.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D10A01 5', mRNA
sequence
         (43 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387877|gb|CA851084.1|CA851084 D09H11_O11_16.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09H11 5', mRNA
sequence
         (669 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1STY4 HAD-superfamily hydrolase subfamily IA, variant 3; Epoxid...   348   1e-95
Q8VZP1 Putative GS1 protein - Arabidopsis thaliana (Mouse-ear cr...   326   5e-89
Q8GW23 Hypothetical protein At4g25840/F14M19_120 (At4g25840) - A...   318   1e-86
Q8L8P9 GS1-like protein - Arabidopsis thaliana (Mouse-ear cress)      318   1e-86
Q9FKM6 GS1-like protein - Arabidopsis thaliana (Mouse-ear cress)      303   3e-82

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387876|gb|CA851083.1|CA851083 D09H10_O10_15.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09H10 5', mRNA
sequence
         (660 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1ST43 Integrase, catalytic region; Peptidase aspartic, catalyti...    35   0.21 
Q9FY32 Manganese superoxide dismutase (EC 1.15.1.1) (Fragment) -...    32   1.4  
Q6L4D5 Hypothetical protein OSJNBa0088M05.5 (Os05g0380800 protei...    31   3.0  
Q9FY33 Manganese superoxide dismutase (EC 1.15.1.1) (Fragment) -...    31   3.9  
O65324 Superoxide dismutase - Raphanus sativus (Radish)                30   5.1  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387875|gb|CA851082.1|CA851082 D09H09_O09_15.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09H09 5', mRNA
sequence
         (85 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387874|gb|CA851081.1|CA851081 D09H08_O08_16.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09H08 5', mRNA
sequence
         (334 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q6Y1E9 Cysteine protease 14 - Trifolium repens (Creeping white c...    97   2e-20
Q6Y1F0 Cysteine protease 14 - Trifolium repens (Creeping white c...    95   7e-20
Q1SXV1 Peptidase C1A, papain - Medicago truncatula (Barrel medic)      94   2e-19
Q0WT15 Putative cysteine proteinase - Arabidopsis thaliana (Mous...    87   1e-17
Q84M26 Cysteine protease-4 - Helianthus annuus (Common sunflower)      85   7e-17

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387873|gb|CA851080.1|CA851080 D09H07_O07_16.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09H07 5', mRNA
sequence
         (425 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9XEV9 Elongation factor 1-alpha - Nicotiana tabacum (Common tob...    36   0.035
Q9M7E6 Elongation factor 1 alpha - Zea mays (Maize)                    36   0.035
Q9M7E5 Elongation factor 1 alpha - Zea mays (Maize)                    36   0.035
Q9M7E3 Elongation factor 1 alpha - Zea mays (Maize)                    36   0.035
Q9FYV3 Elongation factor - Saccharum officinarum (Sugarcane)           36   0.035

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387872|gb|CA851079.1|CA851079 D09H06_O06_15.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09H06 5', mRNA
sequence
         (653 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q8L5Q7 Putative quinone oxidoreductase (EC 1.6.5.5) - Cicer arie...   276   4e-74
Q6NQE2 Hypothetical protein At4g27270 - Arabidopsis thaliana (Mo...   263   4e-70
Q9LSQ5 1,4-benzoquinone reductase-like; Trp repressor binding pr...   263   5e-70
Q9XH74 Hypothetical protein p78RF - Prunus armeniaca (Apricot)        261   2e-69
Q6ZKI0 Putative quinone-oxidoreductase QR2 (Os08g0139200 protein...   256   4e-68

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387871|gb|CA851078.1|CA851078 D09H05_O05_15.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09H05 5', mRNA
sequence
         (46 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387870|gb|CA851077.1|CA851077 D09H04_O04_16.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09H04 5', mRNA
sequence
         (41 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387869|gb|CA851076.1|CA851076 D09H03_O03_16.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09H03 5', mRNA
sequence
         (584 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q3HRX4 40S ribosomal protein S17-like protein - Solanum tuberosu...   211   2e-54
Q6RJY3 40S ribosomal protein S17 - Capsicum annuum (Bell pepper)      207   1e-53
Q8H7V0 Putative 40S ribosomal protein S17 (Os03g0109500 protein)...   199   7e-51
Q7XEQ3 40S ribosomal protein S17-4, putative, expressed (Os10g04...   192   8e-49
Q01A77 Inframe stop codon - Ostreococcus tauri                        187   3e-47

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387868|gb|CA851075.1|CA851075 D09H02_O02_15.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09H02 5', mRNA
sequence
         (416 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9FIL6 Protein-tyrosine kinase (At5g58950) - Arabidopsis thalian...    29   4.0  
Q8W0Z2 AT5g58950/k19m22_150 - Arabidopsis thaliana (Mouse-ear cr...    29   4.0  
Q2QVZ3 Retrotransposon protein, putative, unclassified - Oryza s...    29   5.3  
Q00VR5 [I] KOG1680 Enoyl-CoA hydratase - Ostreococcus tauri            29   5.3  
Q6F3A4 Putative gypsy type transposon (Retrotransposon protein, ...    28   6.9  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387867|gb|CA851074.1|CA851074 D09H01_O01_15.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09H01 5', mRNA
sequence
         (435 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q43443 Phosphoinositide-specific phospholipase C P13 - Glycine m...   153   3e-38
Q43439 Phosphatidylinositol-specific phospholipase C - Glycine m...   149   3e-37
Q93YX8 Phosphoinositide-specific phospholipase C (PLC) - Medicag...   141   6e-34
Q2PEW5 Putative phosphoinositide specific phospholipase C - Trif...   140   2e-33
O24297 Phospholipase C - Pisum sativum (Garden pea)                   140   2e-33

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387866|gb|CA851073.1|CA851073 D09G12_M12_14.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09G12 5', mRNA
sequence
         (633 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q2HTK5 H+-transporting two-sector ATPase, alpha/beta subunit, ce...   104   2e-22
Q1S7B8 RNA-directed DNA polymerase (Reverse transcriptase) - Med...   103   4e-22
Q1RXD8 RNA-directed DNA polymerase (Reverse transcriptase) - Med...   103   6e-22
Q1SSC3 Hypothetical protein - Medicago truncatula (Barrel medic)      101   2e-21
Q1T4N4 Polynucleotidyl transferase, Ribonuclease H fold - Medica...    94   4e-19

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387865|gb|CA851072.1|CA851072 D09G11_M11_14.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09G11 5', mRNA
sequence
         (459 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q5VNJ3 Hypothetical protein OJ1123_G09.14 - Oryza sativa (japoni...    33   0.49 
Q5I7F3 Aux/IAA1 (Fragment) - Avena sativa (Oat)                        33   0.49 
Q8H0A9 Transposon protein, putative, unclassified - Oryza sativa...    32   1.1  
Q018S3 Chromosome 05 contig 1, DNA sequence. (Fragment) - Ostreo...    31   1.4  
Q5VRF4 Putative prolin rich protein (Os06g0168700 protein) - Ory...    30   2.4  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387864|gb|CA851071.1|CA851071 D09G10_M10_13.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09G10 5', mRNA
sequence
         (707 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9LYF9 Clathrin binding protein-like - Arabidopsis thaliana (Mou...    38   0.036
Q9LH95 Arabidopsis thaliana genomic DNA, chromosome 3, BAC clone...    37   0.062
Q8S949 Kinesin-like protein NACK2 - Nicotiana tabacum (Common to...    37   0.062
O09451 RNA polymerase II largest subunit (Fragment) - Bonnemaiso...    35   0.31 
Q38GA3 Target of rapamycin kinase - Chlamydomonas reinhardtii          34   0.40 

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387863|gb|CA851070.1|CA851070 D09G09_M09_13.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09G09 5', mRNA
sequence
         (646 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q5NKQ3 Putative NAM (No apical meristem) protein - Zea mays (Maize)    30   5.0  
Q8H7Z7 Putative gypsy-type retrotransposon RIRE2 protein (Retrot...    30   8.6  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387862|gb|CA851069.1|CA851069 D09G08_M08_14.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09G08 5', mRNA
sequence
         (313 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9FI44 Genomic DNA, chromosome 5, TAC clone:K3K7 (Hypothetical p...    32   0.55 
Q8LBK3 Hypothetical protein - Arabidopsis thaliana (Mouse-ear cr...    32   0.55 
Q2V2Z7 Protein At5g51040 - Arabidopsis thaliana (Mouse-ear cress)      32   0.55 

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387861|gb|CA851068.1|CA851068 D09G07_M07_14.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09G07 5', mRNA
sequence
         (669 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387860|gb|CA851067.1|CA851067 D09G06_M06_13.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09G06 5', mRNA
sequence
         (566 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q6Z565 Brain protein 44-like (Os08g0412500 protein) - Oryza sati...   137   2e-32
Q5XLE2 Brain protein 44-like - Zea mays (Maize)                       137   2e-32
Q6H4I2 Brain protein 44-like (Os09g0373000 protein) - Oryza sati...   136   4e-32
Q949R9 Hypothetical protein At5g20090 (Hypothetical protein) - A...   135   6e-32
Q6ZB58 Light induced protein like (Os08g0344300 protein) - Oryza...    74   2e-13

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387859|gb|CA851066.1|CA851066 D09G05_M05_13.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09G05 5', mRNA
sequence
         (637 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q7XPM7 OSJNBa0060D06.17 protein (Os04g0653100 protein) - Oryza s...   108   1e-23
Q94A32 AT3g43520/T18D12_90 - Arabidopsis thaliana (Mouse-ear cress)    78   2e-14
Q8LC37 Hypothetical protein - Arabidopsis thaliana (Mouse-ear cr...    78   2e-14
Q6F2W8 Expressed protein (Os03g0584300 protein) (Uncharacterised...    30   8.3  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387858|gb|CA851065.1|CA851065 D09G04_M04_14.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09G04 5', mRNA
sequence
         (661 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q5Z892 Hypothetical protein OJ1294_G12.15 (Hypothetical protein ...    26   2.0  
Q9C6K9 Wall-associated kinase, putative - Arabidopsis thaliana (...    31   3.0  
Q68YT2 Dehydrin COR11 - Vaccinium corymbosum (Highbush blueberry)      31   3.9  
Q2R137 Expressed protein - Oryza sativa (japonica cultivar-group)      30   6.8  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387857|gb|CA851064.1|CA851064 D09G03_M03_14.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09G03 5', mRNA
sequence
         (648 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

A0A1F5 Cinnamyl alcohol dehydrogenase - Leucaena glauca (White p...   273   3e-73
Q08GP3 Cinnamyl-alcohol dehydrogenase (EC 1.1.1.195) - Leucaena ...   269   5e-72
Q5ERI1 Cinnamyl alcohol dehydrogenase - Acacia mangium x Acacia ...   268   8e-72
Q0NZX3 Cinnamyl alcohol dehydrogenase (Fragment) - Leucaena glau...   256   4e-68
Q06BH9 Cinnamyl alcohol dehydrogenase (Fragment) - Leucaena glau...   254   1e-67

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387856|gb|CA851063.1|CA851063 D09G02_M02_13.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09G02 5', mRNA
sequence
         (381 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9SF87 F8A24.10 protein (At3g09850/F8A24_10) - Arabidopsis thali...    51   9e-07
Q6Z2C8 Hypothetical protein OJ1034_C08.5 (Os08g0288500 protein) ...    51   1e-06
Q013B2 [A] KOG2184 Tuftelin-interacting protein TIP39 - Ostreoco...    38   0.008
Q8LDZ5 Hypothetical protein - Arabidopsis thaliana (Mouse-ear cr...    33   0.25 
Q015M7 [A] KOG2184 Tuftelin-interacting protein TIP39 - Ostreoco...    33   0.25 

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387855|gb|CA851062.1|CA851062 D09F12_K12_12.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09F12 5', mRNA
sequence
         (427 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q43453 G.max mRNA from stress-induced gene (H4) - Glycine max (S...    91   1e-19
Q8LJU1 PR10-like protein - Glycine max (Soybean)                       93   3e-19
Q39450 Pathogenesis related protein - Cicer arietinum (Chickpea)...    76   3e-14
Q2XQG7 Pathogenesis-related protein PR-10 (Fragment) - Glycine m...    73   3e-13
Q9AXK2 PR10.2C protein - Lupinus luteus (European yellow lupin)        73   3e-13

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387854|gb|CA851061.1|CA851061 D09F11_K11_12.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09F11 5', mRNA
sequence
         (22 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387853|gb|CA851060.1|CA851060 D09F10_K10_11.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09F10 5', mRNA
sequence
         (627 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q0INB8 Os12g0484700 protein - Oryza sativa (japonica cultivar-gr...   204   2e-52
Q2QQT2 Yippee-like protein At4g27740, putative - Oryza sativa (j...   201   1e-51
Q2R2Q4 Yippee-like protein At4g27740, putative, expressed (Os11g...   198   1e-50
Q2V3E1 Protein At4g27745 - Arabidopsis thaliana (Mouse-ear cress)     192   7e-49
Q10QK2 Expressed protein - Oryza sativa (japonica cultivar-group)     132   1e-30

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387852|gb|CA851059.1|CA851059 D09F09_K09_11.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09F09 5', mRNA
sequence
         (672 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

O03991 RAD23 protein, isoform II - Daucus carota (Carrot)             228   2e-59
Q3ECA5 Protein At1g79650 - Arabidopsis thaliana (Mouse-ear cress)     221   1e-57
Q6ETL3 Putative RAD23 protein (Os02g0179300 protein) - Oryza sat...   200   4e-51
Q1KUV7 Hypothetical protein - Cleome spinosa                          193   4e-49
Q9STA6 RAD23 protein - Solanum lycopersicum (Tomato) (Lycopersic...   186   6e-47

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387851|gb|CA851058.1|CA851058 D09F08_K08_12.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09F08 5', mRNA
sequence
         (433 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9M7E6 Elongation factor 1 alpha - Zea mays (Maize)                    36   0.037
Q9M7E5 Elongation factor 1 alpha - Zea mays (Maize)                    36   0.037
Q9M7E3 Elongation factor 1 alpha - Zea mays (Maize)                    36   0.037
Q9M7E2 Elongation factor 1 alpha - Zea mays (Maize)                    36   0.037
Q9FYV3 Elongation factor - Saccharum officinarum (Sugarcane)           36   0.037

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387850|gb|CA851057.1|CA851057 D09F07_K07_12.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09F07 5', mRNA
sequence
         (705 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q65WV6 Putative aminotransferase (Os05g0475400 protein) - Oryza ...   226   e-104
Q0WWF1 Aminotransferase like protein - Arabidopsis thaliana (Mou...   224   e-103
Q10LR4 Alanine-glyoxylate aminotransferase 2, mitochondrial, put...   225   e-102
Q10R45 Alanine-glyoxylate aminotransferase 2, mitochondrial, put...   202   1e-84
Q1SJ68 Peptidase S1 and S6, chymotrypsin/Hap; Aminotransferase c...   199   3e-84

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387849|gb|CA851056.1|CA851056 D09F06_K06_11.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09F06 5', mRNA
sequence
         (126 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387848|gb|CA851055.1|CA851055 D09F05_K05_11.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09F05 5', mRNA
sequence
         (447 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q7XUK6 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.9) (Rib...   122   4e-28
Q01IC6 OSIGBa0092E01.9 protein (H0306B06.13 protein) - Oryza sat...   122   4e-28
Q9XH13 6,7-dimethyl-8-ribityllumazine synthase (Fragment) - Nico...   116   3e-26
Q5ZQU1 6,7-dimethyl-8-ribityllumazine synthase - Nicotiana tabac...   116   3e-26
Q53L54 SAM dependent carboxyl methyltransferase (SAM dependent c...    30   3.7  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387847|gb|CA851054.1|CA851054 D09F04_K04_12.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09F04 5', mRNA
sequence
         (180 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387846|gb|CA851053.1|CA851053 D09F03_K03_12.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09F03 5', mRNA
sequence
         (35 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387845|gb|CA851052.1|CA851052 D09F02_K02_11.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09F02 5', mRNA
sequence
         (688 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9LXZ6 Hypothetical protein T5P19_90 - Arabidopsis thaliana (Mou...   214   3e-55
Q0WPK3 Hypothetical protein At3g56440 - Arabidopsis thaliana (Mo...   214   3e-55
Q9AS72 P0028E10.20 protein - Oryza sativa (japonica cultivar-group)   209   7e-54
Q5VQF8 Hypothetical protein OJ1276_B06.19 (Os01g0168500 protein)...   209   7e-54
Q8GYD7 Hypothetical protein At2g40810 (At2g40810) - Arabidopsis ...   206   7e-53

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387844|gb|CA851051.1|CA851051 D09F01_K01_11.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09F01 5', mRNA
sequence
         (473 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q2HVG1 Hypothetical protein - Medicago truncatula (Barrel medic)      192   4e-49
O49636 Hypothetical protein AT4g22310 (AT4g22310) - Arabidopsis ...   188   7e-48
Q7XIT4 Light induced protein like protein (Os07g0449100 protein)...   186   2e-47
Q6ZB58 Light induced protein like (Os08g0344300 protein) - Oryza...   186   2e-47
Q8LB46 Light induced protein like - Arabidopsis thaliana (Mouse-...   182   3e-46

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387843|gb|CA851050.1|CA851050 D09E12_I12_10.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09E12 5', mRNA
sequence
         (523 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q0JIM4 Os01g0790200 protein - Oryza sativa (japonica cultivar-gr...    37   0.046
Q5CAI3 OSJNBa0032N05.15 protein - Oryza sativa (Rice)                  30   4.3  
Q5EUC7 Adenosine 5'-phosphosulfate reductase 3 - Zea mays (Maize)      29   7.3  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387842|gb|CA851049.1|CA851049 D09E11_I11_10.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09E11 5', mRNA
sequence
         (629 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q2XTC3 ADP,ATP carrier protein-like - Solanum tuberosum (Potato)      144   2e-34
P93767 ADP/ATP translocator - Solanum lycopersicum (Tomato) (Lyc...   144   2e-34
Q307Y6 ADP/ATP translocator-like (ADP,ATP carrier protein-like) ...   142   7e-34
Q0WVD8 Adenylate translocator - Arabidopsis thaliana (Mouse-ear ...   136   5e-32
O49875 Adenine nucleotide translocator - Lupinus albus (White lu...   134   2e-31

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387841|gb|CA851048.1|CA851048 D09E10_I10_09.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09E10 5', mRNA
sequence
         (209 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387840|gb|CA851047.1|CA851047 D09E09_I09_09.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09E09 5', mRNA
sequence
         (604 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9FQE3 Glutathione S-transferase GST 15 (EC 2.5.1.18) (Fragment)...   273   2e-73
Q1SN74 Glutathione S-transferase, omega-class - Medicago truncat...   162   1e-39
Q1RSI2 Intracellular chloride channel - Medicago truncatula (Bar...   152   1e-36
Q1RSH9 Intracellular chloride channel - Medicago truncatula (Bar...   149   6e-36
Q1RSH8 Intracellular chloride channel - Medicago truncatula (Bar...   147   2e-35

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387839|gb|CA851046.1|CA851046 D09E08_I08_10.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09E08 5', mRNA
sequence
         (497 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q94ES8 Root nodule extensin (Fragment) - Pisum sativum (Garden pea)    37   0.040
Q94ES3 Root nodule extensin (Fragment) - Pisum sativum (Garden pea)    37   0.040
Q9LU37 Genomic DNA, chromosome 3, P1 clone: MXL8 - Arabidopsis t...    35   0.089
Q9ASW4 At3g21211 (Hypothetical protein At3g21215) (At3g21211/At3...    35   0.089
O24099 MtN12 protein (Fragment) - Medicago truncatula (Barrel me...    35   0.12 

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387838|gb|CA851045.1|CA851045 D09E07_I07_10.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09E07 5', mRNA
sequence
         (401 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q84RC4 Metallothionein-like protein - Arachis hypogaea (Peanut)        78   9e-15
Q1RVP9 Plant metallothionein, family 15 - Medicago truncatula (B...    76   3e-14
Q9M4H3 Putative metallothionein-like protein - Vitis vinifera (G...    72   6e-13
Q9XET5 Metallothionein-like protein - Gossypium hirsutum (Upland...    68   7e-12
O82046 Metallothionein-like protein - Ribes nigrum (European bla...    66   3e-11

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387837|gb|CA851044.1|CA851044 D09E06_I06_09.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09E06 5', mRNA
sequence
         (601 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q84JL6 Hypothetical protein At1g79160 - Arabidopsis thaliana (Mo...   109   7e-24
O64536 YUP8H12R.23 protein - Arabidopsis thaliana (Mouse-ear cress)   109   7e-24
Q9SA48 >F3O9.30 (At1g16500) (Expressed protein) (Hypothetical pr...   100   5e-21
Q7XK21 OSJNBa0044K18.24 protein - Oryza sativa (japonica cultiva...    40   0.007
Q5U8T5 Cyclin B-like protein - Nicotiana tabacum (Common tobacco)      37   0.061

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387836|gb|CA851043.1|CA851043 D09E05_I05_09.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09E05 5', mRNA
sequence
         (369 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q94LQ6 Putative transcription factor (Os10g0557600 protein) (GAT...    34   0.14 
Q1S9S7 Zinc finger, GATA-type - Medicago truncatula (Barrel medic)     33   0.19 
Q76DY1 AG-motif binding protein-3 - Nicotiana tabacum (Common to...    33   0.32 
Q7FYS6 T10I18.7 protein - Arabidopsis thaliana (Mouse-ear cress)       32   0.54 
Q8LIZ3 Putative AG-motif binding protein-4 (Os01g0745700 protein...    32   0.71 

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387835|gb|CA851042.1|CA851042 D09E04_I04_10.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09E04 5', mRNA
sequence
         (571 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q7M213 Metallothionein - Glycine max (Soybean)                         97   3e-20
Q75NI1 Type 2 metallothionein - Glycine max (Soybean)                  91   2e-18
Q75NI3 Type 2 metallothionein - Phaseolus aureus (Mung bean) (Vi...    90   5e-18
Q45W72 Metallothionein-like protein (Type 2 metallothionein) - A...    89   9e-18
Q75NH9 Type 2 metallothionein - Phaseolus angularis (Adzuki bean...    87   3e-17

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387834|gb|CA851041.1|CA851041 D09E03_I03_10.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09E03 5', mRNA
sequence
         (356 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q94LQ6 Putative transcription factor (Os10g0557600 protein) (GAT...    34   0.14 
Q1S9S7 Zinc finger, GATA-type - Medicago truncatula (Barrel medic)     33   0.19 
Q76DY1 AG-motif binding protein-3 - Nicotiana tabacum (Common to...    33   0.32 
Q7FYS6 T10I18.7 protein - Arabidopsis thaliana (Mouse-ear cress)       32   0.55 
Q8LIZ3 Putative AG-motif binding protein-4 (Os01g0745700 protein...    32   0.72 

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387833|gb|CA851040.1|CA851040 D09E02_I02_09.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09E02 5', mRNA
sequence
         (12 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387832|gb|CA851039.1|CA851039 D09E01_I01_09.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09E01 5', mRNA
sequence
         (385 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q94LQ6 Putative transcription factor (Os10g0557600 protein) (GAT...    34   0.14 
Q1S9S7 Zinc finger, GATA-type - Medicago truncatula (Barrel medic)     33   0.19 
Q76DY1 AG-motif binding protein-3 - Nicotiana tabacum (Common to...    33   0.32 
Q7FYS6 T10I18.7 protein - Arabidopsis thaliana (Mouse-ear cress)       32   0.55 
Q8LIZ3 Putative AG-motif binding protein-4 (Os01g0745700 protein...    32   0.72 

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387831|gb|CA851038.1|CA851038 D09D12_G12_08.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09D12 5', mRNA
sequence
         (661 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q9SRE1 Putative translation initiation factor IF-2; 35582-30916 ...    34   0.47 
Q5MD17 Protein kinase C conserved region 2 (Fragment) - Brassica...    33   1.0  
Q9LEX1 CaLB protein (At3g61050) - Arabidopsis thaliana (Mouse-ea...    32   1.4  
P92940 CaLB protein - Arabidopsis thaliana (Mouse-ear cress)           32   1.4  
Q9SRD2 Putative translation initiation factor IF-2; 73082-68138 ...    32   1.8  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387830|gb|CA851037.1|CA851037 D09D11_G11_08.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09D11 5', mRNA
sequence
         (369 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q6MWG9 B1160F02.7 protein (Os04g0100300 protein) - Oryza sativa ...    28   6.0  
Q67Y55 Tyrosine transaminase-like protein - Arabidopsis thaliana...    28   7.8  
O49451 Tyrosine transaminase-like protein (EC 2.6.1.5) - Arabido...    28   7.8  

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387829|gb|CA851036.1|CA851036 D09D10_G10_07.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09D10 5', mRNA
sequence
         (722 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q1SQF0 Paired amphipathic helix - Medicago truncatula (Barrel me...   299   5e-81
Q658A2 Transcriptional co-repressor-like - Oryza sativa (japonic...   213   5e-55
Q0JRB9 Os01g0109700 protein (Fragment) - Oryza sativa (japonica ...   213   5e-55
Q9LFQ3 Transcriptional regulatory-like protein - Arabidopsis tha...   211   2e-54
Q1EPA1 Paired amphipathic helix repeat-containing protein / tran...   202   9e-52

BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387828|gb|CA851035.1|CA851035 D09D09_G09_07.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09D09 5', mRNA
sequence
         (292 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done

 ***** No hits found ******


BLASTX 2.2.15 [Oct-15-2006]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|33387827|gb|CA851034.1|CA851034 D09D08_G08_08.ab1 cDNA
Peking library 2, 4 day SCN3 Glycine max cDNA clone D09D08 5', mRNA
sequence
         (699 letters)

Database: /home/xzhou/data/uniprot/plantUniP_withIPR.pep 
           211,148 sequences; 82,535,734 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Q27SZ1 Xyloglucan endotransglycosylase (EC 2.4.1.207) (Fragment)...   354   1e-97
Q9LLC2 Xyloglucan endotransglycosylase XET2 (EC 2.4.1.207) - Asp...   342   9e-94
Q8GTJ0 Xyloglucan endotransglycosylase - Malus domestica (Apple)...   341   2e-93
Q1W398 Xyloglucan endotransglycosylase - Striga asiatica              336   5e-92
Q4LET4 Xyloglucan endotransglucosylase/hydrolase - Sagittaria py...   327   2e-89

