[Bioperl-l] Uniprot/Swiss accessions?
Smithies, Russell
Russell.Smithies at agresearch.co.nz
Mon May 18 23:54:41 EDT 2009
We re-installed blast version 2.2.18 and everything works perfectly.
It formats the Uniprot fasta as it should and retrieves sequences with fastacmd as it should.
I think we'll email NCBI and tell them they broke formatdb in their "upgrade"
--Russell
> -----Original Message-----
> From: bioperl-l-bounces at lists.open-bio.org [mailto:bioperl-l-
> bounces at lists.open-bio.org] On Behalf Of Smithies, Russell
> Sent: Tuesday, 19 May 2009 3:43 p.m.
> To: 'bill at genenformics.com'; 'bioperl-l at lists.open-bio.org'
> Subject: Re: [Bioperl-l] Uniprot/Swiss accessions?
>
> There's no descriptions in the top of the blast output and no accessions in
> the alignments.
> The fasta is coming from UniProt so surely they know how to format files.
> And it does match what NCBI require in their defline i.e. sp|accession|entry
> name
>
> --Russell
>
> > -----Original Message-----
> > From: bioperl-l-bounces at lists.open-bio.org [mailto:bioperl-l-
> > bounces at lists.open-bio.org] On Behalf Of bill at genenformics.com
> > Sent: Tuesday, 19 May 2009 3:13 p.m.
> > To: bioperl-l at lists.open-bio.org
> > Subject: Re: [Bioperl-l] Uniprot/Swiss accessions?
> >
> > I could not see the difference.
> >
> > Do you follow the rules for FASTA defline:
> >
> > http://www.ncbi.nlm.nih.gov/books/bv.fcgi?rid=handbook.table.632
> >
> > Bill
> >
> >
> > > No, that doesn't work :-(
> > > Here's some blast output with the database formatted with local ids:
> > > =====================================================================
> > > Database: uniprot_sprot.fasta
> > > 466,739 sequences; 165,389,953 total letters
> > >
> > > Searching..................................................done
> > >
> > >
> > >
> > > Score
> > > E
> > > Sequences producing significant alignments: (bits)
> > > Value
> > >
> > > sp|Q4U9M9|104K_THEAN Unknown 421
> > > e-117
> > > sp|P15711|104K_THEPA Unknown 265
> > > 6e-70
> > > sp|Q2SPQ2|CHED_HAHCH Unknown 33
> > > 4.2
> > >
> > >
> > > Score = 421 bits (1083), Expect = e-117, Method: Compositional matrix
> > > adjust.
> > > Identities = 0/209 (0%), Positives = 0/209 (0%)
> > >
> > > Query: 1 VHKVVEGDIVIWENEEMPLYTCAIVTQNEVPYMAYVELLEDPDLIFFLKEGDQWAPIPED 60
> > >
> > > Query: 61 QYLAXXXXXXXXIHTESFFSLNLSFQHENYKYEMVSSFQHSIKMVVFTPKNGHICKMVYD
> > > 120
> > >
> > > Query: 121 KNIRIFKALYNEYVTSVIGFFRGLKLLLLNIFVIDDRGMIGNKYFQLLDDKYAPISVQGY
> > > 180
> > >
> > > Query: 181 VATIPKLKDFAEPYHPIILDISDIDYVNF 209
> > >
> > >
> ===========================================================================
> > >
> > > If I tweak the fasta and change the ids from lcl to gi and re-formatdb,
> > > all works correctly:
> > >
> > >
> ===========================================================================
> > > Query= test
> > > (612 letters)
> > >
> > > Database: uniprot_sprot.fasta
> > > 466,739 sequences; 165,389,953 total letters
> > >
> > > Searching..................................................done
> > >
> > >
> > >
> > > %2
> >
> > _______________________________________________
> > Bioperl-l mailing list
> > Bioperl-l at lists.open-bio.org
> > http://lists.open-bio.org/mailman/listinfo/bioperl-l
> =======================================================================
> Attention: The information contained in this message and/or attachments
> from AgResearch Limited is intended only for the persons or entities
> to which it is addressed and may contain confidential and/or privileged
> material. Any review, retransmission, dissemination or other use of, or
> taking of any action in reliance upon, this information by persons or
> entities other than the intended recipients is prohibited by AgResearch
> Limited. If you have received this message in error, please notify the
> sender immediately.
> =======================================================================
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l at lists.open-bio.org
> http://lists.open-bio.org/mailman/listinfo/bioperl-l
More information about the Bioperl-l
mailing list