[Biojava-l] Amino acids physico-chemical properties calculation

[Peter Troshin]

> >> Would you please explain how the input of this method will be
> >> given?

Just assume that this would be a String for now. For example 
"MFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGR".

Hope that helps.

Regards,
Peter

On 07/04/2011 12:26, effat farhana wrote:
>  Hi, I'm a student of Computer Science and Engineering background. I
>  heard about GSoC a few days earlier and very much eager to
>  participate in it. I'm quite familiar with C++, Java multithreading.
>  The idea of this project proposal seems quite interesting to me.
>
>  One of the methods to be implemented is to calculate the numbers of
>  different amino acids in protein. Would you please explain how the
>  input of this method will be given? Will the protein sequence be
>  represented by String as sequence of amino acids and I've just count
>  the different types of amino acid?
>
>
>  Looking forward for your quick reply Thanks in advance
>
>  farhana _______________________________________________ Biojava-l
>  mailing list - Biojava-l at lists.open-bio.org
>  http://lists.open-bio.org/mailman/listinfo/biojava-l