[MOBY-guts] biomoby commit
Andreas Groscurth
groscurt at dev.open-bio.org
Wed Dec 17 09:09:54 EST 2008
groscurt
Wed Dec 17 09:09:54 EST 2008
Update of /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test
In directory dev.open-bio.org:/tmp/cvs-serv5728/src/main/de/mpg/mpiz_koeln/featureClient/test
Modified Files:
SingleCallDefinition.java SingleCallWithParameters.java
ComplexSingleCall.java SingleMultiServiceCall.java
MultiCallWithParameters.java SimpleSingleCall.java
SimpleMultiCall.java MultiCallByDefinition.java
Log Message:
minor changes
moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test SingleCallDefinition.java,1.1,1.2 SingleCallWithParameters.java,1.2,1.3 ComplexSingleCall.java,1.2,1.3 SingleMultiServiceCall.java,1.2,1.3 MultiCallWithParameters.java,1.2,1.3 SimpleSingleCall.java,1.2,1.3 SimpleMultiCall.java,1.2,1.3 MultiCallByDefinition.java,1.2,1.3
===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleCallDefinition.java,v
retrieving revision 1.1
retrieving revision 1.2
diff -u -r1.1 -r1.2
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleCallDefinition.java 2008/11/26 08:52:20 1.1
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleCallDefinition.java 2008/12/17 14:09:54 1.2
@@ -9,14 +9,14 @@
import de.mpg.mpiz_koeln.featureClient.FeatureClientException;
import de.mpg.mpiz_koeln.featureClient.FeatureClientResult;
-public class SingleCallDefinition {
+class SingleCallDefinition {
public static void main( String[] args ) throws FeatureClientException, MobyException {
FeatureClient client = new FeatureClient();
client.addOutput( "Object", "PMID" );
client.setTimeout( 45 );
client.add2Filter( "Locus2GeneAliases", "getCor", "getGeneticElementNameByFreeText", "getGoTermAssociations",
"getConservedDomainLabelFromDomainId", "ExplodeOutCrossReferences" );
- client.setServiceInputSingleCall( "", "Q9SZW4" );
+ client.setSingleCallInput( "", "Q9SZW4" );
Collection< FeatureClientResult > collection = client.call();
for ( FeatureClientResult mobyServiceResult : collection ) {
===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleCallWithParameters.java,v
retrieving revision 1.2
retrieving revision 1.3
diff -u -r1.2 -r1.3
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleCallWithParameters.java 2008/12/17 10:21:56 1.2
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleCallWithParameters.java 2008/12/17 14:09:54 1.3
@@ -13,7 +13,7 @@
import de.mpg.mpiz_koeln.featureClient.FeatureClientException;
import de.mpg.mpiz_koeln.featureClient.FeatureClientResult;
-public class SingleCallWithParameters {
+class SingleCallWithParameters {
public static void main( String[] args ) throws FeatureClientException, MobyException {
FeatureClient client = new FeatureClient();
client.setTimeout( 120 );
@@ -35,7 +35,7 @@
geneName.setId( "my_gene" );
geneName.setName( "gene_name" );
- client.setServiceInputSingleCall( organism, sequence, geneName );
+ client.setSingleCallInput( organism, sequence, geneName );
Collection < FeatureClientResult > result = client.call();
===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/ComplexSingleCall.java,v
retrieving revision 1.2
retrieving revision 1.3
diff -u -r1.2 -r1.3
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/ComplexSingleCall.java 2008/12/17 10:21:56 1.2
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/ComplexSingleCall.java 2008/12/17 14:09:54 1.3
@@ -2,7 +2,6 @@
package de.mpg.mpiz_koeln.featureClient.test;
import java.util.Collection;
-import java.util.List;
import org.biomoby.shared.MobyException;
import org.biomoby.shared.datatypes.AminoAcidSequence;
@@ -18,7 +17,7 @@
* This examples shows how to use the client to call a web service once which consumes a complex data type, such as
* AminoAcidSequence.
*/
-public class ComplexSingleCall {
+class ComplexSingleCall {
public static void main(String[] args) throws MobyException, FeatureClientException {
FeatureClient client = new FeatureClient();
// timeout of the calls is set to 45 seconds
@@ -31,7 +30,7 @@
sequence.set_SequenceString( new MobyString( "MQPVKVYADRRSQPSRAVIIFCRVNQIDFEEVTVDLFKSQHLTPEFRKVNPMGQVPAIVDGR" ) );
sequence.set_Length( new MobyInteger( 50 ) );
// set the input to the client
- client.setServiceInputSingleCall( sequence );
+ client.setSingleCallInput( sequence );
// start the call and retrieve the results
Collection< FeatureClientResult > result = client.call();
===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleMultiServiceCall.java,v
retrieving revision 1.2
retrieving revision 1.3
diff -u -r1.2 -r1.3
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleMultiServiceCall.java 2008/12/17 10:21:56 1.2
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SingleMultiServiceCall.java 2008/12/17 14:09:54 1.3
@@ -13,7 +13,7 @@
/**
* This example shows how to call more service one with one input.
*/
-public class SingleMultiServiceCall {
+class SingleMultiServiceCall {
public static void main( String[] args ) throws FeatureClientException, MobyException {
FeatureClient client = new FeatureClient();
client.setTimeout( 30 );
@@ -23,7 +23,7 @@
client.addService( "Locus2Publications" );
// set the input of the service
- client.setServiceInputSingleCall( "AGI_LocusCode", "AT1G12000" );
+ client.setSingleCallInput( "AGI_LocusCode", "AT1G12000" );
// call the service
Collection< FeatureClientResult > result = client.call();
===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/MultiCallWithParameters.java,v
retrieving revision 1.2
retrieving revision 1.3
diff -u -r1.2 -r1.3
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/MultiCallWithParameters.java 2008/12/17 10:21:56 1.2
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/MultiCallWithParameters.java 2008/12/17 14:09:54 1.3
@@ -18,7 +18,7 @@
* This example shows how to call a service multiple times which consumes more than one input. It also shows the mixture
* of a simple object input and a complex data type input.
*/
-public class MultiCallWithParameters {
+class MultiCallWithParameters {
public static void main( String[] args ) throws MobyException, FeatureClientException {
FeatureClient client = new FeatureClient();
// the service might take longer, so we set the timeout to 120 seconds
@@ -55,7 +55,7 @@
// adds the inputs to the client and give it an identifier, so that you are able to distinguish the several
// calls later. This identifier is completely free to choice !
- client.addServiceInputMultiCall( "gene1", organism, sequence, geneName );
+ client.addMultipleCallInput( "gene1", organism, sequence, geneName );
// we want to call the same service a second time so we build again some input values
organism = new MobyObject();
@@ -75,7 +75,7 @@
geneName.setName( "gene_name" );
// adds the inputs to the client for the second call with a different identifier as before
- client.addServiceInputMultiCall( "gene2", organism, sequence, geneName );
+ client.addMultipleCallInput( "gene2", organism, sequence, geneName );
// the service is called
Collection< FeatureClientResult > result = client.call();
===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SimpleSingleCall.java,v
retrieving revision 1.2
retrieving revision 1.3
diff -u -r1.2 -r1.3
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SimpleSingleCall.java 2008/12/17 10:21:56 1.2
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SimpleSingleCall.java 2008/12/17 14:09:54 1.3
@@ -12,12 +12,12 @@
/**
* This example shows how to call a service once with a simple object input.
*/
-public class SimpleSingleCall {
+class SimpleSingleCall {
public static void main( String[] args ) throws FeatureClientException, MobyException {
FeatureClient client = new FeatureClient();
client.setTimeout( 45 );
client.addService( "mpiz-koeln.mpg.de", "ID2IDs" );
- client.setServiceInputSingleCall( "", "NP_176539.1" );
+ client.setSingleCallInput( "", "NP_176539.1" );
Collection< FeatureClientResult > result = client.call();
for ( FeatureClientResult mobyServiceResult : result ) {
===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SimpleMultiCall.java,v
retrieving revision 1.2
retrieving revision 1.3
diff -u -r1.2 -r1.3
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SimpleMultiCall.java 2008/12/17 10:21:56 1.2
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/SimpleMultiCall.java 2008/12/17 14:09:54 1.3
@@ -13,7 +13,7 @@
/**
* This example shows how to call a web service multiple times with a simple object input.
*/
-public class SimpleMultiCall {
+class SimpleMultiCall {
public static void main( String[] args ) throws MobyException, FeatureClientException {
// the client queries the default central if no given otherwise
FeatureClient client = new FeatureClient();
@@ -23,9 +23,9 @@
client.addService( "mpiz-koeln.mpg.de", "get_go_information_by_go_term" );
// the three different inputs for the three service calls
- client.addServiceInputMultiCall( "GO", "0044408" );
- client.addServiceInputMultiCall( "GO", "0020015" );
- client.addServiceInputMultiCall( "GO", "0004396" );
+ client.addMultipleCallInput( "GO", "0044408" );
+ client.addMultipleCallInput( "GO", "0020015" );
+ client.addMultipleCallInput( "GO", "0004396" );
// call the service
Collection< FeatureClientResult > result = client.call();
===================================================================
RCS file: /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/MultiCallByDefinition.java,v
retrieving revision 1.2
retrieving revision 1.3
diff -u -r1.2 -r1.3
--- /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/MultiCallByDefinition.java 2008/12/17 10:21:56 1.2
+++ /home/repository/moby/moby-live/Java/src/main/de/mpg/mpiz_koeln/featureClient/test/MultiCallByDefinition.java 2008/12/17 14:09:54 1.3
@@ -18,7 +18,7 @@
*
* It also shows how to filter out services or authorities which shall be not called at all.
*/
-public class MultiCallByDefinition {
+class MultiCallByDefinition {
public static void main( String[] args ) throws MobyException, FeatureClientException {
// create a client to the default moby central in calgary with a timeout of 30 seconds
FeatureClient client = new FeatureClient();
@@ -28,9 +28,9 @@
// exclude services identified by service name or authority
client.add2Filter( "Locus2GeneAliases", "getCor", "bioinfo.icapture.ubc.ca" );
// input for the first call -> it also defines now we search for service which consumes an AGI code
- client.addServiceInputMultiCall( "AGI_LocusCode", "AT4G30110" );
+ client.addMultipleCallInput( "AGI_LocusCode", "AT4G30110" );
// input for the second call
- client.addServiceInputMultiCall( "AGI_LocusCode", "AT1G12000" );
+ client.addMultipleCallInput( "AGI_LocusCode", "AT1G12000" );
// call the service, which will be found
Collection< FeatureClientResult > result = client.call();
More information about the MOBY-guts
mailing list