[MOBY-guts] biomoby commit

Andreas Groscurth groscurt at dev.open-bio.org
Wed Dec 17 09:09:54 EST 2008


groscurt
Wed Dec 17 09:09:54 EST 2008
Update of /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test
In directory dev.open-bio.org:/tmp/cvs-serv5728/src/main/de/mpg/mpiz_koeln/featureClient/test

Modified Files:
	SingleCallDefinition.java SingleCallWithParameters.java 
	ComplexSingleCall.java SingleMultiServiceCall.java 
	MultiCallWithParameters.java SimpleSingleCall.java 
	SimpleMultiCall.java MultiCallByDefinition.java 
Log Message:
minor changes
moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test SingleCallDefinition.java,1.1,1.2 SingleCallWithParameters.java,1.2,1.3 ComplexSingleCall.java,1.2,1.3 SingleMultiServiceCall.java,1.2,1.3 MultiCallWithParameters.java,1.2,1.3 SimpleSingleCall.java,1.2,1.3 SimpleMultiCall.java,1.2,1.3 MultiCallByDefinition.java,1.2,1.3
===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleCallDefinition.java,v
retrieving revision 1.1
retrieving revision 1.2
diff -u -r1.1 -r1.2
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleCallDefinition.java	2008/11/26 08:52:20	1.1
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleCallDefinition.java	2008/12/17 14:09:54	1.2
@@ -9,14 +9,14 @@
 import de.mpg.mpiz_koeln.featureClient.FeatureClientException;
 import de.mpg.mpiz_koeln.featureClient.FeatureClientResult;
 
-public class SingleCallDefinition {
+class SingleCallDefinition {
     public static void main( String[] args ) throws FeatureClientException, MobyException {
         FeatureClient client = new FeatureClient();
         client.addOutput( "Object", "PMID" );
         client.setTimeout( 45 );
         client.add2Filter( "Locus2GeneAliases", "getCor", "getGeneticElementNameByFreeText", "getGoTermAssociations",
                 "getConservedDomainLabelFromDomainId", "ExplodeOutCrossReferences" );
-        client.setServiceInputSingleCall( "", "Q9SZW4" );
+        client.setSingleCallInput( "", "Q9SZW4" );
 
         Collection< FeatureClientResult > collection = client.call();
         for ( FeatureClientResult mobyServiceResult : collection ) {

===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleCallWithParameters.java,v
retrieving revision 1.2
retrieving revision 1.3
diff -u -r1.2 -r1.3
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleCallWithParameters.java	2008/12/17 10:21:56	1.2
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleCallWithParameters.java	2008/12/17 14:09:54	1.3
@@ -13,7 +13,7 @@
 import de.mpg.mpiz_koeln.featureClient.FeatureClientException;
 import de.mpg.mpiz_koeln.featureClient.FeatureClientResult;
 
-public class SingleCallWithParameters {
+class SingleCallWithParameters {
     public static void main( String[] args ) throws FeatureClientException, MobyException {
         FeatureClient client = new FeatureClient();
         client.setTimeout( 120 );
@@ -35,7 +35,7 @@
         geneName.setId( "my_gene" );
         geneName.setName( "gene_name" );
 
-        client.setServiceInputSingleCall( organism, sequence, geneName );
+        client.setSingleCallInput( organism, sequence, geneName );
 
         Collection < FeatureClientResult > result = client.call();
 

===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/ComplexSingleCall.java,v
retrieving revision 1.2
retrieving revision 1.3
diff -u -r1.2 -r1.3
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/ComplexSingleCall.java	2008/12/17 10:21:56	1.2
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/ComplexSingleCall.java	2008/12/17 14:09:54	1.3
@@ -2,7 +2,6 @@
 package de.mpg.mpiz_koeln.featureClient.test;
 
 import java.util.Collection;
-import java.util.List;
 
 import org.biomoby.shared.MobyException;
 import org.biomoby.shared.datatypes.AminoAcidSequence;
@@ -18,7 +17,7 @@
  * This examples shows how to use the client to call a web service once which consumes a complex data type, such as
  * AminoAcidSequence.
  */
-public class ComplexSingleCall {
+class ComplexSingleCall {
 	public static void main(String[] args) throws MobyException, FeatureClientException {
 		FeatureClient client = new FeatureClient();
 		// timeout of the calls is set to 45 seconds
@@ -31,7 +30,7 @@
 		sequence.set_SequenceString( new MobyString( "MQPVKVYADRRSQPSRAVIIFCRVNQIDFEEVTVDLFKSQHLTPEFRKVNPMGQVPAIVDGR" ) );
 		sequence.set_Length( new MobyInteger( 50 ) );
 		// set the input to the client
-		client.setServiceInputSingleCall( sequence );
+		client.setSingleCallInput( sequence );
 
 		// start the call and retrieve the results
 		Collection< FeatureClientResult > result = client.call();

===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleMultiServiceCall.java,v
retrieving revision 1.2
retrieving revision 1.3
diff -u -r1.2 -r1.3
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleMultiServiceCall.java	2008/12/17 10:21:56	1.2
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleMultiServiceCall.java	2008/12/17 14:09:54	1.3
@@ -13,7 +13,7 @@
 /**
  * This example shows how to call more service one with one input.
  */
-public class SingleMultiServiceCall {
+class SingleMultiServiceCall {
     public static void main( String[] args ) throws FeatureClientException, MobyException {
         FeatureClient client = new FeatureClient();
         client.setTimeout( 30 );
@@ -23,7 +23,7 @@
         client.addService( "Locus2Publications" );
 
         // set the input of the service
-        client.setServiceInputSingleCall( "AGI_LocusCode", "AT1G12000" );
+        client.setSingleCallInput( "AGI_LocusCode", "AT1G12000" );
 
         // call the service
         Collection< FeatureClientResult > result = client.call();

===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/MultiCallWithParameters.java,v
retrieving revision 1.2
retrieving revision 1.3
diff -u -r1.2 -r1.3
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/MultiCallWithParameters.java	2008/12/17 10:21:56	1.2
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/MultiCallWithParameters.java	2008/12/17 14:09:54	1.3
@@ -18,7 +18,7 @@
  * This example shows how to call a service multiple times which consumes more than one input. It also shows the mixture
  * of a simple object input and a complex data type input.
  */
-public class MultiCallWithParameters {
+class MultiCallWithParameters {
     public static void main( String[] args ) throws MobyException, FeatureClientException {
         FeatureClient client = new FeatureClient();
         // the service might take longer, so we set the timeout to 120 seconds
@@ -55,7 +55,7 @@
 
         // adds the inputs to the client and give it an identifier, so that you are able to distinguish the several
         // calls later. This identifier is completely free to choice !
-        client.addServiceInputMultiCall( "gene1", organism, sequence, geneName );
+        client.addMultipleCallInput( "gene1", organism, sequence, geneName );
 
         // we want to call the same service a second time so we build again some input values
         organism = new MobyObject();
@@ -75,7 +75,7 @@
         geneName.setName( "gene_name" );
 
         // adds the inputs to the client for the second call with a different identifier as before
-        client.addServiceInputMultiCall( "gene2", organism, sequence, geneName );
+        client.addMultipleCallInput( "gene2", organism, sequence, geneName );
 
         // the service is called
         Collection< FeatureClientResult > result = client.call();

===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SimpleSingleCall.java,v
retrieving revision 1.2
retrieving revision 1.3
diff -u -r1.2 -r1.3
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SimpleSingleCall.java	2008/12/17 10:21:56	1.2
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SimpleSingleCall.java	2008/12/17 14:09:54	1.3
@@ -12,12 +12,12 @@
 /**
  * This example shows how to call a service once with a simple object input.
  */
-public class SimpleSingleCall {
+class SimpleSingleCall {
     public static void main( String[] args ) throws FeatureClientException, MobyException {
         FeatureClient client = new FeatureClient();
         client.setTimeout( 45 );
         client.addService( "mpiz-koeln.mpg.de", "ID2IDs" );
-        client.setServiceInputSingleCall( "", "NP_176539.1" );
+        client.setSingleCallInput( "", "NP_176539.1" );
         Collection< FeatureClientResult > result = client.call();
 
         for ( FeatureClientResult mobyServiceResult : result ) {

===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SimpleMultiCall.java,v
retrieving revision 1.2
retrieving revision 1.3
diff -u -r1.2 -r1.3
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SimpleMultiCall.java	2008/12/17 10:21:56	1.2
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SimpleMultiCall.java	2008/12/17 14:09:54	1.3
@@ -13,7 +13,7 @@
 /**
  * This example shows how to call a web service multiple times with a simple object input.
  */
-public class SimpleMultiCall {
+class SimpleMultiCall {
     public static void main( String[] args ) throws MobyException, FeatureClientException {
         // the client queries the default central if no given otherwise
         FeatureClient client = new FeatureClient();
@@ -23,9 +23,9 @@
         client.addService( "mpiz-koeln.mpg.de", "get_go_information_by_go_term" );
 
         // the three different inputs for the three service calls
-        client.addServiceInputMultiCall( "GO", "0044408" );
-        client.addServiceInputMultiCall( "GO", "0020015" );
-        client.addServiceInputMultiCall( "GO", "0004396" );
+        client.addMultipleCallInput( "GO", "0044408" );
+        client.addMultipleCallInput( "GO", "0020015" );
+        client.addMultipleCallInput( "GO", "0004396" );
 
         // call the service
         Collection< FeatureClientResult > result = client.call();

===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/MultiCallByDefinition.java,v
retrieving revision 1.2
retrieving revision 1.3
diff -u -r1.2 -r1.3
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/MultiCallByDefinition.java	2008/12/17 10:21:56	1.2
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/MultiCallByDefinition.java	2008/12/17 14:09:54	1.3
@@ -18,7 +18,7 @@
  * 
  * It also shows how to filter out services or authorities which shall be not called at all.
  */
-public class MultiCallByDefinition {
+class MultiCallByDefinition {
     public static void main( String[] args ) throws MobyException, FeatureClientException {
         // create a client to the default moby central in calgary with a timeout of 30 seconds
         FeatureClient client = new FeatureClient();
@@ -28,9 +28,9 @@
         // exclude services identified by service name or authority
         client.add2Filter( "Locus2GeneAliases", "getCor", "bioinfo.icapture.ubc.ca" );
         // input for the first call -> it also defines now we search for service which consumes an AGI code
-        client.addServiceInputMultiCall( "AGI_LocusCode", "AT4G30110" );
+        client.addMultipleCallInput( "AGI_LocusCode", "AT4G30110" );
         // input for the second call
-        client.addServiceInputMultiCall( "AGI_LocusCode", "AT1G12000" );
+        client.addMultipleCallInput( "AGI_LocusCode", "AT1G12000" );
 
         // call the service, which will be found
         Collection< FeatureClientResult > result = client.call();



More information about the MOBY-guts mailing list