From maoj at helix.nih.gov Mon Mar 2 12:06:22 2009 From: maoj at helix.nih.gov (jean mao) Date: Mon, 2 Mar 2009 12:06:22 -0500 (EST) Subject: [EMBOSS] Error in EMMA Message-ID: Hi, The version of EMBOSS I am using is 4.0.0. I received an error from 'EMMA'. I will appreciate if someone can help me with this: Error: Failed to open filename '00028079B' Problem writing out EMBOSS alignment file CLUSTAL 2.0.9 Multiple Sequence Alignments Error: parameter required for /dnamatrix Under our .../htdocs/emboss/output/955836 are files: total 8 -rw-r--r-- 1 webcpu webcpu 2121 Mar 2 09:18 00028079A -rw-r--r-- 1 webcpu webcpu 0 Mar 2 09:18 dendoutfile -rw-r--r-- 1 webcpu webcpu 3999 Mar 2 09:18 index.html -rw-r--r-- 1 webcpu webcpu 0 Mar 2 09:18 outseq The sequences I used is at the bottom of this message. I did some googling on this and found someone suggested to modify emma.c file to : dna_matrix = ajAcdGetListSingle( "dnamatrix"); m2c = ajStrGetCharFirst(dna_matrix); if(m2c=='i') ajStrAssignC(&m2str,"iub"); else if(m2c=='c') ajStrAssignC(&m2str,"clustalw"); else if(m2c=='o') ajStrAssignC(&m2str,"own"); I did that but still got the same error. Could someone help me with this? Thank you very much. Jean Mao >gyrAprobe ttccgcagtttacgacaccatcgtccgtat >gyrA atgaccgacgcaaccatccgccacgaccacaaattcgccctcgaaaccctgcccgtcagc cttgaagacgaaatgcgcaaaagctatctcgactacgccatgagcgtcattgtcgggcgc gcgctgccggacgttcgcgacggcctaaagccggtgcaccggcgcgtactgtacgcgatg cacgagctgaaaaataactggaatgccgcctacaaaaaatcggcgcgcatcgtcggcgac gtcatcggtaaataccacccccacggcgattccgcagtttacgacaccatcgtccgtatg gcgcaaaatttcgctatgcgttatgtgctgatagacggacagggcaacttcggatcggtg gacgggcttgccgccgcagccatgcgctataccgaaatccgcatggcgaaaatctcacat gaaatgctggcagacattgaggaagaaaccgttaatttcggcccgaactacgacggtagc gaacacgagccgcttgtactgccgacccgtttccccacactgctcgtcaacggctcgtcc ggtatcgccgtcggtatggcgaccaacatcccgccgcacaacctcaccgacaccatcaac gcctgtctgcgtcttttggacgaacccaaaaccgaaatcgacgaactgatcgacattatc caagcccccgacttcccgaccggggcaaccatctacggcttgggcggcgtgcgcgaaggc tataaaacaggccgcggccgcgttgttatgcgcggtaagacccatatcgaacccataggc aaaaacggcgaacgcgaacgcatcgttatcgacgaaatcccctatcaggtcaacaaagcc >gyrANM atgaccgacgcaaccatccgccacgaccacaaattcgccctcgaaaccctgccggtaagc cttgaagacgaaatgcgcaaaagctatctcgactacgccatgagcgtcattgtcgggcgc gcgctgccggacgttcgcgacggtctcaagccggtacaccgccgcgtactgtacgcgatg cacgagctgaaaaacaactggaatgccgcctacaaaaaatcggcgcgcattgtcggcgac gtcatcggtaaataccacccccacggcgataccgccgtatacgacaccatcgtccgtatg gcgcaaaatttcgctatgcgttatgtgctgatagacggacagggcaacttcggatcggtg gacgggcttgccgccgcagccatgcgctacaccgaaatccgcatggcgaaaatttcccac gaaatgctggcagacattgaggaagaaaccgtcaatttcggcccgaactacgacggtagc gaacacgagccgcttgtactgccgacccgtttccccacactgctcgtcaacggctcgtcc ggcatcgccgtcggcatggcgaccaatatcccgccgcacaacctttctgataccgtcaat gcctgcctgcgcctgctcgatgcacccgacaccgaaatcgacgaactgatcgacattatc caagcccccgacttcccgaccggggcaaccatctacggcttgagcggcgtgcgcgaaggc tataaaacaggccgcggccgcgtcgttatgcgcggtaagacccatatcgaacccataggc agaaacggcgaacgcgaagccatcgttatcgacgaaatcccctatcaggtcaacaaagcc >gyrA338rt gccctcgaaaccctgccggtaagccttgaagacgaaatgcgcaaaagctatctcgactac gccatgagcgtcattgtcgggcgcgcgctgccggacgttcgcgacggtctcaagccggta caccgccgcgtactgtacgcgatgcacgaattgaaaaacaactggaatgccgcctacaaa aaatcggcacgcatcgtcggcgacgtcatcggtaaataccacccccacggcgataccgcc gtatacgacaccatcgtccgtatggcacaaaatttcgctatgcgttatgtgctgatagac ggacagggcaacttcggatcggtggacgggctgccgccgc From georgios at biotek.uio.no Tue Mar 3 05:49:22 2009 From: georgios at biotek.uio.no (George Magklaras) Date: Tue, 03 Mar 2009 11:49:22 +0100 Subject: [EMBOSS] Error in EMMA In-Reply-To: References: Message-ID: <49AD0B32.4020009@biotek.uio.no> Hi, I am under the impression that the version of emboss you are using (4) is designed to interface to version 1.8x of clustalw and hence there could be difficulties. I think the interface to clustal 2.0.x series was addressed in a latter version of EMBOSS (5 or perhaps 6). On my EMBOSS version 6.0.1 server, I ran this against clustalw 2.0.10 flawlessly (files attached). So, I suggest that you either: i)Upgrade to EMBOSS 6.0.1 ii)try to run emboss 4.0.0 emma with clustalw 1.8x . Obviously i) is better than ii). GM -- -- George Magklaras BSc Hons MPhil RHCE:805008309135525 Senior Computer Systems Engineer/UNIX-Linux Systems Administrator EMBnet Technical Management Board The Biotechnology Centre of Oslo, University of Oslo http://www.no.embnet.org jean mao wrote: > Hi, > The version of EMBOSS I am using is 4.0.0. I received an error from > 'EMMA'. I will appreciate if someone can help me with this: > > Error: Failed to open filename '00028079B' > Problem writing out EMBOSS alignment file > > CLUSTAL 2.0.9 Multiple Sequence Alignments > Error: parameter required for /dnamatrix > > Under our .../htdocs/emboss/output/955836 > are files: > > total 8 > -rw-r--r-- 1 webcpu webcpu 2121 Mar 2 09:18 00028079A > -rw-r--r-- 1 webcpu webcpu 0 Mar 2 09:18 dendoutfile > -rw-r--r-- 1 webcpu webcpu 3999 Mar 2 09:18 index.html > -rw-r--r-- 1 webcpu webcpu 0 Mar 2 09:18 outseq > > The sequences I used is at the bottom of this message. > > I did some googling on this and found someone suggested to modify emma.c > file to : > dna_matrix = ajAcdGetListSingle( "dnamatrix"); > m2c = ajStrGetCharFirst(dna_matrix); > > if(m2c=='i') > ajStrAssignC(&m2str,"iub"); > else if(m2c=='c') > ajStrAssignC(&m2str,"clustalw"); > else if(m2c=='o') > ajStrAssignC(&m2str,"own"); > > I did that but still got the same error. > > Could someone help me with this? Thank you very much. > > Jean Mao > >> gyrAprobe > ttccgcagtttacgacaccatcgtccgtat >> gyrA > atgaccgacgcaaccatccgccacgaccacaaattcgccctcgaaaccctgcccgtcagc > cttgaagacgaaatgcgcaaaagctatctcgactacgccatgagcgtcattgtcgggcgc > gcgctgccggacgttcgcgacggcctaaagccggtgcaccggcgcgtactgtacgcgatg > cacgagctgaaaaataactggaatgccgcctacaaaaaatcggcgcgcatcgtcggcgac > gtcatcggtaaataccacccccacggcgattccgcagtttacgacaccatcgtccgtatg > gcgcaaaatttcgctatgcgttatgtgctgatagacggacagggcaacttcggatcggtg > gacgggcttgccgccgcagccatgcgctataccgaaatccgcatggcgaaaatctcacat > gaaatgctggcagacattgaggaagaaaccgttaatttcggcccgaactacgacggtagc > gaacacgagccgcttgtactgccgacccgtttccccacactgctcgtcaacggctcgtcc > ggtatcgccgtcggtatggcgaccaacatcccgccgcacaacctcaccgacaccatcaac > gcctgtctgcgtcttttggacgaacccaaaaccgaaatcgacgaactgatcgacattatc > caagcccccgacttcccgaccggggcaaccatctacggcttgggcggcgtgcgcgaaggc > tataaaacaggccgcggccgcgttgttatgcgcggtaagacccatatcgaacccataggc > aaaaacggcgaacgcgaacgcatcgttatcgacgaaatcccctatcaggtcaacaaagcc >> gyrANM > atgaccgacgcaaccatccgccacgaccacaaattcgccctcgaaaccctgccggtaagc > cttgaagacgaaatgcgcaaaagctatctcgactacgccatgagcgtcattgtcgggcgc > gcgctgccggacgttcgcgacggtctcaagccggtacaccgccgcgtactgtacgcgatg > cacgagctgaaaaacaactggaatgccgcctacaaaaaatcggcgcgcattgtcggcgac > gtcatcggtaaataccacccccacggcgataccgccgtatacgacaccatcgtccgtatg > gcgcaaaatttcgctatgcgttatgtgctgatagacggacagggcaacttcggatcggtg > gacgggcttgccgccgcagccatgcgctacaccgaaatccgcatggcgaaaatttcccac > gaaatgctggcagacattgaggaagaaaccgtcaatttcggcccgaactacgacggtagc > gaacacgagccgcttgtactgccgacccgtttccccacactgctcgtcaacggctcgtcc > ggcatcgccgtcggcatggcgaccaatatcccgccgcacaacctttctgataccgtcaat > gcctgcctgcgcctgctcgatgcacccgacaccgaaatcgacgaactgatcgacattatc > caagcccccgacttcccgaccggggcaaccatctacggcttgagcggcgtgcgcgaaggc > tataaaacaggccgcggccgcgtcgttatgcgcggtaagacccatatcgaacccataggc > agaaacggcgaacgcgaagccatcgttatcgacgaaatcccctatcaggtcaacaaagcc >> gyrA338rt > gccctcgaaaccctgccggtaagccttgaagacgaaatgcgcaaaagctatctcgactac > gccatgagcgtcattgtcgggcgcgcgctgccggacgttcgcgacggtctcaagccggta > caccgccgcgtactgtacgcgatgcacgaattgaaaaacaactggaatgccgcctacaaa > aaatcggcacgcatcgtcggcgacgtcatcggtaaataccacccccacggcgataccgcc > gtatacgacaccatcgtccgtatggcacaaaatttcgctatgcgttatgtgctgatagac > ggacagggcaacttcggatcggtggacgggctgccgccgc > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > -------------- next part -------------- An embedded and charset-unspecified text was scrubbed... Name: gyraprobe.dnd URL: -------------- next part -------------- An embedded and charset-unspecified text was scrubbed... Name: gyraprobe.aln URL: From uludag at ebi.ac.uk Tue Mar 3 07:10:24 2009 From: uludag at ebi.ac.uk (Mahmut Uludag) Date: Tue, 03 Mar 2009 12:10:24 +0000 Subject: [EMBOSS] Error in EMMA In-Reply-To: References: Message-ID: <1236082224.24851.7.camel@emboss2.ebi.ac.uk> Hi, > I did some googling on this and found someone suggested to modify emma.c > file > to : > dna_matrix = ajAcdGetListSingle( "dnamatrix"); > m2c = ajStrGetCharFirst(dna_matrix); > > if(m2c=='i') > ajStrAssignC(&m2str,"iub"); > else if(m2c=='c') > ajStrAssignC(&m2str,"clustalw"); > else if(m2c=='o') > ajStrAssignC(&m2str,"own"); > > I did that but still got the same error. After the above changes made I'm able to use clustalw-2.0.7 with EMBOSS-4.1.0. Regards, Mahmut From jeedward at yahoo.com Sun Mar 8 07:04:43 2009 From: jeedward at yahoo.com (John Edward) Date: Sun, 8 Mar 2009 04:04:43 -0700 (PDT) Subject: [EMBOSS] Draft paper submission is extended (will not be extended further): BCBGC-09 Message-ID: <575752.17388.qm@web45904.mail.sp1.yahoo.com> Draft paper submission is extended (will not be extended further): BCBGC-09 ? ? *Apologies if you receive multiple copies of this email. Please forward to interested people.* ? The deadline for draft paper submission at the 2009 International Conference on Bioinformatics, Computational Biology, Genomics and Chemoinformatics (BCBGC-09) (website: http://www.PromoteResearch.org ) is extended due to numerous requests from the authors. The conference will be held during July 13-16 2009 in Orlando, FL, USA. We invite draft paper submissions. The conference will take place at the same time and venue where several other international conferences are taking place. The other conferences include: ????????? International Conference on Artificial Intelligence and Pattern Recognition (AIPR-09) ????????? International Conference on Automation, Robotics and Control Systems (ARCS-09) ????????? International Conference on Enterprise Information Systems and Web Technologies (EISWT-09) ????????? International Conference on High Performance Computing, Networking and Communication Systems (HPCNCS-09) ????????? International Conference on Information Security and Privacy (ISP-09) ????????? International Conference on Recent Advances in Information Technology and Applications (RAITA-09) ????????? International Conference on Software Engineering Theory and Practice (SETP-09) ????????? International Conference on Theory and Applications of Computational Science (TACS-09) ????????? International Conference on Theoretical and Mathematical Foundations of Computer Science (TMFCS-09) ? The website http://www.PromoteResearch.org contains more details. ? Sincerely John Edward Publicity committee ? ? From mmiller at sdsc.edu Mon Mar 9 11:33:31 2009 From: mmiller at sdsc.edu (Mark Miller) Date: Mon, 9 Mar 2009 08:33:31 -0700 Subject: [EMBOSS] epestfind In-Reply-To: References: <492D621D.6050104@umdnj.edu> Message-ID: <4826ED3C5DF4664C8C2B222B0DDCD12FFD49C1@et.ad.sdsc.edu> Hi all, I am implementing epestfind for my users. I am having trouble making some of the flags work, and wonder if they are vestigial: persisting in the manual but no longer in the code. I looked in the changelog, but don't see anything relevant. Specifically, 1. I cannot find a way to make the sequence modifier -snucleotide1 work. Does the program really accept DNA sequences as input? (I don't see this option in other online portals) 2. for the graph labels, the "subtitle" flag places subtitle text strings in postscript and png files, but the others (xtitle, ytitle, and gtitle) do not. (I see this behavior in other online portals as well: the entry form is there, but it does not produce the promised result). Any advice most appreciated.... Mark From gbottu at vub.ac.be Thu Mar 12 11:41:08 2009 From: gbottu at vub.ac.be (Guy Bottu) Date: Thu, 12 Mar 2009 16:41:08 +0100 Subject: [EMBOSS] MSE blues Message-ID: <49B92D14.2070304@vub.ac.be> Dear friends, I had not used MSE for a long time. I recently discovered that with the most recent versions of some terminal emulation software, like TeraTerm-SSH, MSE does not function properly : it is not possible to delete bases/amino acids by pressing the "Delete" key of the PC, presumably because the character is not relayed properly to the distant computer running EMBOSS. Could the EMBOSS development team mend this by extending the list of characters recognized as a "delete" ? Or do you consider that it is not worth spending effort on MSE ? Regards, Guy Bottu, BEN From andrespinzon at gmail.com Thu Mar 12 20:13:15 2009 From: andrespinzon at gmail.com (Andres Pinzon) Date: Thu, 12 Mar 2009 20:13:15 -0400 Subject: [EMBOSS] recursive backtranslate Message-ID: <8968fc7e0903121713n5b049caby6ee1fc4d55262a0b@mail.gmail.com> Hi everyone, Is it possible to give backtranseq a muliple fasta file as input and have all the sequences in it translated? I have tried several times but backtranseq backtranslates just the first sequence of my multiple fasta file. best, -- Andr?s Pinz?n http://bioinf.ibun.unal.edu.co/~apinzon/ Bioinformatics Center, Colombia EMBnet node http://bioinf.ibun.unal.edu.co Tel +57 3165000 ext 16961 Fax +571 3165415 Micology and Phytopathology Laboratory - Los Andes University. http://bioinf.uniandes.edu.co Tel +571 3394949 ext. 2768 From david.bauer at bayerhealthcare.com Fri Mar 13 02:41:23 2009 From: david.bauer at bayerhealthcare.com (david.bauer at bayerhealthcare.com) Date: Fri, 13 Mar 2009 07:41:23 +0100 Subject: [EMBOSS] recursive backtranslate In-Reply-To: <8968fc7e0903121713n5b049caby6ee1fc4d55262a0b@mail.gmail.com> Message-ID: Hi Andr?s, it just takes one sequence as input. Btw. you can see this if you look what the emboss programs say with -help. > backtranseq -help Standard (Mandatory) qualifiers: [-sequence] sequence (Gapped) protein sequence filename and optional format, or reference (input USA) If it says "sequence" than it takes just one sequence as input. > infoseq -help Standard (Mandatory) qualifiers: [-sequence] seqall (Gapped) sequence(s) filename and optional format, or reference (input USA) If you see "seqall" than the program can work on more than one sequence. For your problem you can either use "seqretsplit" to split up our file into individual sequences or you can write a script which iterates through the multiple fasta file with "skipseq" and sends its output to backtranseq. Cheers, David. emboss-bounces at lists.open-bio.org schrieb am 13/03/2009 01:13:15: > Hi everyone, > Is it possible to give backtranseq a muliple fasta file as input and > have all the sequences in it translated? > I have tried several times but backtranseq backtranslates just the > first sequence of my multiple fasta file. > > best, > > -- > Andr?s Pinz?n > http://bioinf.ibun.unal.edu.co/~apinzon/ > Bioinformatics Center, Colombia EMBnet node > http://bioinf.ibun.unal.edu.co > Tel +57 3165000 ext 16961 Fax +571 3165415 > Micology and Phytopathology Laboratory - Los Andes University. > http://bioinf.uniandes.edu.co > Tel +571 3394949 ext. 2768 > > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss From stephen.taylor at imm.ox.ac.uk Fri Mar 13 04:09:06 2009 From: stephen.taylor at imm.ox.ac.uk (Steve Taylor) Date: Fri, 13 Mar 2009 08:09:06 +0000 Subject: [EMBOSS] fuzzpro oddity Message-ID: <49BA14A2.5060400@imm.ox.ac.uk> Hi, I have an odd problem. I am trying to search a multi-fasta set of proteins. If I do: fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXXW -stdout -auto I get: Error: Sequence is not a protein fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXX -stdout -auto returns results. Any thoughts why? Is this a cryptic way of saying it can't find the motif or some other problem? I have tried this on Solaris 9 EMBOSS version 3.0 and Linux FC8 EMBOSS 6.0 and both give the same responses. Thanks for any help, Steve ------------------------------------------------------------------ Medical Sciences Division Weatherall Institute of Molecular Medicine/Sir William Dunn School Oxford University From pmr at ebi.ac.uk Fri Mar 13 05:30:35 2009 From: pmr at ebi.ac.uk (Peter Rice) Date: Fri, 13 Mar 2009 09:30:35 +0000 Subject: [EMBOSS] recursive backtranslate In-Reply-To: References: Message-ID: <49BA27BB.6010304@ebi.ac.uk> david.bauer at bayerhealthcare.com wrote: emboss-bounces at lists.open-bio.org schrieb am 13/03/2009 01:13:15: > > Is it possible to give backtranseq a muliple fasta file as input and > > have all the sequences in it translated? > > I have tried several times but backtranseq backtranslates just the > > first sequence of my multiple fasta file. > > it just takes one sequence as input. > > For your problem you can either use "seqretsplit" to split up our file > into individual sequences or you can write a script which iterates through > the multiple fasta file with "skipseq" and sends its output to > backtranseq. We have already extended backtranseq for the next release to work over multiple sequences. The changes needed are not difficult if you want to try a little programming. regards, Peter Rice From pmr at ebi.ac.uk Fri Mar 13 05:51:27 2009 From: pmr at ebi.ac.uk (Peter Rice) Date: Fri, 13 Mar 2009 09:51:27 +0000 Subject: [EMBOSS] fuzzpro oddity In-Reply-To: <49BA14A2.5060400@imm.ox.ac.uk> References: <49BA14A2.5060400@imm.ox.ac.uk> Message-ID: <49BA2C9F.5030802@ebi.ac.uk> Steve Taylor wrote: > Hi, > > I have an odd problem. I am trying to search a multi-fasta set of > proteins. If I do: > > fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXXW > -stdout -auto > > I get: > > Error: Sequence is not a protein > > I have tried this on Solaris 9 EMBOSS version 3.0 and Linux FC8 EMBOSS > 6.0 and both give the same responses. We have never seen a report like this before, but we believe you if it happens in version 6 and version 3 ! The message should only come from reading an input sequence from invertebrate.protein.faa and that part should be the same in both cases. Can you please send the invertebrate.protein.faa file to emboss-bug at emboss.open-bio.org You have aroused our curiosity :-) regards, Peter From pmr at ebi.ac.uk Fri Mar 13 10:41:45 2009 From: pmr at ebi.ac.uk (Peter Rice) Date: Fri, 13 Mar 2009 14:41:45 +0000 Subject: [EMBOSS] fuzzpro oddity In-Reply-To: <49BA14A2.5060400@imm.ox.ac.uk> References: <49BA14A2.5060400@imm.ox.ac.uk> Message-ID: <49BA70A9.9010508@ebi.ac.uk> Steve Taylor wrote: > Hi, > > I have an odd problem. I am trying to search a multi-fasta set of > proteins. If I do: > > fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXXW > -stdout -auto > > I get: > > Error: Sequence is not a protein > > fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXX > -stdout -auto > > returns results. > > Any thoughts why? Is this a cryptic way of saying it can't find the > motif or some other problem? Nothing to do with the pattern. There is a strange sequence there: >gi|170590912|ref|XP_001900215.1| hypothetical protein Bm1_43765 [Brugia malayi] MAAQKERLTGDIYJESDIRQKSALSSSATVPSPQMNSQASRSASERQNIWEHRLGIRAPEQNSEQKKYWEYRNIYHIPVP QGIEFWEDEDKKRWEMINIGGLDESEANRQIKKAKLQLARERQQENRGSRTPQTTHIFFIISLICFGLQIVLAAICIGFC IYQIFNNSQIEAGIAFLLLALMLLIGAAGGIFSALKRSENLAICTAVYNVTSAVGIIVAIINLYSFRVGQSGNLSAFIPI AGVVALVQNFNKLS This sequence has a 'J' which is a mass-spec ambiguity code for "I or L" and has somehow crept into a translation (perhaps with an ambiguous codon - there are several possibilties) EMBOSS 3.0.0 refuses to read it. EMBOSS 4.0.0 also fails. EMBOSS 5.0.0 and 6.0.0 understand J and should be able to process it and convert it to X As for the difference between the patterns - they both fail, but without the W it gives some results before it reaches the bad sequence. As you are reporting the results to stdout, it is not so easy to spot ... but just before the tail of the report I get the "Error: Sequence is not a protein" line (as one it to stdout and one is to stderr you may not see it in exactly the same place) Solutions are: edit the J (and any others) to X in the file and of course to update your EMBOSS installation to 6.0.0 As to the missing second message about the bad sequence ... if this were the only sequence in the file it would issue a message because it can read nothing. When reading through a file with many sequences it assumes the first failure is end of file. We need to do something about that - such as adding the sequence name to the message so you know where it stopped. Thanks for the report - it was fun to look into. Peter From pmr at ebi.ac.uk Fri Mar 13 11:26:20 2009 From: pmr at ebi.ac.uk (Peter Rice) Date: Fri, 13 Mar 2009 15:26:20 +0000 Subject: [EMBOSS] fuzzpro oddity In-Reply-To: <49BA76EB.6000409@imm.ox.ac.uk> References: <49BA14A2.5060400@imm.ox.ac.uk> <49BA70A9.9010508@ebi.ac.uk> <49BA76EB.6000409@imm.ox.ac.uk> Message-ID: <49BA7B1C.3010400@ebi.ac.uk> Steve Taylor wrote: > Thanks Peter. > > Nice detective work. I wonder if anybody in NCBI/RefSeq is reading this? > This is where the source is from...I wonder how blast indexing handles > not having a > for example? There was a '>' ... my mailer uses it for quoting so it got converted to '>' but the file was OK. It was only the 'J' in the sequnece that broke things. Peter From andrespinzon at gmail.com Fri Mar 13 11:29:53 2009 From: andrespinzon at gmail.com (Andres Pinzon) Date: Fri, 13 Mar 2009 11:29:53 -0400 Subject: [EMBOSS] recursive backtranslate In-Reply-To: <49BA27BB.6010304@ebi.ac.uk> References: <49BA27BB.6010304@ebi.ac.uk> Message-ID: <8968fc7e0903130829h20d4e967m26df9691b8d13c3a@mail.gmail.com> Hi all, thank you for your answers, Just in case anyone could need it, this is a small bash script which does the job: ============== #!/bin/bash LIST=`ls *.fasta` for i in $LIST do backtranseq -sequence $i -auto done ============ First run seqretsplit on your multiple fasta file, and run this script from the directory where your fasta files were stored. Best, On Fri, Mar 13, 2009 at 5:30 AM, Peter Rice wrote: > david.bauer at bayerhealthcare.com wrote: > emboss-bounces at lists.open-bio.org schrieb am 13/03/2009 01:13:15: >> >> > Is it possible to give backtranseq a muliple fasta file as input and >> > have all the sequences in it translated? >> > I have tried several times but backtranseq ?backtranslates just the >> > first sequence of my multiple fasta file. >> >> it just takes one sequence as input. >> >> For your problem you can either use "seqretsplit" to split up our file >> into individual sequences or you can write a script which iterates through >> the multiple fasta file with "skipseq" and sends its output to backtranseq. > > We have already extended backtranseq for the next release to work over > multiple sequences. > > The changes needed are not difficult if you want to try a little > programming. > > regards, > > Peter Rice > -- Andr?s Pinz?n http://bioinf.ibun.unal.edu.co/~apinzon/ Bioinformatics Center, Colombia EMBnet node http://bioinf.ibun.unal.edu.co Tel +57 3165000 ext 16961 Fax +571 3165415 Micology and Phytopathology Laboratory - Los Andes University. http://bioinf.uniandes.edu.co Tel +571 3394949 ext. 2768 From andrespinzon at gmail.com Fri Mar 13 11:36:17 2009 From: andrespinzon at gmail.com (Andres Pinzon) Date: Fri, 13 Mar 2009 11:36:17 -0400 Subject: [EMBOSS] fuzzpro oddity In-Reply-To: <49BA7B1C.3010400@ebi.ac.uk> References: <49BA14A2.5060400@imm.ox.ac.uk> <49BA70A9.9010508@ebi.ac.uk> <49BA76EB.6000409@imm.ox.ac.uk> <49BA7B1C.3010400@ebi.ac.uk> Message-ID: <8968fc7e0903130836k4fb9a8edn96e7ac535afa659f@mail.gmail.com> Hi Steve, just in case you have to change J for X in several fasta files, several times, this bash script does the job: find -type f -name '*.fasta' -print0 | xargs --null perl -pi -e 's/J/X/' Hope it helps, Best On Fri, Mar 13, 2009 at 11:26 AM, Peter Rice wrote: > Steve Taylor wrote: >> >> Thanks Peter. >> >> Nice detective work. I wonder if anybody in NCBI/RefSeq is reading this? >> This is where the source is from...I wonder how blast indexing handles not >> having a > for example? > > There was a '>' ... my mailer uses it for quoting so it got converted to > '>' but the file was OK. It was only the 'J' in the sequnece that broke > things. > > Peter > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > -- Andr?s Pinz?n http://bioinf.ibun.unal.edu.co/~apinzon/ Bioinformatics Center, Colombia EMBnet node http://bioinf.ibun.unal.edu.co Tel +57 3165000 ext 16961 Fax +571 3165415 Micology and Phytopathology Laboratory - Los Andes University. http://bioinf.uniandes.edu.co Tel +571 3394949 ext. 2768 From stephen.taylor at imm.ox.ac.uk Fri Mar 13 11:08:27 2009 From: stephen.taylor at imm.ox.ac.uk (Steve Taylor) Date: Fri, 13 Mar 2009 15:08:27 +0000 Subject: [EMBOSS] fuzzpro oddity In-Reply-To: <49BA70A9.9010508@ebi.ac.uk> References: <49BA14A2.5060400@imm.ox.ac.uk> <49BA70A9.9010508@ebi.ac.uk> Message-ID: <49BA76EB.6000409@imm.ox.ac.uk> Thanks Peter. Nice detective work. I wonder if anybody in NCBI/RefSeq is reading this? This is where the source is from...I wonder how blast indexing handles not having a > for example? Steve >> >> I have an odd problem. I am trying to search a multi-fasta set of >> proteins. If I do: >> >> fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXXW >> -stdout -auto >> >> I get: >> >> Error: Sequence is not a protein >> >> fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXX >> -stdout -auto >> >> returns results. >> >> Any thoughts why? Is this a cryptic way of saying it can't find the >> motif or some other problem? > > > Nothing to do with the pattern. There is a strange sequence there: > > >gi|170590912|ref|XP_001900215.1| hypothetical protein Bm1_43765 > [Brugia malayi] > MAAQKERLTGDIYJESDIRQKSALSSSATVPSPQMNSQASRSASERQNIWEHRLGIRAPEQNSEQKKYWEYRNIYHIPVP > > QGIEFWEDEDKKRWEMINIGGLDESEANRQIKKAKLQLARERQQENRGSRTPQTTHIFFIISLICFGLQIVLAAICIGFC > > IYQIFNNSQIEAGIAFLLLALMLLIGAAGGIFSALKRSENLAICTAVYNVTSAVGIIVAIINLYSFRVGQSGNLSAFIPI > > AGVVALVQNFNKLS > > This sequence has a 'J' which is a mass-spec ambiguity code for "I or L" > and has somehow crept into a translation (perhaps with an ambiguous > codon - there are several possibilties) > > EMBOSS 3.0.0 refuses to read it. EMBOSS 4.0.0 also fails. > > EMBOSS 5.0.0 and 6.0.0 understand J and should be able to process it and > convert it to X > > As for the difference between the patterns - they both fail, but without > the W it gives some results before it reaches the bad sequence. > > As you are reporting the results to stdout, it is not so easy to spot ... > but just before the tail of the report I get the "Error: Sequence is not > a protein" line (as one it to stdout and one is to stderr you may not > see it in exactly the same place) > > Solutions are: edit the J (and any others) to X in the file > and of course to update your EMBOSS installation to 6.0.0 > > As to the missing second message about the bad sequence ... if this were > the > only sequence in the file it would issue a message because it can read > nothing. When reading through a file with many sequences it assumes the > first failure is end of file. We need to do something about that - such > as adding the sequence name to the message so you know where it stopped. > > Thanks for the report - it was fun to look into. > > Peter > > > From mincloud at gmail.com Wed Mar 18 01:12:38 2009 From: mincloud at gmail.com (yun zheng) Date: Wed, 18 Mar 2009 13:12:38 +0800 Subject: [EMBOSS] make error Message-ID: <8f6eb9540903172212n289d21e2y1b42c517645aac6c@mail.gmail.com> Hi, I met a lot of errors when I typed make in EMBOSS 6.0.1 folder. #./configure #make ... xwin.c:3394: error: 'XwDev' has no member named 'write_to_window' xwin.c:3398: error: 'XwDev' has no member named 'write_to_window' xwin.c:3402: error: 'XwDev' has no member named 'write_to_pixmap' xwin.c:3406: error: 'XwDisplay' has no member named 'display' xwin.c:3407: error: 'XwDev' has no member named 'write_to_pixmap' make[2]: *** [xwin.lo] Error 1 make[2]: Leaving directory `/home/zhengy/software/EMBOSS-6.0.1/EMBOSS-6.0.1/plplot' make[1]: *** [all-recursive] Error 1 make[1]: Leaving directory `/home/zhengy/software/EMBOSS-6.0.1/EMBOSS-6.0.1/plplot' make: *** [all-recursive] Error 1 My machine is installed with a 64-bit GNU Linux (CentOS). # uname -a Linux IDM-DNA 2.6.18-92.1.22.el5 #1 SMP Tue Dec 16 11:57:43 EST 2008 x86_64 x86_64 x86_64 GNU/Linux Could you help me to solve the problem? Many thanks. sincerely zheng, yun Institute of Deveopmental Biology and Molecular Medicine Fudan University 200 Handan Rd Shanghai, China 200433 From ajb at ebi.ac.uk Wed Mar 18 05:09:49 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Wed, 18 Mar 2009 09:09:49 -0000 (GMT) Subject: [EMBOSS] make error In-Reply-To: <8f6eb9540903172212n289d21e2y1b42c517645aac6c@mail.gmail.com> References: <8f6eb9540903172212n289d21e2y1b42c517645aac6c@mail.gmail.com> Message-ID: <60593.86.9.126.186.1237367389.squirrel@webmail.ebi.ac.uk> Hi, You need to install the X11 development files for CentOS from your DVD. For that Linux distribution the RPM is probably called 'xorg-x11-proto-devel'. While you're doing that you may want to install the 'gd-devel' RPM at the same time (which will enable PNG support). After that do a 'make clean' and redo the './configure' step. The FAQ does give a hint to the above but I'll see whether it needs updating for CentOS. Alan > Hi, I met a lot of errors when I typed make in EMBOSS 6.0.1 folder. > > #./configure > #make > ... > xwin.c:3394: error: 'XwDev' has no member named 'write_to_window' > xwin.c:3398: error: 'XwDev' has no member named 'write_to_window' > xwin.c:3402: error: 'XwDev' has no member named 'write_to_pixmap' > xwin.c:3406: error: 'XwDisplay' has no member named 'display' > xwin.c:3407: error: 'XwDev' has no member named 'write_to_pixmap' > make[2]: *** [xwin.lo] Error 1 > make[2]: Leaving directory > `/home/zhengy/software/EMBOSS-6.0.1/EMBOSS-6.0.1/plplot' > make[1]: *** [all-recursive] Error 1 > make[1]: Leaving directory > `/home/zhengy/software/EMBOSS-6.0.1/EMBOSS-6.0.1/plplot' > make: *** [all-recursive] Error 1 > > My machine is installed with a 64-bit GNU Linux (CentOS). > # uname -a > Linux IDM-DNA 2.6.18-92.1.22.el5 #1 SMP Tue Dec 16 11:57:43 EST 2008 > x86_64 > x86_64 x86_64 GNU/Linux > > Could you help me to solve the problem? > > Many thanks. > > sincerely > zheng, yun > > Institute of Deveopmental Biology and Molecular Medicine > Fudan University > 200 Handan Rd > Shanghai, China 200433 > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > From fernan at iib.unsam.edu.ar Tue Mar 17 08:19:33 2009 From: fernan at iib.unsam.edu.ar (Fernan Aguero) Date: Tue, 17 Mar 2009 09:19:33 -0300 Subject: [EMBOSS] emboss-6.0.1 fails to build without X Message-ID: <20090317121933.GC68123@iib.unsam.edu.ar> ./configure --without-x [ ... succeeds ... ] make [ ... fails ... ] [ lots of errors from xwin.c ...] xwin.c: In function `imageops': xwin.c:3406: error: structure has no member named `display' *** Error code 1 This is on FreeBSD-6.3, gcc-3.4.6, gnu make 3.81 Typescript is attached. Cheers, Fernan -------------- next part -------------- Script started on Tue Mar 17 09:15:38 2009 gama# ./configfgguure --without-x checking for a BSD-compatible install... /usr/bin/install -c checking whether build environment is sane... yes checking for a thread-safe mkdir -p... ./install-sh -c -d checking for gawk... no checking for mawk... no checking for nawk... nawk checking whether make sets $(MAKE)... yes checking for gawk... (cached) nawk checking for gcc... gcc checking for C compiler default output file name... a.out checking whether the C compiler works... yes checking whether we are cross compiling... no checking for suffix of executables... checking for suffix of object files... o checking whether we are using the GNU C compiler... yes checking whether gcc accepts -g... yes checking for gcc option to accept ISO C89... none needed checking for style of include used by make... GNU checking dependency style of gcc... gcc3 checking how to run the C preprocessor... gcc -E checking build system type... i386-unknown-freebsd6.3 checking host system type... i386-unknown-freebsd6.3 checking for a sed that does not truncate output... /usr/bin/sed checking for grep that handles long lines and -e... /usr/bin/grep checking for egrep... /usr/bin/grep -E checking for ld used by gcc... /usr/bin/ld checking if the linker (/usr/bin/ld) is GNU ld... yes checking for /usr/bin/ld option to reload object files... -r checking for BSD-compatible nm... /usr/bin/nm -B checking whether ln -s works... yes checking how to recognize dependent libraries... pass_all checking for ANSI C header files... yes checking for sys/types.h... yes checking for sys/stat.h... yes checking for stdlib.h... yes checking for string.h... yes checking for memory.h... yes checking for strings.h... yes checking for inttypes.h... yes checking for stdint.h... yes checking for unistd.h... yes checking dlfcn.h usability... yes checking dlfcn.h presence... yes checking for dlfcn.h... yes checking for g++... g++ checking whether we are using the GNU C++ compiler... yes checking whether g++ accepts -g... yes checking dependency style of g++... gcc3 checking how to run the C++ preprocessor... g++ -E checking for g77... no checking for xlf... no checking for f77... f77 checking whether we are using the GNU Fortran 77 compiler... yes checking whether f77 accepts -g... yes checking the maximum length of command line arguments... 196608 checking command to parse /usr/bin/nm -B output from gcc object... ok checking for objdir... .libs checking for ar... ar checking for ranlib... ranlib checking for strip... strip checking if gcc supports -fno-rtti -fno-exceptions... no checking for gcc option to produce PIC... -fPIC checking if gcc PIC flag -fPIC works... yes checking if gcc static flag -static works... yes checking if gcc supports -c -o file.o... yes checking whether the gcc linker (/usr/bin/ld) supports shared libraries... yes checking whether -lc should be explicitly linked in... yes checking dynamic linker characteristics... freebsd6.3 ld.so checking how to hardcode library paths into programs... immediate checking whether stripping libraries is possible... yes checking if libtool supports shared libraries... yes checking whether to build shared libraries... yes checking whether to build static libraries... yes configure: creating libtool appending configuration tag "CXX" to libtool checking for ld used by g++... /usr/bin/ld checking if the linker (/usr/bin/ld) is GNU ld... yes checking whether the g++ linker (/usr/bin/ld) supports shared libraries... yes checking for g++ option to produce PIC... -fPIC checking if g++ PIC flag -fPIC works... yes checking if g++ static flag -static works... yes checking if g++ supports -c -o file.o... yes checking whether the g++ linker (/usr/bin/ld) supports shared libraries... yes checking dynamic linker characteristics... freebsd6.3 ld.so checking how to hardcode library paths into programs... immediate appending configuration tag "F77" to libtool checking if libtool supports shared libraries... yes checking whether to build shared libraries... yes checking whether to build static libraries... yes checking for f77 option to produce PIC... -fPIC checking if f77 PIC flag -fPIC works... yes checking if f77 static flag -static works... yes checking if f77 supports -c -o file.o... yes checking whether the f77 linker (/usr/bin/ld) supports shared libraries... yes checking dynamic linker characteristics... freebsd6.3 ld.so checking how to hardcode library paths into programs... immediate checking whether byte ordering is bigendian... no checking for a BSD-compatible install... /usr/bin/install -c checking whether ln -s works... yes checking whether make sets $(MAKE)... (cached) yes checking for ranlib... (cached) ranlib checking for X... disabled checking for dirent.h that defines DIR... yes checking for library containing opendir... none required checking for ANSI C header files... (cached) yes checking for unistd.h... (cached) yes checking for an ANSI C-conforming const... yes checking for pid_t... yes checking for size_t... yes checking whether struct tm is in sys/time.h or time.h... time.h checking whether getpgrp requires zero arguments... yes checking for strftime... yes checking vfork.h usability... no checking vfork.h presence... no checking for vfork.h... no checking for fork... yes checking for vfork... yes checking for working fork... yes checking for working vfork... (cached) yes checking for vprintf... yes checking for _doprnt... no checking for memmove... yes checking for gethostbyname in -lc... yes checking for socket in -lc... yes checking for main in -lm... yes ./configure: line 23442: !=: command not found checking if docroot is given... no checking if gcc profiling is selected... no checking if java include directory given... no checking if java OS include directory given... no checking if png driver is wanted... yes checking for inflateEnd in -lz... yes checking for png_destroy_read_struct in -lpng... no No png driver will be made due to librarys missing/old. checking if any authorisation type is given... no checking for gdome2... no checking if Linux x86_64... no checking for large file support... done checking for purify... no checking for cygwin... no checking for mprobe... no checking for savestats... no checking if any threading type is given... no configure: creating ./config.status config.status: creating plplot/Makefile config.status: creating plplot/lib/Makefile config.status: creating nucleus/Makefile config.status: creating ajax/Makefile config.status: creating emboss/Makefile config.status: creating emboss/acd/Makefile config.status: creating test/Makefile config.status: creating test/data/Makefile config.status: creating test/embl/Makefile config.status: creating test/genbank/Makefile config.status: creating test/gb/Makefile config.status: creating test/pir/Makefile config.status: creating test/swiss/Makefile config.status: creating test/swnew/Makefile config.status: creating test/testdb/Makefile config.status: creating test/wormpep/Makefile config.status: creating emboss/data/Makefile config.status: creating emboss/data/AAINDEX/Makefile config.status: creating emboss/data/CODONS/Makefile config.status: creating emboss/data/REBASE/Makefile config.status: creating emboss/data/JASPAR_CORE/Makefile config.status: creating emboss/data/JASPAR_FAM/Makefile config.status: creating emboss/data/JASPAR_PHYLOFACTS/Makefile config.status: creating emboss/data/JASPAR_CNE/Makefile config.status: creating emboss/data/JASPAR_POLII/Makefile config.status: creating emboss/data/JASPAR_SPLICE/Makefile config.status: creating emboss/data/PRINTS/Makefile config.status: creating emboss/data/PROSITE/Makefile config.status: creating doc/Makefile config.status: creating doc/manuals/Makefile config.status: creating doc/tutorials/Makefile config.status: creating doc/programs/Makefile config.status: creating doc/programs/html/Makefile config.status: creating doc/programs/text/Makefile config.status: creating jemboss/Makefile config.status: creating jemboss/api/Makefile config.status: creating jemboss/api/org/Makefile config.status: creating jemboss/api/org/emboss/Makefile config.status: creating jemboss/api/org/emboss/jemboss/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/filetree/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/form/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/sequenceChooser/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/startup/Makefile config.status: creating jemboss/api/org/emboss/jemboss/parser/Makefile config.status: creating jemboss/api/org/emboss/jemboss/parser/acd/Makefile config.status: creating jemboss/api/org/emboss/jemboss/programs/Makefile config.status: creating jemboss/api/org/emboss/jemboss/soap/Makefile config.status: creating jemboss/images/Makefile config.status: creating jemboss/lib/Makefile config.status: creating jemboss/lib/axis/Makefile config.status: creating jemboss/org/Makefile config.status: creating jemboss/org/emboss/Makefile config.status: creating jemboss/org/emboss/jemboss/Makefile config.status: creating jemboss/org/emboss/jemboss/graphics/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/filetree/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/form/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/startup/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/sequenceChooser/Makefile config.status: creating jemboss/org/emboss/jemboss/parser/Makefile config.status: creating jemboss/org/emboss/jemboss/parser/acd/Makefile config.status: creating jemboss/org/emboss/jemboss/programs/Makefile config.status: creating jemboss/org/emboss/jemboss/server/Makefile config.status: creating jemboss/org/emboss/jemboss/soap/Makefile config.status: creating jemboss/org/emboss/jemboss/editor/Makefile config.status: creating jemboss/org/emboss/jemboss/draw/Makefile config.status: creating jemboss/resources/Makefile config.status: creating jemboss/utils/Makefile config.status: creating Makefile config.status: executing depfiles commands gama# gmake Making all in plplot gmake[1]: Entering directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' Making all in lib gmake[2]: Entering directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot/lib' gmake[2]: Nothing to be done for `all'. gmake[2]: Leaving directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot/lib' gmake[2]: Entering directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pdfutils.lo -MD -MP -MF .deps/pdfutils.Tpo -c -o pdfutils.lo pdfutils.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pdfutils.lo -MD -MP -MF .deps/pdfutils.Tpo -c pdfutils.c -fPIC -DPIC -o .libs/pdfutils.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pdfutils.lo -MD -MP -MF .deps/pdfutils.Tpo -c pdfutils.c -o pdfutils.o >/dev/null 2>&1 mv -f .deps/pdfutils.Tpo .deps/pdfutils.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plargs.lo -MD -MP -MF .deps/plargs.Tpo -c -o plargs.lo plargs.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plargs.lo -MD -MP -MF .deps/plargs.Tpo -c plargs.c -fPIC -DPIC -o .libs/plargs.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plargs.lo -MD -MP -MF .deps/plargs.Tpo -c plargs.c -o plargs.o >/dev/null 2>&1 mv -f .deps/plargs.Tpo .deps/plargs.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbox.lo -MD -MP -MF .deps/plbox.Tpo -c -o plbox.lo plbox.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbox.lo -MD -MP -MF .deps/plbox.Tpo -c plbox.c -fPIC -DPIC -o .libs/plbox.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbox.lo -MD -MP -MF .deps/plbox.Tpo -c plbox.c -o plbox.o >/dev/null 2>&1 mv -f .deps/plbox.Tpo .deps/plbox.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcont.lo -MD -MP -MF .deps/plcont.Tpo -c -o plcont.lo plcont.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcont.lo -MD -MP -MF .deps/plcont.Tpo -c plcont.c -fPIC -DPIC -o .libs/plcont.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcont.lo -MD -MP -MF .deps/plcont.Tpo -c plcont.c -o plcont.o >/dev/null 2>&1 mv -f .deps/plcont.Tpo .deps/plcont.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcore.lo -MD -MP -MF .deps/plcore.Tpo -c -o plcore.lo plcore.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcore.lo -MD -MP -MF .deps/plcore.Tpo -c plcore.c -fPIC -DPIC -o .libs/plcore.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcore.lo -MD -MP -MF .deps/plcore.Tpo -c plcore.c -o plcore.o >/dev/null 2>&1 mv -f .deps/plcore.Tpo .deps/plcore.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plctrl.lo -MD -MP -MF .deps/plctrl.Tpo -c -o plctrl.lo plctrl.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plctrl.lo -MD -MP -MF .deps/plctrl.Tpo -c plctrl.c -fPIC -DPIC -o .libs/plctrl.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plctrl.lo -MD -MP -MF .deps/plctrl.Tpo -c plctrl.c -o plctrl.o >/dev/null 2>&1 mv -f .deps/plctrl.Tpo .deps/plctrl.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcvt.lo -MD -MP -MF .deps/plcvt.Tpo -c -o plcvt.lo plcvt.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcvt.lo -MD -MP -MF .deps/plcvt.Tpo -c plcvt.c -fPIC -DPIC -o .libs/plcvt.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcvt.lo -MD -MP -MF .deps/plcvt.Tpo -c plcvt.c -o plcvt.o >/dev/null 2>&1 mv -f .deps/plcvt.Tpo .deps/plcvt.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pldtik.lo -MD -MP -MF .deps/pldtik.Tpo -c -o pldtik.lo pldtik.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pldtik.lo -MD -MP -MF .deps/pldtik.Tpo -c pldtik.c -fPIC -DPIC -o .libs/pldtik.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pldtik.lo -MD -MP -MF .deps/pldtik.Tpo -c pldtik.c -o pldtik.o >/dev/null 2>&1 mv -f .deps/pldtik.Tpo .deps/pldtik.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plfill.lo -MD -MP -MF .deps/plfill.Tpo -c -o plfill.lo plfill.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plfill.lo -MD -MP -MF .deps/plfill.Tpo -c plfill.c -fPIC -DPIC -o .libs/plfill.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plfill.lo -MD -MP -MF .deps/plfill.Tpo -c plfill.c -o plfill.o >/dev/null 2>&1 mv -f .deps/plfill.Tpo .deps/plfill.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plhist.lo -MD -MP -MF .deps/plhist.Tpo -c -o plhist.lo plhist.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plhist.lo -MD -MP -MF .deps/plhist.Tpo -c plhist.c -fPIC -DPIC -o .libs/plhist.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plhist.lo -MD -MP -MF .deps/plhist.Tpo -c plhist.c -o plhist.o >/dev/null 2>&1 mv -f .deps/plhist.Tpo .deps/plhist.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plline.lo -MD -MP -MF .deps/plline.Tpo -c -o plline.lo plline.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plline.lo -MD -MP -MF .deps/plline.Tpo -c plline.c -fPIC -DPIC -o .libs/plline.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plline.lo -MD -MP -MF .deps/plline.Tpo -c plline.c -o plline.o >/dev/null 2>&1 mv -f .deps/plline.Tpo .deps/plline.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmap.lo -MD -MP -MF .deps/plmap.Tpo -c -o plmap.lo plmap.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmap.lo -MD -MP -MF .deps/plmap.Tpo -c plmap.c -fPIC -DPIC -o .libs/plmap.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmap.lo -MD -MP -MF .deps/plmap.Tpo -c plmap.c -o plmap.o >/dev/null 2>&1 mv -f .deps/plmap.Tpo .deps/plmap.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plot3d.lo -MD -MP -MF .deps/plot3d.Tpo -c -o plot3d.lo plot3d.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plot3d.lo -MD -MP -MF .deps/plot3d.Tpo -c plot3d.c -fPIC -DPIC -o .libs/plot3d.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plot3d.lo -MD -MP -MF .deps/plot3d.Tpo -c plot3d.c -o plot3d.o >/dev/null 2>&1 mv -f .deps/plot3d.Tpo .deps/plot3d.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plpage.lo -MD -MP -MF .deps/plpage.Tpo -c -o plpage.lo plpage.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plpage.lo -MD -MP -MF .deps/plpage.Tpo -c plpage.c -fPIC -DPIC -o .libs/plpage.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plpage.lo -MD -MP -MF .deps/plpage.Tpo -c plpage.c -o plpage.o >/dev/null 2>&1 mv -f .deps/plpage.Tpo .deps/plpage.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsdef.lo -MD -MP -MF .deps/plsdef.Tpo -c -o plsdef.lo plsdef.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsdef.lo -MD -MP -MF .deps/plsdef.Tpo -c plsdef.c -fPIC -DPIC -o .libs/plsdef.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsdef.lo -MD -MP -MF .deps/plsdef.Tpo -c plsdef.c -o plsdef.o >/dev/null 2>&1 mv -f .deps/plsdef.Tpo .deps/plsdef.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plshade.lo -MD -MP -MF .deps/plshade.Tpo -c -o plshade.lo plshade.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plshade.lo -MD -MP -MF .deps/plshade.Tpo -c plshade.c -fPIC -DPIC -o .libs/plshade.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plshade.lo -MD -MP -MF .deps/plshade.Tpo -c plshade.c -o plshade.o >/dev/null 2>&1 mv -f .deps/plshade.Tpo .deps/plshade.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsym.lo -MD -MP -MF .deps/plsym.Tpo -c -o plsym.lo plsym.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsym.lo -MD -MP -MF .deps/plsym.Tpo -c plsym.c -fPIC -DPIC -o .libs/plsym.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsym.lo -MD -MP -MF .deps/plsym.Tpo -c plsym.c -o plsym.o >/dev/null 2>&1 mv -f .deps/plsym.Tpo .deps/plsym.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pltick.lo -MD -MP -MF .deps/pltick.Tpo -c -o pltick.lo pltick.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pltick.lo -MD -MP -MF .deps/pltick.Tpo -c pltick.c -fPIC -DPIC -o .libs/pltick.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pltick.lo -MD -MP -MF .deps/pltick.Tpo -c pltick.c -o pltick.o >/dev/null 2>&1 mv -f .deps/pltick.Tpo .deps/pltick.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plvpor.lo -MD -MP -MF .deps/plvpor.Tpo -c -o plvpor.lo plvpor.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plvpor.lo -MD -MP -MF .deps/plvpor.Tpo -c plvpor.c -fPIC -DPIC -o .libs/plvpor.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plvpor.lo -MD -MP -MF .deps/plvpor.Tpo -c plvpor.c -o plvpor.o >/dev/null 2>&1 mv -f .deps/plvpor.Tpo .deps/plvpor.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plwind.lo -MD -MP -MF .deps/plwind.Tpo -c -o plwind.lo plwind.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plwind.lo -MD -MP -MF .deps/plwind.Tpo -c plwind.c -fPIC -DPIC -o .libs/plwind.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plwind.lo -MD -MP -MF .deps/plwind.Tpo -c plwind.c -o plwind.o >/dev/null 2>&1 mv -f .deps/plwind.Tpo .deps/plwind.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plstripc.lo -MD -MP -MF .deps/plstripc.Tpo -c -o plstripc.lo plstripc.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plstripc.lo -MD -MP -MF .deps/plstripc.Tpo -c plstripc.c -fPIC -DPIC -o .libs/plstripc.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plstripc.lo -MD -MP -MF .deps/plstripc.Tpo -c plstripc.c -o plstripc.o >/dev/null 2>&1 mv -f .deps/plstripc.Tpo .deps/plstripc.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT hpgl.lo -MD -MP -MF .deps/hpgl.Tpo -c -o hpgl.lo hpgl.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT hpgl.lo -MD -MP -MF .deps/hpgl.Tpo -c hpgl.c -fPIC -DPIC -o .libs/hpgl.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT hpgl.lo -MD -MP -MF .deps/hpgl.Tpo -c hpgl.c -o hpgl.o >/dev/null 2>&1 mv -f .deps/hpgl.Tpo .deps/hpgl.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT impress.lo -MD -MP -MF .deps/impress.Tpo -c -o impress.lo impress.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT impress.lo -MD -MP -MF .deps/impress.Tpo -c impress.c -fPIC -DPIC -o .libs/impress.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT impress.lo -MD -MP -MF .deps/impress.Tpo -c impress.c -o impress.o >/dev/null 2>&1 mv -f .deps/impress.Tpo .deps/impress.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljiip.lo -MD -MP -MF .deps/ljiip.Tpo -c -o ljiip.lo ljiip.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljiip.lo -MD -MP -MF .deps/ljiip.Tpo -c ljiip.c -fPIC -DPIC -o .libs/ljiip.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljiip.lo -MD -MP -MF .deps/ljiip.Tpo -c ljiip.c -o ljiip.o >/dev/null 2>&1 mv -f .deps/ljiip.Tpo .deps/ljiip.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljii.lo -MD -MP -MF .deps/ljii.Tpo -c -o ljii.lo ljii.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljii.lo -MD -MP -MF .deps/ljii.Tpo -c ljii.c -fPIC -DPIC -o .libs/ljii.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljii.lo -MD -MP -MF .deps/ljii.Tpo -c ljii.c -o ljii.o >/dev/null 2>&1 mv -f .deps/ljii.Tpo .deps/ljii.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT null.lo -MD -MP -MF .deps/null.Tpo -c -o null.lo null.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT null.lo -MD -MP -MF .deps/null.Tpo -c null.c -fPIC -DPIC -o .libs/null.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT null.lo -MD -MP -MF .deps/null.Tpo -c null.c -o null.o >/dev/null 2>&1 mv -f .deps/null.Tpo .deps/null.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT data.lo -MD -MP -MF .deps/data.Tpo -c -o data.lo data.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT data.lo -MD -MP -MF .deps/data.Tpo -c data.c -fPIC -DPIC -o .libs/data.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT data.lo -MD -MP -MF .deps/data.Tpo -c data.c -o data.o >/dev/null 2>&1 mv -f .deps/data.Tpo .deps/data.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pbm.lo -MD -MP -MF .deps/pbm.Tpo -c -o pbm.lo pbm.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pbm.lo -MD -MP -MF .deps/pbm.Tpo -c pbm.c -fPIC -DPIC -o .libs/pbm.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pbm.lo -MD -MP -MF .deps/pbm.Tpo -c pbm.c -o pbm.o >/dev/null 2>&1 mv -f .deps/pbm.Tpo .deps/pbm.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbuf.lo -MD -MP -MF .deps/plbuf.Tpo -c -o plbuf.lo plbuf.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbuf.lo -MD -MP -MF .deps/plbuf.Tpo -c plbuf.c -fPIC -DPIC -o .libs/plbuf.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbuf.lo -MD -MP -MF .deps/plbuf.Tpo -c plbuf.c -o plbuf.o >/dev/null 2>&1 mv -f .deps/plbuf.Tpo .deps/plbuf.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmeta.lo -MD -MP -MF .deps/plmeta.Tpo -c -o plmeta.lo plmeta.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmeta.lo -MD -MP -MF .deps/plmeta.Tpo -c plmeta.c -fPIC -DPIC -o .libs/plmeta.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmeta.lo -MD -MP -MF .deps/plmeta.Tpo -c plmeta.c -o plmeta.o >/dev/null 2>&1 mv -f .deps/plmeta.Tpo .deps/plmeta.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ps.lo -MD -MP -MF .deps/ps.Tpo -c -o ps.lo ps.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ps.lo -MD -MP -MF .deps/ps.Tpo -c ps.c -fPIC -DPIC -o .libs/ps.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ps.lo -MD -MP -MF .deps/ps.Tpo -c ps.c -o ps.o >/dev/null 2>&1 mv -f .deps/ps.Tpo .deps/ps.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT tek.lo -MD -MP -MF .deps/tek.Tpo -c -o tek.lo tek.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT tek.lo -MD -MP -MF .deps/tek.Tpo -c tek.c -fPIC -DPIC -o .libs/tek.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT tek.lo -MD -MP -MF .deps/tek.Tpo -c tek.c -o tek.o >/dev/null 2>&1 mv -f .deps/tek.Tpo .deps/tek.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xfig.lo -MD -MP -MF .deps/xfig.Tpo -c -o xfig.lo xfig.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xfig.lo -MD -MP -MF .deps/xfig.Tpo -c xfig.c -fPIC -DPIC -o .libs/xfig.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xfig.lo -MD -MP -MF .deps/xfig.Tpo -c xfig.c -o xfig.o >/dev/null 2>&1 mv -f .deps/xfig.Tpo .deps/xfig.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xwin.lo -MD -MP -MF .deps/xwin.Tpo -c -o xwin.lo xwin.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xwin.lo -MD -MP -MF .deps/xwin.Tpo -c xwin.c -fPIC -DPIC -o .libs/xwin.o In file included from xwin.c:34: plxwd.h:22:22: X11/Xlib.h: No such file or directory plxwd.h:23:23: X11/Xutil.h: No such file or directory plxwd.h:24:28: X11/cursorfont.h: No such file or directory plxwd.h:25:24: X11/keysym.h: No such file or directory In file included from xwin.c:34: plxwd.h:51: error: syntax error before "Display" plxwd.h:61: error: syntax error before "XColor" plxwd.h:76: error: syntax error before "Window" plxwd.h:107: error: syntax error before "XPoint" plxwd.h:109: error: syntax error before "XEvent" xwin.c:119: error: syntax error before "sxwm_colors" xwin.c:119: warning: data definition has no type or storage class xwin.c:154: error: syntax error before '*' token xwin.c:164: error: syntax error before "XEvent" xwin.c:165: error: syntax error before "XEvent" xwin.c:166: error: syntax error before "XEvent" xwin.c:167: error: syntax error before "XEvent" xwin.c:168: error: syntax error before "XEvent" xwin.c:169: error: syntax error before "XEvent" xwin.c:170: error: syntax error before "XEvent" xwin.c:171: error: syntax error before "XEvent" xwin.c:172: error: syntax error before "XEvent" xwin.c:173: error: syntax error before "XEvent" xwin.c:208: error: syntax error before "XColor" xwin.c:209: error: syntax error before "XColor" xwin.c: In function `plD_line_xw': xwin.c:375: error: structure has no member named `display' xwin.c:375: error: structure has no member named `window' xwin.c:375: error: structure has no member named `gc' xwin.c:378: error: structure has no member named `display' xwin.c:378: error: structure has no member named `pixmap' xwin.c:378: error: structure has no member named `gc' xwin.c: In function `XorMod': xwin.c:399: error: structure has no member named `display' xwin.c:399: error: structure has no member named `gc' xwin.c:399: error: `GXcopy' undeclared (first use in this function) xwin.c:399: error: (Each undeclared identifier is reported only once xwin.c:399: error: for each function it appears in.) xwin.c:401: error: structure has no member named `display' xwin.c:401: error: structure has no member named `gc' xwin.c:401: error: `GXxor' undeclared (first use in this function) xwin.c: In function `plD_polyline_xw': xwin.c:417: error: syntax error before "pts" xwin.c:432: error: `pts' undeclared (first use in this function) xwin.c:437: error: structure has no member named `display' xwin.c:437: error: structure has no member named `window' xwin.c:437: error: structure has no member named `gc' xwin.c:438: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:441: error: structure has no member named `display' xwin.c:441: error: structure has no member named `pixmap' xwin.c:441: error: structure has no member named `gc' xwin.c: In function `plD_eop_xw': xwin.c:469: error: structure has no member named `display' xwin.c: In function `plD_bop_xw': xwin.c:502: error: structure has no member named `display' xwin.c:502: error: structure has no member named `window' xwin.c:505: error: structure has no member named `display' xwin.c:505: error: structure has no member named `gc' xwin.c:505: error: structure has no member named `cmap0' xwin.c:506: error: structure has no member named `display' xwin.c:506: error: structure has no member named `pixmap' xwin.c:506: error: structure has no member named `gc' xwin.c:508: error: structure has no member named `display' xwin.c:508: error: structure has no member named `gc' xwin.c:508: error: structure has no member named `curcolor' xwin.c:510: error: structure has no member named `display' xwin.c: In function `plD_tidy_xw': xwin.c:547: error: structure has no member named `display' xwin.c:547: error: structure has no member named `window' xwin.c:549: error: structure has no member named `display' xwin.c:549: error: structure has no member named `pixmap' xwin.c:550: error: structure has no member named `display' xwin.c:556: error: structure has no member named `display' xwin.c:556: error: structure has no member named `gc' xwin.c:557: error: structure has no member named `display' xwin.c:557: error: structure has no member named `gcXor' xwin.c:558: error: structure has no member named `display' xwin.c:559: error: structure has no member named `cmap0' xwin.c:559: error: structure has no member named `cmap0' xwin.c:559: error: structure has no member named `cmap0' xwin.c:560: error: structure has no member named `cmap1' xwin.c:560: error: structure has no member named `cmap1' xwin.c:560: error: structure has no member named `cmap1' xwin.c: In function `plD_state_xw': xwin.c:592: error: structure has no member named `display' xwin.c:592: error: structure has no member named `gc' xwin.c:593: error: `LineSolid' undeclared (first use in this function) xwin.c:593: error: `CapRound' undeclared (first use in this function) xwin.c:593: error: `JoinMiter' undeclared (first use in this function) xwin.c:600: error: structure has no member named `curcolor' xwin.c:601: error: structure has no member named `display' xwin.c:601: error: structure has no member named `map' xwin.c:601: error: structure has no member named `curcolor' xwin.c:603: error: structure has no member named `curcolor' xwin.c:603: error: structure has no member named `fgcolor' xwin.c:606: error: structure has no member named `curcolor' xwin.c:606: error: structure has no member named `cmap0' xwin.c:608: error: structure has no member named `display' xwin.c:608: error: structure has no member named `gc' xwin.c:608: error: structure has no member named `curcolor' xwin.c:611: error: structure has no member named `curcolor' xwin.c:611: error: structure has no member named `fgcolor' xwin.c:612: error: structure has no member named `display' xwin.c:612: error: structure has no member named `gc' xwin.c:612: error: structure has no member named `curcolor' xwin.c:628: error: structure has no member named `curcolor' xwin.c:628: error: structure has no member named `cmap1' xwin.c:630: error: structure has no member named `curcolor' xwin.c:630: error: structure has no member named `fgcolor' xwin.c:632: error: structure has no member named `display' xwin.c:632: error: structure has no member named `gc' xwin.c:632: error: structure has no member named `curcolor' xwin.c: In function `plD_esc_xw': xwin.c:712: error: structure has no member named `display' xwin.c:744: error: `XColor' undeclared (first use in this function) xwin.c:744: error: syntax error before ')' token xwin.c:748: error: syntax error before ')' token xwin.c: In function `GetCursorCmd': xwin.c:777: error: syntax error before "event" xwin.c:789: error: structure has no member named `display' xwin.c:789: error: structure has no member named `window' xwin.c:789: error: `event' undeclared (first use in this function) xwin.c: In function `FillPolygonCmd': xwin.c:811: error: syntax error before "pts" xwin.c:820: error: `pts' undeclared (first use in this function) xwin.c:827: error: structure has no member named `display' xwin.c:827: error: structure has no member named `window' xwin.c:827: error: structure has no member named `gc' xwin.c:828: error: `Nonconvex' undeclared (first use in this function) xwin.c:828: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:831: error: structure has no member named `display' xwin.c:831: error: structure has no member named `pixmap' xwin.c:831: error: structure has no member named `gc' xwin.c:838: error: structure has no member named `display' xwin.c:838: error: structure has no member named `gc' xwin.c:838: error: structure has no member named `fgcolor' xwin.c:840: error: structure has no member named `display' xwin.c:840: error: structure has no member named `window' xwin.c:840: error: structure has no member named `gc' xwin.c:844: error: structure has no member named `display' xwin.c:844: error: structure has no member named `pixmap' xwin.c:844: error: structure has no member named `gc' xwin.c:847: error: structure has no member named `display' xwin.c:847: error: structure has no member named `gc' xwin.c:847: error: structure has no member named `curcolor' xwin.c: In function `OpenXwin': xwin.c:929: error: structure has no member named `display' xwin.c:930: error: structure has no member named `display' xwin.c:935: error: structure has no member named `display' xwin.c:937: error: structure has no member named `display' xwin.c:940: error: structure has no member named `map' xwin.c:940: error: structure has no member named `display' xwin.c:952: error: structure has no member named `display' xwin.c:958: error: structure has no member named `cmap0' xwin.c:958: error: `XColor' undeclared (first use in this function) xwin.c:958: error: syntax error before ')' token xwin.c:959: error: structure has no member named `cmap0' xwin.c: In function `Init': xwin.c:995: error: syntax error before "root" xwin.c:1008: error: structure has no member named `window' xwin.c:1014: error: structure has no member named `display' xwin.c:1014: error: structure has no member named `window' xwin.c:1014: error: structure has no member named `map' xwin.c:1018: error: structure has no member named `gc' xwin.c:1019: error: structure has no member named `gc' xwin.c:1019: error: structure has no member named `display' xwin.c:1019: error: structure has no member named `window' xwin.c:1023: error: structure has no member named `gcXor' xwin.c:1024: error: syntax error before "gcValues" xwin.c:1027: error: `gcValues' undeclared (first use in this function) xwin.c:1027: error: structure has no member named `cmap0' xwin.c:1029: error: `GXxor' undeclared (first use in this function) xwin.c:1030: error: `GCForeground' undeclared (first use in this function) xwin.c:1030: error: `GCBackground' undeclared (first use in this function) xwin.c:1030: error: `GCFunction' undeclared (first use in this function) xwin.c:1032: error: structure has no member named `gcXor' xwin.c:1032: error: structure has no member named `display' xwin.c:1032: error: structure has no member named `window' xwin.c:1037: error: structure has no member named `display' xwin.c:1037: error: structure has no member named `window' xwin.c:1037: error: `root' undeclared (first use in this function) xwin.c:1064: error: structure has no member named `display' xwin.c:1064: error: structure has no member named `window' xwin.c:1064: error: structure has no member named `cmap0' xwin.c:1065: error: structure has no member named `display' xwin.c:1065: error: structure has no member named `gc' xwin.c:1065: error: structure has no member named `cmap0' xwin.c: In function `InitMain': xwin.c:1085: error: syntax error before "root" xwin.c:1095: error: structure has no member named `display' xwin.c:1095: error: structure has no member named `display' xwin.c:1096: error: `root' undeclared (first use in this function) xwin.c:1101: error: `hint' undeclared (first use in this function) xwin.c:1103: error: `PSize' undeclared (first use in this function) xwin.c:1105: error: `USSize' undeclared (first use in this function) xwin.c:1121: error: `USPosition' undeclared (first use in this function) xwin.c:1143: error: structure has no member named `window' xwin.c:1144: error: structure has no member named `display' xwin.c:1145: error: structure has no member named `display' xwin.c:1148: error: `InputOutput' undeclared (first use in this function) xwin.c:1148: error: structure has no member named `visual' xwin.c:1151: error: structure has no member named `display' xwin.c:1151: error: structure has no member named `window' xwin.c:1152: error: `None' undeclared (first use in this function) xwin.c: In function `MapMain': xwin.c:1166: error: syntax error before "event" xwin.c:1173: error: `ButtonPressMask' undeclared (first use in this function) xwin.c:1174: error: `KeyPressMask' undeclared (first use in this function) xwin.c:1175: error: `ExposureMask' undeclared (first use in this function) xwin.c:1176: error: `ButtonMotionMask' undeclared (first use in this function) xwin.c:1177: error: `StructureNotifyMask' undeclared (first use in this function) xwin.c:1179: error: structure has no member named `display' xwin.c:1179: error: structure has no member named `window' xwin.c:1183: error: structure has no member named `display' xwin.c:1183: error: structure has no member named `window' xwin.c:1189: error: structure has no member named `display' xwin.c:1189: error: structure has no member named `window' xwin.c:1189: error: `event' undeclared (first use in this function) xwin.c:1190: error: `Expose' undeclared (first use in this function) xwin.c:1191: error: structure has no member named `display' xwin.c:1191: error: structure has no member named `window' xwin.c: In function `WaitForPage': xwin.c:1210: error: syntax error before "event" xwin.c:1215: error: structure has no member named `display' xwin.c:1215: error: structure has no member named `window' xwin.c:1215: error: `event' undeclared (first use in this function) xwin.c: In function `HandleEvents': xwin.c:1363: error: syntax error before "event" xwin.c:1365: error: structure has no member named `display' xwin.c:1365: error: structure has no member named `window' xwin.c:1366: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:1387: error: syntax error before "XEvent" xwin.c: In function `MasterEH': xwin.c:1389: error: `pls' undeclared (first use in this function) xwin.c:1392: error: `event' undeclared (first use in this function) xwin.c:1396: error: `KeyPress' undeclared (first use in this function) xwin.c:1400: error: `ButtonPress' undeclared (first use in this function) xwin.c:1404: error: `Expose' undeclared (first use in this function) xwin.c:1408: error: `ConfigureNotify' undeclared (first use in this function) xwin.c:1412: error: `MotionNotify' undeclared (first use in this function) xwin.c:1418: error: `EnterNotify' undeclared (first use in this function) xwin.c:1422: error: `LeaveNotify' undeclared (first use in this function) xwin.c: At top level: xwin.c:1435: error: syntax error before "XEvent" xwin.c: In function `KeyEH': xwin.c:1437: error: `pls' undeclared (first use in this function) xwin.c:1441: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:1455: error: syntax error before "XEvent" xwin.c: In function `ButtonEH': xwin.c:1457: error: `pls' undeclared (first use in this function) xwin.c:1461: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:1490: error: syntax error before "XEvent" xwin.c: In function `LookupXKeyEvent': xwin.c:1492: error: `pls' undeclared (first use in this function) xwin.c:1494: error: `XKeyEvent' undeclared (first use in this function) xwin.c:1494: error: `keyEvent' undeclared (first use in this function) xwin.c:1494: error: syntax error before ')' token xwin.c:1497: error: syntax error before "cs" xwin.c:1506: error: `keysym' undeclared (first use in this function) xwin.c:1506: error: `cs' undeclared (first use in this function) xwin.c:1514: error: `XK_BackSpace' undeclared (first use in this function) xwin.c:1515: error: `XK_Tab' undeclared (first use in this function) xwin.c:1516: error: `XK_Linefeed' undeclared (first use in this function) xwin.c:1517: error: `XK_Return' undeclared (first use in this function) xwin.c:1518: error: `XK_Escape' undeclared (first use in this function) xwin.c:1519: error: `XK_Delete' undeclared (first use in this function) xwin.c: At top level: xwin.c:1535: error: syntax error before "XEvent" xwin.c: In function `LookupXButtonEvent': xwin.c:1537: error: `pls' undeclared (first use in this function) xwin.c:1539: error: `XButtonEvent' undeclared (first use in this function) xwin.c:1539: error: `buttonEvent' undeclared (first use in this function) xwin.c:1539: error: syntax error before ')' token xwin.c: In function `ProcessButton': xwin.c:1628: error: `Button3' undeclared (first use in this function) xwin.c: In function `LocateKey': xwin.c:1729: error: structure has no member named `display' xwin.c:1729: error: structure has no member named `window' xwin.c:1729: error: `None' undeclared (first use in this function) xwin.c: In function `LocateButton': xwin.c:1755: error: `Button1' undeclared (first use in this function) xwin.c: At top level: xwin.c:1840: error: syntax error before "XEvent" xwin.c: In function `MotionEH': xwin.c:1842: error: `pls' undeclared (first use in this function) xwin.c:1843: error: `XMotionEvent' undeclared (first use in this function) xwin.c:1843: error: `motionEvent' undeclared (first use in this function) xwin.c:1843: error: syntax error before ')' token xwin.c: At top level: xwin.c:1858: error: syntax error before "XEvent" xwin.c: In function `EnterEH': xwin.c:1860: error: `pls' undeclared (first use in this function) xwin.c:1861: error: `XCrossingEvent' undeclared (first use in this function) xwin.c:1861: error: `crossingEvent' undeclared (first use in this function) xwin.c:1861: error: syntax error before ')' token xwin.c: At top level: xwin.c:1876: error: syntax error before "XEvent" xwin.c: In function `LeaveEH': xwin.c:1878: error: `pls' undeclared (first use in this function) xwin.c:1880: error: `event' undeclared (first use in this function) xwin.c: In function `CreateXhairs': xwin.c:1896: error: syntax error before "root" xwin.c:1899: error: syntax error before "event" xwin.c:1903: error: structure has no member named `xhair_cursor' xwin.c:1904: error: structure has no member named `xhair_cursor' xwin.c:1904: error: structure has no member named `display' xwin.c:1904: error: `XC_crosshair' undeclared (first use in this function) xwin.c:1906: error: structure has no member named `display' xwin.c:1906: error: structure has no member named `window' xwin.c:1906: error: structure has no member named `xhair_cursor' xwin.c:1911: error: structure has no member named `display' xwin.c:1911: error: structure has no member named `window' xwin.c:1911: error: `root' undeclared (first use in this function) xwin.c:1911: error: `child' undeclared (first use in this function) xwin.c:1923: error: structure has no member named `display' xwin.c:1924: error: structure has no member named `display' xwin.c:1924: error: structure has no member named `window' xwin.c:1925: error: `PointerMotionMask' undeclared (first use in this function) xwin.c:1925: error: `event' undeclared (first use in this function) xwin.c:1929: error: `EnterWindowMask' undeclared (first use in this function) xwin.c:1929: error: `LeaveWindowMask' undeclared (first use in this function) xwin.c:1930: error: structure has no member named `display' xwin.c:1930: error: structure has no member named `window' xwin.c: In function `DestroyXhairs': xwin.c:1947: error: structure has no member named `display' xwin.c:1947: error: structure has no member named `window' xwin.c:1952: error: `PointerMotionMask' undeclared (first use in this function) xwin.c:1952: error: `EnterWindowMask' undeclared (first use in this function) xwin.c:1952: error: `LeaveWindowMask' undeclared (first use in this function) xwin.c:1953: error: structure has no member named `display' xwin.c:1953: error: structure has no member named `window' xwin.c: In function `DrawXhairs': xwin.c:1978: error: structure has no member named `xhair_x' xwin.c:1978: error: structure has no member named `xhair_x' xwin.c:1979: error: structure has no member named `xhair_x' xwin.c:1979: error: structure has no member named `xhair_x' xwin.c:1981: error: structure has no member named `xhair_y' xwin.c:1981: error: structure has no member named `xhair_y' xwin.c:1982: error: structure has no member named `xhair_y' xwin.c:1982: error: structure has no member named `xhair_y' xwin.c: In function `UpdateXhairs': xwin.c:1999: error: structure has no member named `display' xwin.c:1999: error: structure has no member named `window' xwin.c:1999: error: structure has no member named `gcXor' xwin.c:1999: error: structure has no member named `xhair_x' xwin.c:2000: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:2002: error: structure has no member named `display' xwin.c:2002: error: structure has no member named `window' xwin.c:2002: error: structure has no member named `gcXor' xwin.c:2002: error: structure has no member named `xhair_y' xwin.c: At top level: xwin.c:2014: error: syntax error before "XEvent" xwin.c: In function `ExposeEH': xwin.c:2016: error: `pls' undeclared (first use in this function) xwin.c:2018: error: `XExposeEvent' undeclared (first use in this function) xwin.c:2018: error: `exposeEvent' undeclared (first use in this function) xwin.c:2018: error: syntax error before ')' token xwin.c:2028: error: structure has no member named `display' xwin.c:2037: error: structure has no member named `display' xwin.c:2037: error: structure has no member named `window' xwin.c:2054: error: structure has no member named `display' xwin.c:2054: error: structure has no member named `window' xwin.c:2055: error: `ExposureMask' undeclared (first use in this function) xwin.c:2055: error: `StructureNotifyMask' undeclared (first use in this function) xwin.c:2055: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:2066: error: syntax error before "XEvent" xwin.c: In function `ResizeEH': xwin.c:2068: error: `pls' undeclared (first use in this function) xwin.c:2070: error: `XConfigureEvent' undeclared (first use in this function) xwin.c:2070: error: `configEvent' undeclared (first use in this function) xwin.c:2070: error: syntax error before ')' token xwin.c:2085: error: structure has no member named `display' xwin.c:2097: error: structure has no member named `display' xwin.c:2098: error: structure has no member named `display' xwin.c:2098: error: structure has no member named `window' xwin.c:2099: error: `ExposureMask' undeclared (first use in this function) xwin.c:2099: error: `StructureNotifyMask' undeclared (first use in this function) xwin.c:2099: error: `event' undeclared (first use in this function) xwin.c: In function `ExposeCmd': xwin.c:2143: error: structure has no member named `display' xwin.c:2145: error: structure has no member named `display' xwin.c:2145: error: structure has no member named `pixmap' xwin.c:2145: error: structure has no member named `window' xwin.c:2145: error: structure has no member named `gc' xwin.c:2147: error: structure has no member named `display' xwin.c:2150: error: syntax error before "pts" xwin.c:2152: error: `pts' undeclared (first use in this function) xwin.c:2158: error: structure has no member named `display' xwin.c:2158: error: structure has no member named `window' xwin.c:2158: error: structure has no member named `gc' xwin.c:2159: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:2165: error: structure has no member named `display' xwin.c: In function `ResizeCmd': xwin.c:2227: error: structure has no member named `display' xwin.c:2227: error: structure has no member named `pixmap' xwin.c:2238: error: structure has no member named `display' xwin.c:2244: error: structure has no member named `display' xwin.c:2244: error: structure has no member named `pixmap' xwin.c:2244: error: structure has no member named `window' xwin.c:2244: error: structure has no member named `gc' xwin.c:2246: error: structure has no member named `display' xwin.c: In function `RedrawCmd': xwin.c:2313: error: structure has no member named `display' xwin.c:2320: error: structure has no member named `display' xwin.c:2320: error: structure has no member named `pixmap' xwin.c:2320: error: structure has no member named `window' xwin.c:2320: error: structure has no member named `gc' xwin.c:2322: error: structure has no member named `display' xwin.c: At top level: xwin.c:2337: error: syntax error before '*' token xwin.c: In function `CreatePixmapErrorHandler': xwin.c:2339: error: `error' undeclared (first use in this function) xwin.c:2340: error: `BadAlloc' undeclared (first use in this function) xwin.c:2342: error: `display' undeclared (first use in this function) xwin.c: In function `CreatePixmap': xwin.c:2361: error: syntax error before '*' token xwin.c:2363: warning: assignment makes pointer from integer without a cast xwin.c:2365: error: `Success' undeclared (first use in this function) xwin.c:2370: error: structure has no member named `pixmap' xwin.c:2370: error: structure has no member named `display' xwin.c:2370: error: structure has no member named `window' xwin.c:2372: error: structure has no member named `display' xwin.c: In function `GetVisual': xwin.c:2407: error: syntax error before "vTemplate" xwin.c:2411: error: `vTemplate' undeclared (first use in this function) xwin.c:2414: error: `visualList' undeclared (first use in this function) xwin.c:2414: error: structure has no member named `display' xwin.c:2415: error: `VisualScreenMask' undeclared (first use in this function) xwin.c:2415: error: `VisualDepthMask' undeclared (first use in this function) xwin.c:2462: error: structure has no member named `visual' xwin.c:2469: error: structure has no member named `visual' xwin.c:2469: error: structure has no member named `display' xwin.c:2470: error: structure has no member named `display' xwin.c:2475: error: structure has no member named `visual' xwin.c:2476: error: `TrueColor' undeclared (first use in this function) xwin.c:2477: error: `StaticColor' undeclared (first use in this function) xwin.c:2478: error: `StaticGray' undeclared (first use in this function) xwin.c:2491: error: structure has no member named `visual' xwin.c:2492: error: `PseudoColor' undeclared (first use in this function) xwin.c:2495: error: `GrayScale' undeclared (first use in this function) xwin.c:2498: error: `DirectColor' undeclared (first use in this function) xwin.c: In function `AllocBGFG': xwin.c:2543: error: structure has no member named `display' xwin.c:2543: error: structure has no member named `map' xwin.c:2543: error: `False' undeclared (first use in this function) xwin.c:2547: error: structure has no member named `cmap0' xwin.c:2551: error: structure has no member named `cmap0' xwin.c:2551: error: structure has no member named `display' xwin.c:2552: error: structure has no member named `fgcolor' xwin.c:2552: error: structure has no member named `display' xwin.c:2563: error: structure has no member named `display' xwin.c:2563: error: structure has no member named `map' xwin.c:2575: error: structure has no member named `cmap0' xwin.c:2581: error: structure has no member named `fgcolor' xwin.c:2584: error: structure has no member named `display' xwin.c:2584: error: structure has no member named `map' xwin.c: In function `SetBGFG': xwin.c:2620: error: structure has no member named `cmap0' xwin.c:2639: error: structure has no member named `fgcolor' xwin.c:2644: error: structure has no member named `display' xwin.c:2644: error: structure has no member named `map' xwin.c:2644: error: structure has no member named `fgcolor' xwin.c:2645: error: structure has no member named `display' xwin.c:2645: error: structure has no member named `map' xwin.c:2645: error: structure has no member named `cmap0' xwin.c:2647: error: structure has no member named `display' xwin.c:2647: error: structure has no member named `map' xwin.c:2647: error: structure has no member named `cmap0' xwin.c:2648: error: structure has no member named `display' xwin.c:2648: error: structure has no member named `map' xwin.c:2648: error: structure has no member named `fgcolor' xwin.c: In function `AllocCustomMap': xwin.c:2710: error: syntax error before "xwm_colors" xwin.c:2719: error: `xwm_colors' undeclared (first use in this function) xwin.c:2721: error: structure has no member named `display' xwin.c:2721: error: structure has no member named `map' xwin.c:2729: error: structure has no member named `display' xwin.c:2729: error: structure has no member named `map' xwin.c:2729: error: structure has no member named `fgcolor' xwin.c:2733: error: structure has no member named `map' xwin.c:2733: error: structure has no member named `display' xwin.c:2733: error: structure has no member named `display' xwin.c:2734: error: structure has no member named `visual' xwin.c:2734: error: `AllocNone' undeclared (first use in this function) xwin.c:2740: error: structure has no member named `display' xwin.c:2740: error: structure has no member named `map' xwin.c:2740: error: `False' undeclared (first use in this function) xwin.c:2751: error: structure has no member named `display' xwin.c:2751: error: structure has no member named `map' xwin.c:2758: error: structure has no member named `display' xwin.c:2758: error: structure has no member named `map' xwin.c:2758: error: structure has no member named `cmap0' xwin.c:2759: error: structure has no member named `cmap0' xwin.c:2770: error: request for member `red' in something not a structure or union xwin.c:2771: error: request for member `green' in something not a structure or union xwin.c:2772: error: request for member `blue' in something not a structure or union xwin.c:2775: error: structure has no member named `display' xwin.c:2775: error: structure has no member named `map' xwin.c:2786: error: structure has no member named `display' xwin.c:2786: error: structure has no member named `map' xwin.c: In function `AllocCmap0': xwin.c:2811: error: structure has no member named `cmap0' xwin.c:2812: error: structure has no member named `display' xwin.c:2812: error: structure has no member named `map' xwin.c:2818: error: structure has no member named `cmap0' xwin.c:2818: error: `XColor' undeclared (first use in this function) xwin.c:2818: error: syntax error before ')' token xwin.c:2820: error: structure has no member named `cmap0' xwin.c:2832: error: structure has no member named `display' xwin.c:2832: error: structure has no member named `map' xwin.c:2832: error: `False' undeclared (first use in this function) xwin.c:2842: error: structure has no member named `cmap0' xwin.c:2853: error: syntax error before "c" xwin.c:2854: error: `c' undeclared (first use in this function) xwin.c:2855: error: structure has no member named `display' xwin.c:2855: error: structure has no member named `map' xwin.c:2859: error: structure has no member named `cmap0' xwin.c:2860: error: structure has no member named `cmap0' xwin.c:2864: error: syntax error before "screen_def" xwin.c:2872: error: structure has no member named `display' xwin.c:2872: error: structure has no member named `map' xwin.c:2874: error: `screen_def' undeclared (first use in this function) xwin.c:2874: error: `exact_def' undeclared (first use in this function) xwin.c:2882: error: structure has no member named `cmap0' xwin.c:2883: error: structure has no member named `cmap0' xwin.c:2886: error: structure has no member named `display' xwin.c:2886: error: structure has no member named `map' xwin.c:2890: error: structure has no member named `cmap0' xwin.c:2891: error: structure has no member named `cmap0' xwin.c: In function `AllocCmap1': xwin.c:2932: error: structure has no member named `display' xwin.c:2932: error: structure has no member named `map' xwin.c:2932: error: `False' undeclared (first use in this function) xwin.c:2951: error: structure has no member named `cmap1' xwin.c:2953: error: structure has no member named `cmap1' xwin.c:2953: error: `XColor' undeclared (first use in this function) xwin.c:2953: error: syntax error before ')' token xwin.c:2954: error: structure has no member named `cmap1' xwin.c:2964: error: structure has no member named `cmap1' xwin.c:2976: error: syntax error before "xcol" xwin.c:2981: error: structure has no member named `visual' xwin.c:2982: error: `TrueColor' undeclared (first use in this function) xwin.c:2990: error: structure has no member named `cmap1' xwin.c:2992: error: structure has no member named `cmap1' xwin.c:2992: error: syntax error before ')' token xwin.c:2993: error: structure has no member named `cmap1' xwin.c:2999: error: `xcol' undeclared (first use in this function) xwin.c:3001: error: structure has no member named `display' xwin.c:3001: error: structure has no member named `map' xwin.c:3005: error: structure has no member named `cmap1' xwin.c: In function `StoreCmap0': xwin.c:3041: error: structure has no member named `cmap0' xwin.c:3043: error: structure has no member named `display' xwin.c:3043: error: structure has no member named `map' xwin.c:3043: error: structure has no member named `cmap0' xwin.c:3045: error: structure has no member named `display' xwin.c:3045: error: structure has no member named `map' xwin.c:3045: error: structure has no member named `cmap0' xwin.c: In function `StoreCmap1': xwin.c:3069: error: structure has no member named `cmap1' xwin.c:3071: error: structure has no member named `display' xwin.c:3071: error: structure has no member named `map' xwin.c:3071: error: structure has no member named `cmap1' xwin.c:3073: error: structure has no member named `display' xwin.c:3073: error: structure has no member named `map' xwin.c:3073: error: structure has no member named `cmap1' xwin.c: At top level: xwin.c:3089: error: syntax error before "XColor" xwin.c: In function `PLColor_to_XColor': xwin.c:3091: error: `xcolor' undeclared (first use in this function) xwin.c:3091: error: `plcolor' undeclared (first use in this function) xwin.c:3094: error: `DoRed' undeclared (first use in this function) xwin.c:3094: error: `DoGreen' undeclared (first use in this function) xwin.c:3094: error: `DoBlue' undeclared (first use in this function) xwin.c: At top level: xwin.c:3105: error: syntax error before "XColor" xwin.c: In function `PLColor_from_XColor': xwin.c:3107: error: `plcolor' undeclared (first use in this function) xwin.c:3107: error: `xcolor' undeclared (first use in this function) xwin.c: At top level: xwin.c:3121: error: syntax error before '*' token xwin.c: In function `AreWeGrayscale': xwin.c:3129: error: `XVisualInfo' undeclared (first use in this function) xwin.c:3129: error: `visuals' undeclared (first use in this function) xwin.c:3133: error: `display' undeclared (first use in this function) xwin.c:3138: error: `GrayScale' undeclared (first use in this function) xwin.c:3139: error: `StaticGray' undeclared (first use in this function) xwin.c: At top level: xwin.c:3196: error: syntax error before '*' token xwin.c: In function `GetImageErrorHandler': xwin.c:3198: error: `error' undeclared (first use in this function) xwin.c:3198: error: `BadMatch' undeclared (first use in this function) xwin.c:3200: error: `display' undeclared (first use in this function) xwin.c: In function `DrawImage': xwin.c:3218: error: `XImage' undeclared (first use in this function) xwin.c:3218: error: `ximg' undeclared (first use in this function) xwin.c:3219: error: syntax error before "curcolor" xwin.c:3222: error: syntax error before '*' token xwin.c:3246: warning: assignment makes pointer from integer without a cast xwin.c:3248: error: structure has no member named `display' xwin.c:3250: error: structure has no member named `display' xwin.c:3250: error: structure has no member named `pixmap' xwin.c:3251: error: `AllPlanes' undeclared (first use in this function) xwin.c:3251: error: `ZPixmap' undeclared (first use in this function) xwin.c:3254: error: structure has no member named `display' xwin.c:3254: error: structure has no member named `window' xwin.c:3333: error: `curcolor' undeclared (first use in this function) xwin.c:3333: error: structure has no member named `cmap1' xwin.c:3335: error: structure has no member named `fgcolor' xwin.c:3375: error: structure has no member named `display' xwin.c:3375: error: structure has no member named `pixmap' xwin.c:3375: error: structure has no member named `gc' xwin.c:3378: error: structure has no member named `display' xwin.c:3378: error: structure has no member named `window' xwin.c:3378: error: structure has no member named `gc' xwin.c: In function `imageops': xwin.c:3406: error: structure has no member named `display' gmake[2]: *** [xwin.lo] Error 1 gmake[2]: Leaving directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' gmake[1]: *** [all-recursive] Error 1 gmake[1]: Leaving directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' gmake: *** [all-recursive] Error 1 gama# ^Dexit Script done on Tue Mar 17 09:17:41 2009 From mincloud at gmail.com Wed Mar 18 09:43:39 2009 From: mincloud at gmail.com (yun zheng) Date: Wed, 18 Mar 2009 21:43:39 +0800 Subject: [EMBOSS] make error In-Reply-To: <60593.86.9.126.186.1237367389.squirrel@webmail.ebi.ac.uk> References: <8f6eb9540903172212n289d21e2y1b42c517645aac6c@mail.gmail.com> <60593.86.9.126.186.1237367389.squirrel@webmail.ebi.ac.uk> Message-ID: <8f6eb9540903180643o1eb465ccq1e39096aa59026a7@mail.gmail.com> Alan, Many thanks. I solved the problem successfully. Best regards. sincerely zheng, yun On Wed, Mar 18, 2009 at 5:09 PM, wrote: > Hi, > > You need to install the X11 development files for CentOS from > your DVD. For that Linux distribution the RPM is probably called > 'xorg-x11-proto-devel'. While you're doing that you > may want to install the 'gd-devel' RPM at the same time > (which will enable PNG support). > > After that do a 'make clean' and redo the './configure' step. > > The FAQ does give a hint to the above but I'll see whether > it needs updating for CentOS. > > Alan > > > > Hi, I met a lot of errors when I typed make in EMBOSS 6.0.1 folder. > > > > #./configure > > #make > > ... > > xwin.c:3394: error: 'XwDev' has no member named 'write_to_window' > > xwin.c:3398: error: 'XwDev' has no member named 'write_to_window' > > xwin.c:3402: error: 'XwDev' has no member named 'write_to_pixmap' > > xwin.c:3406: error: 'XwDisplay' has no member named 'display' > > xwin.c:3407: error: 'XwDev' has no member named 'write_to_pixmap' > > make[2]: *** [xwin.lo] Error 1 > > make[2]: Leaving directory > > `/home/zhengy/software/EMBOSS-6.0.1/EMBOSS-6.0.1/plplot' > > make[1]: *** [all-recursive] Error 1 > > make[1]: Leaving directory > > `/home/zhengy/software/EMBOSS-6.0.1/EMBOSS-6.0.1/plplot' > > make: *** [all-recursive] Error 1 > > > > My machine is installed with a 64-bit GNU Linux (CentOS). > > # uname -a > > Linux IDM-DNA 2.6.18-92.1.22.el5 #1 SMP Tue Dec 16 11:57:43 EST 2008 > > x86_64 > > x86_64 x86_64 GNU/Linux > > > > Could you help me to solve the problem? > > > > Many thanks. > > > > sincerely > > zheng, yun > > > > Institute of Deveopmental Biology and Molecular Medicine > > Fudan University > > 200 Handan Rd > > Shanghai, China 200433 > > _______________________________________________ > > EMBOSS mailing list > > EMBOSS at lists.open-bio.org > > http://lists.open-bio.org/mailman/listinfo/emboss > > > > > From fernan at iib.unsam.edu.ar Tue Mar 17 17:52:40 2009 From: fernan at iib.unsam.edu.ar (Fernan Aguero) Date: Tue, 17 Mar 2009 18:52:40 -0300 Subject: [EMBOSS] emboss-6.0.1 fails to build without X Message-ID: <20090317215240.GH34389@iib.unsam.edu.ar> ./configure --without-x [ ... succeeds ... ] make [ ... fails ... ] [ lots of errors from xwin.c ...] xwin.c: In function `imageops': xwin.c:3406: error: structure has no member named `display' *** Error code 1 This is on FreeBSD-6.3, gcc-3.4.6, gnu make 3.81 Typescript is attached. Cheers, Fernan -------------- next part -------------- Script started on Tue Mar 17 09:15:38 2009 gama# ./configfgguure --without-x checking for a BSD-compatible install... /usr/bin/install -c checking whether build environment is sane... yes checking for a thread-safe mkdir -p... ./install-sh -c -d checking for gawk... no checking for mawk... no checking for nawk... nawk checking whether make sets $(MAKE)... yes checking for gawk... (cached) nawk checking for gcc... gcc checking for C compiler default output file name... a.out checking whether the C compiler works... yes checking whether we are cross compiling... no checking for suffix of executables... checking for suffix of object files... o checking whether we are using the GNU C compiler... yes checking whether gcc accepts -g... yes checking for gcc option to accept ISO C89... none needed checking for style of include used by make... GNU checking dependency style of gcc... gcc3 checking how to run the C preprocessor... gcc -E checking build system type... i386-unknown-freebsd6.3 checking host system type... i386-unknown-freebsd6.3 checking for a sed that does not truncate output... /usr/bin/sed checking for grep that handles long lines and -e... /usr/bin/grep checking for egrep... /usr/bin/grep -E checking for ld used by gcc... /usr/bin/ld checking if the linker (/usr/bin/ld) is GNU ld... yes checking for /usr/bin/ld option to reload object files... -r checking for BSD-compatible nm... /usr/bin/nm -B checking whether ln -s works... yes checking how to recognize dependent libraries... pass_all checking for ANSI C header files... yes checking for sys/types.h... yes checking for sys/stat.h... yes checking for stdlib.h... yes checking for string.h... yes checking for memory.h... yes checking for strings.h... yes checking for inttypes.h... yes checking for stdint.h... yes checking for unistd.h... yes checking dlfcn.h usability... yes checking dlfcn.h presence... yes checking for dlfcn.h... yes checking for g++... g++ checking whether we are using the GNU C++ compiler... yes checking whether g++ accepts -g... yes checking dependency style of g++... gcc3 checking how to run the C++ preprocessor... g++ -E checking for g77... no checking for xlf... no checking for f77... f77 checking whether we are using the GNU Fortran 77 compiler... yes checking whether f77 accepts -g... yes checking the maximum length of command line arguments... 196608 checking command to parse /usr/bin/nm -B output from gcc object... ok checking for objdir... .libs checking for ar... ar checking for ranlib... ranlib checking for strip... strip checking if gcc supports -fno-rtti -fno-exceptions... no checking for gcc option to produce PIC... -fPIC checking if gcc PIC flag -fPIC works... yes checking if gcc static flag -static works... yes checking if gcc supports -c -o file.o... yes checking whether the gcc linker (/usr/bin/ld) supports shared libraries... yes checking whether -lc should be explicitly linked in... yes checking dynamic linker characteristics... freebsd6.3 ld.so checking how to hardcode library paths into programs... immediate checking whether stripping libraries is possible... yes checking if libtool supports shared libraries... yes checking whether to build shared libraries... yes checking whether to build static libraries... yes configure: creating libtool appending configuration tag "CXX" to libtool checking for ld used by g++... /usr/bin/ld checking if the linker (/usr/bin/ld) is GNU ld... yes checking whether the g++ linker (/usr/bin/ld) supports shared libraries... yes checking for g++ option to produce PIC... -fPIC checking if g++ PIC flag -fPIC works... yes checking if g++ static flag -static works... yes checking if g++ supports -c -o file.o... yes checking whether the g++ linker (/usr/bin/ld) supports shared libraries... yes checking dynamic linker characteristics... freebsd6.3 ld.so checking how to hardcode library paths into programs... immediate appending configuration tag "F77" to libtool checking if libtool supports shared libraries... yes checking whether to build shared libraries... yes checking whether to build static libraries... yes checking for f77 option to produce PIC... -fPIC checking if f77 PIC flag -fPIC works... yes checking if f77 static flag -static works... yes checking if f77 supports -c -o file.o... yes checking whether the f77 linker (/usr/bin/ld) supports shared libraries... yes checking dynamic linker characteristics... freebsd6.3 ld.so checking how to hardcode library paths into programs... immediate checking whether byte ordering is bigendian... no checking for a BSD-compatible install... /usr/bin/install -c checking whether ln -s works... yes checking whether make sets $(MAKE)... (cached) yes checking for ranlib... (cached) ranlib checking for X... disabled checking for dirent.h that defines DIR... yes checking for library containing opendir... none required checking for ANSI C header files... (cached) yes checking for unistd.h... (cached) yes checking for an ANSI C-conforming const... yes checking for pid_t... yes checking for size_t... yes checking whether struct tm is in sys/time.h or time.h... time.h checking whether getpgrp requires zero arguments... yes checking for strftime... yes checking vfork.h usability... no checking vfork.h presence... no checking for vfork.h... no checking for fork... yes checking for vfork... yes checking for working fork... yes checking for working vfork... (cached) yes checking for vprintf... yes checking for _doprnt... no checking for memmove... yes checking for gethostbyname in -lc... yes checking for socket in -lc... yes checking for main in -lm... yes ./configure: line 23442: !=: command not found checking if docroot is given... no checking if gcc profiling is selected... no checking if java include directory given... no checking if java OS include directory given... no checking if png driver is wanted... yes checking for inflateEnd in -lz... yes checking for png_destroy_read_struct in -lpng... no No png driver will be made due to librarys missing/old. checking if any authorisation type is given... no checking for gdome2... no checking if Linux x86_64... no checking for large file support... done checking for purify... no checking for cygwin... no checking for mprobe... no checking for savestats... no checking if any threading type is given... no configure: creating ./config.status config.status: creating plplot/Makefile config.status: creating plplot/lib/Makefile config.status: creating nucleus/Makefile config.status: creating ajax/Makefile config.status: creating emboss/Makefile config.status: creating emboss/acd/Makefile config.status: creating test/Makefile config.status: creating test/data/Makefile config.status: creating test/embl/Makefile config.status: creating test/genbank/Makefile config.status: creating test/gb/Makefile config.status: creating test/pir/Makefile config.status: creating test/swiss/Makefile config.status: creating test/swnew/Makefile config.status: creating test/testdb/Makefile config.status: creating test/wormpep/Makefile config.status: creating emboss/data/Makefile config.status: creating emboss/data/AAINDEX/Makefile config.status: creating emboss/data/CODONS/Makefile config.status: creating emboss/data/REBASE/Makefile config.status: creating emboss/data/JASPAR_CORE/Makefile config.status: creating emboss/data/JASPAR_FAM/Makefile config.status: creating emboss/data/JASPAR_PHYLOFACTS/Makefile config.status: creating emboss/data/JASPAR_CNE/Makefile config.status: creating emboss/data/JASPAR_POLII/Makefile config.status: creating emboss/data/JASPAR_SPLICE/Makefile config.status: creating emboss/data/PRINTS/Makefile config.status: creating emboss/data/PROSITE/Makefile config.status: creating doc/Makefile config.status: creating doc/manuals/Makefile config.status: creating doc/tutorials/Makefile config.status: creating doc/programs/Makefile config.status: creating doc/programs/html/Makefile config.status: creating doc/programs/text/Makefile config.status: creating jemboss/Makefile config.status: creating jemboss/api/Makefile config.status: creating jemboss/api/org/Makefile config.status: creating jemboss/api/org/emboss/Makefile config.status: creating jemboss/api/org/emboss/jemboss/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/filetree/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/form/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/sequenceChooser/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/startup/Makefile config.status: creating jemboss/api/org/emboss/jemboss/parser/Makefile config.status: creating jemboss/api/org/emboss/jemboss/parser/acd/Makefile config.status: creating jemboss/api/org/emboss/jemboss/programs/Makefile config.status: creating jemboss/api/org/emboss/jemboss/soap/Makefile config.status: creating jemboss/images/Makefile config.status: creating jemboss/lib/Makefile config.status: creating jemboss/lib/axis/Makefile config.status: creating jemboss/org/Makefile config.status: creating jemboss/org/emboss/Makefile config.status: creating jemboss/org/emboss/jemboss/Makefile config.status: creating jemboss/org/emboss/jemboss/graphics/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/filetree/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/form/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/startup/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/sequenceChooser/Makefile config.status: creating jemboss/org/emboss/jemboss/parser/Makefile config.status: creating jemboss/org/emboss/jemboss/parser/acd/Makefile config.status: creating jemboss/org/emboss/jemboss/programs/Makefile config.status: creating jemboss/org/emboss/jemboss/server/Makefile config.status: creating jemboss/org/emboss/jemboss/soap/Makefile config.status: creating jemboss/org/emboss/jemboss/editor/Makefile config.status: creating jemboss/org/emboss/jemboss/draw/Makefile config.status: creating jemboss/resources/Makefile config.status: creating jemboss/utils/Makefile config.status: creating Makefile config.status: executing depfiles commands gama# gmake Making all in plplot gmake[1]: Entering directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' Making all in lib gmake[2]: Entering directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot/lib' gmake[2]: Nothing to be done for `all'. gmake[2]: Leaving directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot/lib' gmake[2]: Entering directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pdfutils.lo -MD -MP -MF .deps/pdfutils.Tpo -c -o pdfutils.lo pdfutils.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pdfutils.lo -MD -MP -MF .deps/pdfutils.Tpo -c pdfutils.c -fPIC -DPIC -o .libs/pdfutils.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pdfutils.lo -MD -MP -MF .deps/pdfutils.Tpo -c pdfutils.c -o pdfutils.o >/dev/null 2>&1 mv -f .deps/pdfutils.Tpo .deps/pdfutils.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plargs.lo -MD -MP -MF .deps/plargs.Tpo -c -o plargs.lo plargs.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plargs.lo -MD -MP -MF .deps/plargs.Tpo -c plargs.c -fPIC -DPIC -o .libs/plargs.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plargs.lo -MD -MP -MF .deps/plargs.Tpo -c plargs.c -o plargs.o >/dev/null 2>&1 mv -f .deps/plargs.Tpo .deps/plargs.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbox.lo -MD -MP -MF .deps/plbox.Tpo -c -o plbox.lo plbox.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbox.lo -MD -MP -MF .deps/plbox.Tpo -c plbox.c -fPIC -DPIC -o .libs/plbox.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbox.lo -MD -MP -MF .deps/plbox.Tpo -c plbox.c -o plbox.o >/dev/null 2>&1 mv -f .deps/plbox.Tpo .deps/plbox.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcont.lo -MD -MP -MF .deps/plcont.Tpo -c -o plcont.lo plcont.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcont.lo -MD -MP -MF .deps/plcont.Tpo -c plcont.c -fPIC -DPIC -o .libs/plcont.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcont.lo -MD -MP -MF .deps/plcont.Tpo -c plcont.c -o plcont.o >/dev/null 2>&1 mv -f .deps/plcont.Tpo .deps/plcont.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcore.lo -MD -MP -MF .deps/plcore.Tpo -c -o plcore.lo plcore.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcore.lo -MD -MP -MF .deps/plcore.Tpo -c plcore.c -fPIC -DPIC -o .libs/plcore.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcore.lo -MD -MP -MF .deps/plcore.Tpo -c plcore.c -o plcore.o >/dev/null 2>&1 mv -f .deps/plcore.Tpo .deps/plcore.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plctrl.lo -MD -MP -MF .deps/plctrl.Tpo -c -o plctrl.lo plctrl.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plctrl.lo -MD -MP -MF .deps/plctrl.Tpo -c plctrl.c -fPIC -DPIC -o .libs/plctrl.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plctrl.lo -MD -MP -MF .deps/plctrl.Tpo -c plctrl.c -o plctrl.o >/dev/null 2>&1 mv -f .deps/plctrl.Tpo .deps/plctrl.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcvt.lo -MD -MP -MF .deps/plcvt.Tpo -c -o plcvt.lo plcvt.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcvt.lo -MD -MP -MF .deps/plcvt.Tpo -c plcvt.c -fPIC -DPIC -o .libs/plcvt.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcvt.lo -MD -MP -MF .deps/plcvt.Tpo -c plcvt.c -o plcvt.o >/dev/null 2>&1 mv -f .deps/plcvt.Tpo .deps/plcvt.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pldtik.lo -MD -MP -MF .deps/pldtik.Tpo -c -o pldtik.lo pldtik.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pldtik.lo -MD -MP -MF .deps/pldtik.Tpo -c pldtik.c -fPIC -DPIC -o .libs/pldtik.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pldtik.lo -MD -MP -MF .deps/pldtik.Tpo -c pldtik.c -o pldtik.o >/dev/null 2>&1 mv -f .deps/pldtik.Tpo .deps/pldtik.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plfill.lo -MD -MP -MF .deps/plfill.Tpo -c -o plfill.lo plfill.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plfill.lo -MD -MP -MF .deps/plfill.Tpo -c plfill.c -fPIC -DPIC -o .libs/plfill.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plfill.lo -MD -MP -MF .deps/plfill.Tpo -c plfill.c -o plfill.o >/dev/null 2>&1 mv -f .deps/plfill.Tpo .deps/plfill.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plhist.lo -MD -MP -MF .deps/plhist.Tpo -c -o plhist.lo plhist.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plhist.lo -MD -MP -MF .deps/plhist.Tpo -c plhist.c -fPIC -DPIC -o .libs/plhist.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plhist.lo -MD -MP -MF .deps/plhist.Tpo -c plhist.c -o plhist.o >/dev/null 2>&1 mv -f .deps/plhist.Tpo .deps/plhist.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plline.lo -MD -MP -MF .deps/plline.Tpo -c -o plline.lo plline.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plline.lo -MD -MP -MF .deps/plline.Tpo -c plline.c -fPIC -DPIC -o .libs/plline.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plline.lo -MD -MP -MF .deps/plline.Tpo -c plline.c -o plline.o >/dev/null 2>&1 mv -f .deps/plline.Tpo .deps/plline.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmap.lo -MD -MP -MF .deps/plmap.Tpo -c -o plmap.lo plmap.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmap.lo -MD -MP -MF .deps/plmap.Tpo -c plmap.c -fPIC -DPIC -o .libs/plmap.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmap.lo -MD -MP -MF .deps/plmap.Tpo -c plmap.c -o plmap.o >/dev/null 2>&1 mv -f .deps/plmap.Tpo .deps/plmap.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plot3d.lo -MD -MP -MF .deps/plot3d.Tpo -c -o plot3d.lo plot3d.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plot3d.lo -MD -MP -MF .deps/plot3d.Tpo -c plot3d.c -fPIC -DPIC -o .libs/plot3d.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plot3d.lo -MD -MP -MF .deps/plot3d.Tpo -c plot3d.c -o plot3d.o >/dev/null 2>&1 mv -f .deps/plot3d.Tpo .deps/plot3d.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plpage.lo -MD -MP -MF .deps/plpage.Tpo -c -o plpage.lo plpage.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plpage.lo -MD -MP -MF .deps/plpage.Tpo -c plpage.c -fPIC -DPIC -o .libs/plpage.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plpage.lo -MD -MP -MF .deps/plpage.Tpo -c plpage.c -o plpage.o >/dev/null 2>&1 mv -f .deps/plpage.Tpo .deps/plpage.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsdef.lo -MD -MP -MF .deps/plsdef.Tpo -c -o plsdef.lo plsdef.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsdef.lo -MD -MP -MF .deps/plsdef.Tpo -c plsdef.c -fPIC -DPIC -o .libs/plsdef.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsdef.lo -MD -MP -MF .deps/plsdef.Tpo -c plsdef.c -o plsdef.o >/dev/null 2>&1 mv -f .deps/plsdef.Tpo .deps/plsdef.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plshade.lo -MD -MP -MF .deps/plshade.Tpo -c -o plshade.lo plshade.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plshade.lo -MD -MP -MF .deps/plshade.Tpo -c plshade.c -fPIC -DPIC -o .libs/plshade.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plshade.lo -MD -MP -MF .deps/plshade.Tpo -c plshade.c -o plshade.o >/dev/null 2>&1 mv -f .deps/plshade.Tpo .deps/plshade.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsym.lo -MD -MP -MF .deps/plsym.Tpo -c -o plsym.lo plsym.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsym.lo -MD -MP -MF .deps/plsym.Tpo -c plsym.c -fPIC -DPIC -o .libs/plsym.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsym.lo -MD -MP -MF .deps/plsym.Tpo -c plsym.c -o plsym.o >/dev/null 2>&1 mv -f .deps/plsym.Tpo .deps/plsym.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pltick.lo -MD -MP -MF .deps/pltick.Tpo -c -o pltick.lo pltick.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pltick.lo -MD -MP -MF .deps/pltick.Tpo -c pltick.c -fPIC -DPIC -o .libs/pltick.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pltick.lo -MD -MP -MF .deps/pltick.Tpo -c pltick.c -o pltick.o >/dev/null 2>&1 mv -f .deps/pltick.Tpo .deps/pltick.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plvpor.lo -MD -MP -MF .deps/plvpor.Tpo -c -o plvpor.lo plvpor.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plvpor.lo -MD -MP -MF .deps/plvpor.Tpo -c plvpor.c -fPIC -DPIC -o .libs/plvpor.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plvpor.lo -MD -MP -MF .deps/plvpor.Tpo -c plvpor.c -o plvpor.o >/dev/null 2>&1 mv -f .deps/plvpor.Tpo .deps/plvpor.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plwind.lo -MD -MP -MF .deps/plwind.Tpo -c -o plwind.lo plwind.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plwind.lo -MD -MP -MF .deps/plwind.Tpo -c plwind.c -fPIC -DPIC -o .libs/plwind.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plwind.lo -MD -MP -MF .deps/plwind.Tpo -c plwind.c -o plwind.o >/dev/null 2>&1 mv -f .deps/plwind.Tpo .deps/plwind.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plstripc.lo -MD -MP -MF .deps/plstripc.Tpo -c -o plstripc.lo plstripc.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plstripc.lo -MD -MP -MF .deps/plstripc.Tpo -c plstripc.c -fPIC -DPIC -o .libs/plstripc.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plstripc.lo -MD -MP -MF .deps/plstripc.Tpo -c plstripc.c -o plstripc.o >/dev/null 2>&1 mv -f .deps/plstripc.Tpo .deps/plstripc.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT hpgl.lo -MD -MP -MF .deps/hpgl.Tpo -c -o hpgl.lo hpgl.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT hpgl.lo -MD -MP -MF .deps/hpgl.Tpo -c hpgl.c -fPIC -DPIC -o .libs/hpgl.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT hpgl.lo -MD -MP -MF .deps/hpgl.Tpo -c hpgl.c -o hpgl.o >/dev/null 2>&1 mv -f .deps/hpgl.Tpo .deps/hpgl.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT impress.lo -MD -MP -MF .deps/impress.Tpo -c -o impress.lo impress.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT impress.lo -MD -MP -MF .deps/impress.Tpo -c impress.c -fPIC -DPIC -o .libs/impress.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT impress.lo -MD -MP -MF .deps/impress.Tpo -c impress.c -o impress.o >/dev/null 2>&1 mv -f .deps/impress.Tpo .deps/impress.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljiip.lo -MD -MP -MF .deps/ljiip.Tpo -c -o ljiip.lo ljiip.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljiip.lo -MD -MP -MF .deps/ljiip.Tpo -c ljiip.c -fPIC -DPIC -o .libs/ljiip.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljiip.lo -MD -MP -MF .deps/ljiip.Tpo -c ljiip.c -o ljiip.o >/dev/null 2>&1 mv -f .deps/ljiip.Tpo .deps/ljiip.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljii.lo -MD -MP -MF .deps/ljii.Tpo -c -o ljii.lo ljii.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljii.lo -MD -MP -MF .deps/ljii.Tpo -c ljii.c -fPIC -DPIC -o .libs/ljii.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljii.lo -MD -MP -MF .deps/ljii.Tpo -c ljii.c -o ljii.o >/dev/null 2>&1 mv -f .deps/ljii.Tpo .deps/ljii.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT null.lo -MD -MP -MF .deps/null.Tpo -c -o null.lo null.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT null.lo -MD -MP -MF .deps/null.Tpo -c null.c -fPIC -DPIC -o .libs/null.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT null.lo -MD -MP -MF .deps/null.Tpo -c null.c -o null.o >/dev/null 2>&1 mv -f .deps/null.Tpo .deps/null.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT data.lo -MD -MP -MF .deps/data.Tpo -c -o data.lo data.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT data.lo -MD -MP -MF .deps/data.Tpo -c data.c -fPIC -DPIC -o .libs/data.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT data.lo -MD -MP -MF .deps/data.Tpo -c data.c -o data.o >/dev/null 2>&1 mv -f .deps/data.Tpo .deps/data.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pbm.lo -MD -MP -MF .deps/pbm.Tpo -c -o pbm.lo pbm.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pbm.lo -MD -MP -MF .deps/pbm.Tpo -c pbm.c -fPIC -DPIC -o .libs/pbm.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pbm.lo -MD -MP -MF .deps/pbm.Tpo -c pbm.c -o pbm.o >/dev/null 2>&1 mv -f .deps/pbm.Tpo .deps/pbm.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbuf.lo -MD -MP -MF .deps/plbuf.Tpo -c -o plbuf.lo plbuf.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbuf.lo -MD -MP -MF .deps/plbuf.Tpo -c plbuf.c -fPIC -DPIC -o .libs/plbuf.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbuf.lo -MD -MP -MF .deps/plbuf.Tpo -c plbuf.c -o plbuf.o >/dev/null 2>&1 mv -f .deps/plbuf.Tpo .deps/plbuf.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmeta.lo -MD -MP -MF .deps/plmeta.Tpo -c -o plmeta.lo plmeta.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmeta.lo -MD -MP -MF .deps/plmeta.Tpo -c plmeta.c -fPIC -DPIC -o .libs/plmeta.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmeta.lo -MD -MP -MF .deps/plmeta.Tpo -c plmeta.c -o plmeta.o >/dev/null 2>&1 mv -f .deps/plmeta.Tpo .deps/plmeta.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ps.lo -MD -MP -MF .deps/ps.Tpo -c -o ps.lo ps.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ps.lo -MD -MP -MF .deps/ps.Tpo -c ps.c -fPIC -DPIC -o .libs/ps.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ps.lo -MD -MP -MF .deps/ps.Tpo -c ps.c -o ps.o >/dev/null 2>&1 mv -f .deps/ps.Tpo .deps/ps.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT tek.lo -MD -MP -MF .deps/tek.Tpo -c -o tek.lo tek.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT tek.lo -MD -MP -MF .deps/tek.Tpo -c tek.c -fPIC -DPIC -o .libs/tek.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT tek.lo -MD -MP -MF .deps/tek.Tpo -c tek.c -o tek.o >/dev/null 2>&1 mv -f .deps/tek.Tpo .deps/tek.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xfig.lo -MD -MP -MF .deps/xfig.Tpo -c -o xfig.lo xfig.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xfig.lo -MD -MP -MF .deps/xfig.Tpo -c xfig.c -fPIC -DPIC -o .libs/xfig.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xfig.lo -MD -MP -MF .deps/xfig.Tpo -c xfig.c -o xfig.o >/dev/null 2>&1 mv -f .deps/xfig.Tpo .deps/xfig.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xwin.lo -MD -MP -MF .deps/xwin.Tpo -c -o xwin.lo xwin.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xwin.lo -MD -MP -MF .deps/xwin.Tpo -c xwin.c -fPIC -DPIC -o .libs/xwin.o In file included from xwin.c:34: plxwd.h:22:22: X11/Xlib.h: No such file or directory plxwd.h:23:23: X11/Xutil.h: No such file or directory plxwd.h:24:28: X11/cursorfont.h: No such file or directory plxwd.h:25:24: X11/keysym.h: No such file or directory In file included from xwin.c:34: plxwd.h:51: error: syntax error before "Display" plxwd.h:61: error: syntax error before "XColor" plxwd.h:76: error: syntax error before "Window" plxwd.h:107: error: syntax error before "XPoint" plxwd.h:109: error: syntax error before "XEvent" xwin.c:119: error: syntax error before "sxwm_colors" xwin.c:119: warning: data definition has no type or storage class xwin.c:154: error: syntax error before '*' token xwin.c:164: error: syntax error before "XEvent" xwin.c:165: error: syntax error before "XEvent" xwin.c:166: error: syntax error before "XEvent" xwin.c:167: error: syntax error before "XEvent" xwin.c:168: error: syntax error before "XEvent" xwin.c:169: error: syntax error before "XEvent" xwin.c:170: error: syntax error before "XEvent" xwin.c:171: error: syntax error before "XEvent" xwin.c:172: error: syntax error before "XEvent" xwin.c:173: error: syntax error before "XEvent" xwin.c:208: error: syntax error before "XColor" xwin.c:209: error: syntax error before "XColor" xwin.c: In function `plD_line_xw': xwin.c:375: error: structure has no member named `display' xwin.c:375: error: structure has no member named `window' xwin.c:375: error: structure has no member named `gc' xwin.c:378: error: structure has no member named `display' xwin.c:378: error: structure has no member named `pixmap' xwin.c:378: error: structure has no member named `gc' xwin.c: In function `XorMod': xwin.c:399: error: structure has no member named `display' xwin.c:399: error: structure has no member named `gc' xwin.c:399: error: `GXcopy' undeclared (first use in this function) xwin.c:399: error: (Each undeclared identifier is reported only once xwin.c:399: error: for each function it appears in.) xwin.c:401: error: structure has no member named `display' xwin.c:401: error: structure has no member named `gc' xwin.c:401: error: `GXxor' undeclared (first use in this function) xwin.c: In function `plD_polyline_xw': xwin.c:417: error: syntax error before "pts" xwin.c:432: error: `pts' undeclared (first use in this function) xwin.c:437: error: structure has no member named `display' xwin.c:437: error: structure has no member named `window' xwin.c:437: error: structure has no member named `gc' xwin.c:438: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:441: error: structure has no member named `display' xwin.c:441: error: structure has no member named `pixmap' xwin.c:441: error: structure has no member named `gc' xwin.c: In function `plD_eop_xw': xwin.c:469: error: structure has no member named `display' xwin.c: In function `plD_bop_xw': xwin.c:502: error: structure has no member named `display' xwin.c:502: error: structure has no member named `window' xwin.c:505: error: structure has no member named `display' xwin.c:505: error: structure has no member named `gc' xwin.c:505: error: structure has no member named `cmap0' xwin.c:506: error: structure has no member named `display' xwin.c:506: error: structure has no member named `pixmap' xwin.c:506: error: structure has no member named `gc' xwin.c:508: error: structure has no member named `display' xwin.c:508: error: structure has no member named `gc' xwin.c:508: error: structure has no member named `curcolor' xwin.c:510: error: structure has no member named `display' xwin.c: In function `plD_tidy_xw': xwin.c:547: error: structure has no member named `display' xwin.c:547: error: structure has no member named `window' xwin.c:549: error: structure has no member named `display' xwin.c:549: error: structure has no member named `pixmap' xwin.c:550: error: structure has no member named `display' xwin.c:556: error: structure has no member named `display' xwin.c:556: error: structure has no member named `gc' xwin.c:557: error: structure has no member named `display' xwin.c:557: error: structure has no member named `gcXor' xwin.c:558: error: structure has no member named `display' xwin.c:559: error: structure has no member named `cmap0' xwin.c:559: error: structure has no member named `cmap0' xwin.c:559: error: structure has no member named `cmap0' xwin.c:560: error: structure has no member named `cmap1' xwin.c:560: error: structure has no member named `cmap1' xwin.c:560: error: structure has no member named `cmap1' xwin.c: In function `plD_state_xw': xwin.c:592: error: structure has no member named `display' xwin.c:592: error: structure has no member named `gc' xwin.c:593: error: `LineSolid' undeclared (first use in this function) xwin.c:593: error: `CapRound' undeclared (first use in this function) xwin.c:593: error: `JoinMiter' undeclared (first use in this function) xwin.c:600: error: structure has no member named `curcolor' xwin.c:601: error: structure has no member named `display' xwin.c:601: error: structure has no member named `map' xwin.c:601: error: structure has no member named `curcolor' xwin.c:603: error: structure has no member named `curcolor' xwin.c:603: error: structure has no member named `fgcolor' xwin.c:606: error: structure has no member named `curcolor' xwin.c:606: error: structure has no member named `cmap0' xwin.c:608: error: structure has no member named `display' xwin.c:608: error: structure has no member named `gc' xwin.c:608: error: structure has no member named `curcolor' xwin.c:611: error: structure has no member named `curcolor' xwin.c:611: error: structure has no member named `fgcolor' xwin.c:612: error: structure has no member named `display' xwin.c:612: error: structure has no member named `gc' xwin.c:612: error: structure has no member named `curcolor' xwin.c:628: error: structure has no member named `curcolor' xwin.c:628: error: structure has no member named `cmap1' xwin.c:630: error: structure has no member named `curcolor' xwin.c:630: error: structure has no member named `fgcolor' xwin.c:632: error: structure has no member named `display' xwin.c:632: error: structure has no member named `gc' xwin.c:632: error: structure has no member named `curcolor' xwin.c: In function `plD_esc_xw': xwin.c:712: error: structure has no member named `display' xwin.c:744: error: `XColor' undeclared (first use in this function) xwin.c:744: error: syntax error before ')' token xwin.c:748: error: syntax error before ')' token xwin.c: In function `GetCursorCmd': xwin.c:777: error: syntax error before "event" xwin.c:789: error: structure has no member named `display' xwin.c:789: error: structure has no member named `window' xwin.c:789: error: `event' undeclared (first use in this function) xwin.c: In function `FillPolygonCmd': xwin.c:811: error: syntax error before "pts" xwin.c:820: error: `pts' undeclared (first use in this function) xwin.c:827: error: structure has no member named `display' xwin.c:827: error: structure has no member named `window' xwin.c:827: error: structure has no member named `gc' xwin.c:828: error: `Nonconvex' undeclared (first use in this function) xwin.c:828: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:831: error: structure has no member named `display' xwin.c:831: error: structure has no member named `pixmap' xwin.c:831: error: structure has no member named `gc' xwin.c:838: error: structure has no member named `display' xwin.c:838: error: structure has no member named `gc' xwin.c:838: error: structure has no member named `fgcolor' xwin.c:840: error: structure has no member named `display' xwin.c:840: error: structure has no member named `window' xwin.c:840: error: structure has no member named `gc' xwin.c:844: error: structure has no member named `display' xwin.c:844: error: structure has no member named `pixmap' xwin.c:844: error: structure has no member named `gc' xwin.c:847: error: structure has no member named `display' xwin.c:847: error: structure has no member named `gc' xwin.c:847: error: structure has no member named `curcolor' xwin.c: In function `OpenXwin': xwin.c:929: error: structure has no member named `display' xwin.c:930: error: structure has no member named `display' xwin.c:935: error: structure has no member named `display' xwin.c:937: error: structure has no member named `display' xwin.c:940: error: structure has no member named `map' xwin.c:940: error: structure has no member named `display' xwin.c:952: error: structure has no member named `display' xwin.c:958: error: structure has no member named `cmap0' xwin.c:958: error: `XColor' undeclared (first use in this function) xwin.c:958: error: syntax error before ')' token xwin.c:959: error: structure has no member named `cmap0' xwin.c: In function `Init': xwin.c:995: error: syntax error before "root" xwin.c:1008: error: structure has no member named `window' xwin.c:1014: error: structure has no member named `display' xwin.c:1014: error: structure has no member named `window' xwin.c:1014: error: structure has no member named `map' xwin.c:1018: error: structure has no member named `gc' xwin.c:1019: error: structure has no member named `gc' xwin.c:1019: error: structure has no member named `display' xwin.c:1019: error: structure has no member named `window' xwin.c:1023: error: structure has no member named `gcXor' xwin.c:1024: error: syntax error before "gcValues" xwin.c:1027: error: `gcValues' undeclared (first use in this function) xwin.c:1027: error: structure has no member named `cmap0' xwin.c:1029: error: `GXxor' undeclared (first use in this function) xwin.c:1030: error: `GCForeground' undeclared (first use in this function) xwin.c:1030: error: `GCBackground' undeclared (first use in this function) xwin.c:1030: error: `GCFunction' undeclared (first use in this function) xwin.c:1032: error: structure has no member named `gcXor' xwin.c:1032: error: structure has no member named `display' xwin.c:1032: error: structure has no member named `window' xwin.c:1037: error: structure has no member named `display' xwin.c:1037: error: structure has no member named `window' xwin.c:1037: error: `root' undeclared (first use in this function) xwin.c:1064: error: structure has no member named `display' xwin.c:1064: error: structure has no member named `window' xwin.c:1064: error: structure has no member named `cmap0' xwin.c:1065: error: structure has no member named `display' xwin.c:1065: error: structure has no member named `gc' xwin.c:1065: error: structure has no member named `cmap0' xwin.c: In function `InitMain': xwin.c:1085: error: syntax error before "root" xwin.c:1095: error: structure has no member named `display' xwin.c:1095: error: structure has no member named `display' xwin.c:1096: error: `root' undeclared (first use in this function) xwin.c:1101: error: `hint' undeclared (first use in this function) xwin.c:1103: error: `PSize' undeclared (first use in this function) xwin.c:1105: error: `USSize' undeclared (first use in this function) xwin.c:1121: error: `USPosition' undeclared (first use in this function) xwin.c:1143: error: structure has no member named `window' xwin.c:1144: error: structure has no member named `display' xwin.c:1145: error: structure has no member named `display' xwin.c:1148: error: `InputOutput' undeclared (first use in this function) xwin.c:1148: error: structure has no member named `visual' xwin.c:1151: error: structure has no member named `display' xwin.c:1151: error: structure has no member named `window' xwin.c:1152: error: `None' undeclared (first use in this function) xwin.c: In function `MapMain': xwin.c:1166: error: syntax error before "event" xwin.c:1173: error: `ButtonPressMask' undeclared (first use in this function) xwin.c:1174: error: `KeyPressMask' undeclared (first use in this function) xwin.c:1175: error: `ExposureMask' undeclared (first use in this function) xwin.c:1176: error: `ButtonMotionMask' undeclared (first use in this function) xwin.c:1177: error: `StructureNotifyMask' undeclared (first use in this function) xwin.c:1179: error: structure has no member named `display' xwin.c:1179: error: structure has no member named `window' xwin.c:1183: error: structure has no member named `display' xwin.c:1183: error: structure has no member named `window' xwin.c:1189: error: structure has no member named `display' xwin.c:1189: error: structure has no member named `window' xwin.c:1189: error: `event' undeclared (first use in this function) xwin.c:1190: error: `Expose' undeclared (first use in this function) xwin.c:1191: error: structure has no member named `display' xwin.c:1191: error: structure has no member named `window' xwin.c: In function `WaitForPage': xwin.c:1210: error: syntax error before "event" xwin.c:1215: error: structure has no member named `display' xwin.c:1215: error: structure has no member named `window' xwin.c:1215: error: `event' undeclared (first use in this function) xwin.c: In function `HandleEvents': xwin.c:1363: error: syntax error before "event" xwin.c:1365: error: structure has no member named `display' xwin.c:1365: error: structure has no member named `window' xwin.c:1366: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:1387: error: syntax error before "XEvent" xwin.c: In function `MasterEH': xwin.c:1389: error: `pls' undeclared (first use in this function) xwin.c:1392: error: `event' undeclared (first use in this function) xwin.c:1396: error: `KeyPress' undeclared (first use in this function) xwin.c:1400: error: `ButtonPress' undeclared (first use in this function) xwin.c:1404: error: `Expose' undeclared (first use in this function) xwin.c:1408: error: `ConfigureNotify' undeclared (first use in this function) xwin.c:1412: error: `MotionNotify' undeclared (first use in this function) xwin.c:1418: error: `EnterNotify' undeclared (first use in this function) xwin.c:1422: error: `LeaveNotify' undeclared (first use in this function) xwin.c: At top level: xwin.c:1435: error: syntax error before "XEvent" xwin.c: In function `KeyEH': xwin.c:1437: error: `pls' undeclared (first use in this function) xwin.c:1441: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:1455: error: syntax error before "XEvent" xwin.c: In function `ButtonEH': xwin.c:1457: error: `pls' undeclared (first use in this function) xwin.c:1461: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:1490: error: syntax error before "XEvent" xwin.c: In function `LookupXKeyEvent': xwin.c:1492: error: `pls' undeclared (first use in this function) xwin.c:1494: error: `XKeyEvent' undeclared (first use in this function) xwin.c:1494: error: `keyEvent' undeclared (first use in this function) xwin.c:1494: error: syntax error before ')' token xwin.c:1497: error: syntax error before "cs" xwin.c:1506: error: `keysym' undeclared (first use in this function) xwin.c:1506: error: `cs' undeclared (first use in this function) xwin.c:1514: error: `XK_BackSpace' undeclared (first use in this function) xwin.c:1515: error: `XK_Tab' undeclared (first use in this function) xwin.c:1516: error: `XK_Linefeed' undeclared (first use in this function) xwin.c:1517: error: `XK_Return' undeclared (first use in this function) xwin.c:1518: error: `XK_Escape' undeclared (first use in this function) xwin.c:1519: error: `XK_Delete' undeclared (first use in this function) xwin.c: At top level: xwin.c:1535: error: syntax error before "XEvent" xwin.c: In function `LookupXButtonEvent': xwin.c:1537: error: `pls' undeclared (first use in this function) xwin.c:1539: error: `XButtonEvent' undeclared (first use in this function) xwin.c:1539: error: `buttonEvent' undeclared (first use in this function) xwin.c:1539: error: syntax error before ')' token xwin.c: In function `ProcessButton': xwin.c:1628: error: `Button3' undeclared (first use in this function) xwin.c: In function `LocateKey': xwin.c:1729: error: structure has no member named `display' xwin.c:1729: error: structure has no member named `window' xwin.c:1729: error: `None' undeclared (first use in this function) xwin.c: In function `LocateButton': xwin.c:1755: error: `Button1' undeclared (first use in this function) xwin.c: At top level: xwin.c:1840: error: syntax error before "XEvent" xwin.c: In function `MotionEH': xwin.c:1842: error: `pls' undeclared (first use in this function) xwin.c:1843: error: `XMotionEvent' undeclared (first use in this function) xwin.c:1843: error: `motionEvent' undeclared (first use in this function) xwin.c:1843: error: syntax error before ')' token xwin.c: At top level: xwin.c:1858: error: syntax error before "XEvent" xwin.c: In function `EnterEH': xwin.c:1860: error: `pls' undeclared (first use in this function) xwin.c:1861: error: `XCrossingEvent' undeclared (first use in this function) xwin.c:1861: error: `crossingEvent' undeclared (first use in this function) xwin.c:1861: error: syntax error before ')' token xwin.c: At top level: xwin.c:1876: error: syntax error before "XEvent" xwin.c: In function `LeaveEH': xwin.c:1878: error: `pls' undeclared (first use in this function) xwin.c:1880: error: `event' undeclared (first use in this function) xwin.c: In function `CreateXhairs': xwin.c:1896: error: syntax error before "root" xwin.c:1899: error: syntax error before "event" xwin.c:1903: error: structure has no member named `xhair_cursor' xwin.c:1904: error: structure has no member named `xhair_cursor' xwin.c:1904: error: structure has no member named `display' xwin.c:1904: error: `XC_crosshair' undeclared (first use in this function) xwin.c:1906: error: structure has no member named `display' xwin.c:1906: error: structure has no member named `window' xwin.c:1906: error: structure has no member named `xhair_cursor' xwin.c:1911: error: structure has no member named `display' xwin.c:1911: error: structure has no member named `window' xwin.c:1911: error: `root' undeclared (first use in this function) xwin.c:1911: error: `child' undeclared (first use in this function) xwin.c:1923: error: structure has no member named `display' xwin.c:1924: error: structure has no member named `display' xwin.c:1924: error: structure has no member named `window' xwin.c:1925: error: `PointerMotionMask' undeclared (first use in this function) xwin.c:1925: error: `event' undeclared (first use in this function) xwin.c:1929: error: `EnterWindowMask' undeclared (first use in this function) xwin.c:1929: error: `LeaveWindowMask' undeclared (first use in this function) xwin.c:1930: error: structure has no member named `display' xwin.c:1930: error: structure has no member named `window' xwin.c: In function `DestroyXhairs': xwin.c:1947: error: structure has no member named `display' xwin.c:1947: error: structure has no member named `window' xwin.c:1952: error: `PointerMotionMask' undeclared (first use in this function) xwin.c:1952: error: `EnterWindowMask' undeclared (first use in this function) xwin.c:1952: error: `LeaveWindowMask' undeclared (first use in this function) xwin.c:1953: error: structure has no member named `display' xwin.c:1953: error: structure has no member named `window' xwin.c: In function `DrawXhairs': xwin.c:1978: error: structure has no member named `xhair_x' xwin.c:1978: error: structure has no member named `xhair_x' xwin.c:1979: error: structure has no member named `xhair_x' xwin.c:1979: error: structure has no member named `xhair_x' xwin.c:1981: error: structure has no member named `xhair_y' xwin.c:1981: error: structure has no member named `xhair_y' xwin.c:1982: error: structure has no member named `xhair_y' xwin.c:1982: error: structure has no member named `xhair_y' xwin.c: In function `UpdateXhairs': xwin.c:1999: error: structure has no member named `display' xwin.c:1999: error: structure has no member named `window' xwin.c:1999: error: structure has no member named `gcXor' xwin.c:1999: error: structure has no member named `xhair_x' xwin.c:2000: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:2002: error: structure has no member named `display' xwin.c:2002: error: structure has no member named `window' xwin.c:2002: error: structure has no member named `gcXor' xwin.c:2002: error: structure has no member named `xhair_y' xwin.c: At top level: xwin.c:2014: error: syntax error before "XEvent" xwin.c: In function `ExposeEH': xwin.c:2016: error: `pls' undeclared (first use in this function) xwin.c:2018: error: `XExposeEvent' undeclared (first use in this function) xwin.c:2018: error: `exposeEvent' undeclared (first use in this function) xwin.c:2018: error: syntax error before ')' token xwin.c:2028: error: structure has no member named `display' xwin.c:2037: error: structure has no member named `display' xwin.c:2037: error: structure has no member named `window' xwin.c:2054: error: structure has no member named `display' xwin.c:2054: error: structure has no member named `window' xwin.c:2055: error: `ExposureMask' undeclared (first use in this function) xwin.c:2055: error: `StructureNotifyMask' undeclared (first use in this function) xwin.c:2055: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:2066: error: syntax error before "XEvent" xwin.c: In function `ResizeEH': xwin.c:2068: error: `pls' undeclared (first use in this function) xwin.c:2070: error: `XConfigureEvent' undeclared (first use in this function) xwin.c:2070: error: `configEvent' undeclared (first use in this function) xwin.c:2070: error: syntax error before ')' token xwin.c:2085: error: structure has no member named `display' xwin.c:2097: error: structure has no member named `display' xwin.c:2098: error: structure has no member named `display' xwin.c:2098: error: structure has no member named `window' xwin.c:2099: error: `ExposureMask' undeclared (first use in this function) xwin.c:2099: error: `StructureNotifyMask' undeclared (first use in this function) xwin.c:2099: error: `event' undeclared (first use in this function) xwin.c: In function `ExposeCmd': xwin.c:2143: error: structure has no member named `display' xwin.c:2145: error: structure has no member named `display' xwin.c:2145: error: structure has no member named `pixmap' xwin.c:2145: error: structure has no member named `window' xwin.c:2145: error: structure has no member named `gc' xwin.c:2147: error: structure has no member named `display' xwin.c:2150: error: syntax error before "pts" xwin.c:2152: error: `pts' undeclared (first use in this function) xwin.c:2158: error: structure has no member named `display' xwin.c:2158: error: structure has no member named `window' xwin.c:2158: error: structure has no member named `gc' xwin.c:2159: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:2165: error: structure has no member named `display' xwin.c: In function `ResizeCmd': xwin.c:2227: error: structure has no member named `display' xwin.c:2227: error: structure has no member named `pixmap' xwin.c:2238: error: structure has no member named `display' xwin.c:2244: error: structure has no member named `display' xwin.c:2244: error: structure has no member named `pixmap' xwin.c:2244: error: structure has no member named `window' xwin.c:2244: error: structure has no member named `gc' xwin.c:2246: error: structure has no member named `display' xwin.c: In function `RedrawCmd': xwin.c:2313: error: structure has no member named `display' xwin.c:2320: error: structure has no member named `display' xwin.c:2320: error: structure has no member named `pixmap' xwin.c:2320: error: structure has no member named `window' xwin.c:2320: error: structure has no member named `gc' xwin.c:2322: error: structure has no member named `display' xwin.c: At top level: xwin.c:2337: error: syntax error before '*' token xwin.c: In function `CreatePixmapErrorHandler': xwin.c:2339: error: `error' undeclared (first use in this function) xwin.c:2340: error: `BadAlloc' undeclared (first use in this function) xwin.c:2342: error: `display' undeclared (first use in this function) xwin.c: In function `CreatePixmap': xwin.c:2361: error: syntax error before '*' token xwin.c:2363: warning: assignment makes pointer from integer without a cast xwin.c:2365: error: `Success' undeclared (first use in this function) xwin.c:2370: error: structure has no member named `pixmap' xwin.c:2370: error: structure has no member named `display' xwin.c:2370: error: structure has no member named `window' xwin.c:2372: error: structure has no member named `display' xwin.c: In function `GetVisual': xwin.c:2407: error: syntax error before "vTemplate" xwin.c:2411: error: `vTemplate' undeclared (first use in this function) xwin.c:2414: error: `visualList' undeclared (first use in this function) xwin.c:2414: error: structure has no member named `display' xwin.c:2415: error: `VisualScreenMask' undeclared (first use in this function) xwin.c:2415: error: `VisualDepthMask' undeclared (first use in this function) xwin.c:2462: error: structure has no member named `visual' xwin.c:2469: error: structure has no member named `visual' xwin.c:2469: error: structure has no member named `display' xwin.c:2470: error: structure has no member named `display' xwin.c:2475: error: structure has no member named `visual' xwin.c:2476: error: `TrueColor' undeclared (first use in this function) xwin.c:2477: error: `StaticColor' undeclared (first use in this function) xwin.c:2478: error: `StaticGray' undeclared (first use in this function) xwin.c:2491: error: structure has no member named `visual' xwin.c:2492: error: `PseudoColor' undeclared (first use in this function) xwin.c:2495: error: `GrayScale' undeclared (first use in this function) xwin.c:2498: error: `DirectColor' undeclared (first use in this function) xwin.c: In function `AllocBGFG': xwin.c:2543: error: structure has no member named `display' xwin.c:2543: error: structure has no member named `map' xwin.c:2543: error: `False' undeclared (first use in this function) xwin.c:2547: error: structure has no member named `cmap0' xwin.c:2551: error: structure has no member named `cmap0' xwin.c:2551: error: structure has no member named `display' xwin.c:2552: error: structure has no member named `fgcolor' xwin.c:2552: error: structure has no member named `display' xwin.c:2563: error: structure has no member named `display' xwin.c:2563: error: structure has no member named `map' xwin.c:2575: error: structure has no member named `cmap0' xwin.c:2581: error: structure has no member named `fgcolor' xwin.c:2584: error: structure has no member named `display' xwin.c:2584: error: structure has no member named `map' xwin.c: In function `SetBGFG': xwin.c:2620: error: structure has no member named `cmap0' xwin.c:2639: error: structure has no member named `fgcolor' xwin.c:2644: error: structure has no member named `display' xwin.c:2644: error: structure has no member named `map' xwin.c:2644: error: structure has no member named `fgcolor' xwin.c:2645: error: structure has no member named `display' xwin.c:2645: error: structure has no member named `map' xwin.c:2645: error: structure has no member named `cmap0' xwin.c:2647: error: structure has no member named `display' xwin.c:2647: error: structure has no member named `map' xwin.c:2647: error: structure has no member named `cmap0' xwin.c:2648: error: structure has no member named `display' xwin.c:2648: error: structure has no member named `map' xwin.c:2648: error: structure has no member named `fgcolor' xwin.c: In function `AllocCustomMap': xwin.c:2710: error: syntax error before "xwm_colors" xwin.c:2719: error: `xwm_colors' undeclared (first use in this function) xwin.c:2721: error: structure has no member named `display' xwin.c:2721: error: structure has no member named `map' xwin.c:2729: error: structure has no member named `display' xwin.c:2729: error: structure has no member named `map' xwin.c:2729: error: structure has no member named `fgcolor' xwin.c:2733: error: structure has no member named `map' xwin.c:2733: error: structure has no member named `display' xwin.c:2733: error: structure has no member named `display' xwin.c:2734: error: structure has no member named `visual' xwin.c:2734: error: `AllocNone' undeclared (first use in this function) xwin.c:2740: error: structure has no member named `display' xwin.c:2740: error: structure has no member named `map' xwin.c:2740: error: `False' undeclared (first use in this function) xwin.c:2751: error: structure has no member named `display' xwin.c:2751: error: structure has no member named `map' xwin.c:2758: error: structure has no member named `display' xwin.c:2758: error: structure has no member named `map' xwin.c:2758: error: structure has no member named `cmap0' xwin.c:2759: error: structure has no member named `cmap0' xwin.c:2770: error: request for member `red' in something not a structure or union xwin.c:2771: error: request for member `green' in something not a structure or union xwin.c:2772: error: request for member `blue' in something not a structure or union xwin.c:2775: error: structure has no member named `display' xwin.c:2775: error: structure has no member named `map' xwin.c:2786: error: structure has no member named `display' xwin.c:2786: error: structure has no member named `map' xwin.c: In function `AllocCmap0': xwin.c:2811: error: structure has no member named `cmap0' xwin.c:2812: error: structure has no member named `display' xwin.c:2812: error: structure has no member named `map' xwin.c:2818: error: structure has no member named `cmap0' xwin.c:2818: error: `XColor' undeclared (first use in this function) xwin.c:2818: error: syntax error before ')' token xwin.c:2820: error: structure has no member named `cmap0' xwin.c:2832: error: structure has no member named `display' xwin.c:2832: error: structure has no member named `map' xwin.c:2832: error: `False' undeclared (first use in this function) xwin.c:2842: error: structure has no member named `cmap0' xwin.c:2853: error: syntax error before "c" xwin.c:2854: error: `c' undeclared (first use in this function) xwin.c:2855: error: structure has no member named `display' xwin.c:2855: error: structure has no member named `map' xwin.c:2859: error: structure has no member named `cmap0' xwin.c:2860: error: structure has no member named `cmap0' xwin.c:2864: error: syntax error before "screen_def" xwin.c:2872: error: structure has no member named `display' xwin.c:2872: error: structure has no member named `map' xwin.c:2874: error: `screen_def' undeclared (first use in this function) xwin.c:2874: error: `exact_def' undeclared (first use in this function) xwin.c:2882: error: structure has no member named `cmap0' xwin.c:2883: error: structure has no member named `cmap0' xwin.c:2886: error: structure has no member named `display' xwin.c:2886: error: structure has no member named `map' xwin.c:2890: error: structure has no member named `cmap0' xwin.c:2891: error: structure has no member named `cmap0' xwin.c: In function `AllocCmap1': xwin.c:2932: error: structure has no member named `display' xwin.c:2932: error: structure has no member named `map' xwin.c:2932: error: `False' undeclared (first use in this function) xwin.c:2951: error: structure has no member named `cmap1' xwin.c:2953: error: structure has no member named `cmap1' xwin.c:2953: error: `XColor' undeclared (first use in this function) xwin.c:2953: error: syntax error before ')' token xwin.c:2954: error: structure has no member named `cmap1' xwin.c:2964: error: structure has no member named `cmap1' xwin.c:2976: error: syntax error before "xcol" xwin.c:2981: error: structure has no member named `visual' xwin.c:2982: error: `TrueColor' undeclared (first use in this function) xwin.c:2990: error: structure has no member named `cmap1' xwin.c:2992: error: structure has no member named `cmap1' xwin.c:2992: error: syntax error before ')' token xwin.c:2993: error: structure has no member named `cmap1' xwin.c:2999: error: `xcol' undeclared (first use in this function) xwin.c:3001: error: structure has no member named `display' xwin.c:3001: error: structure has no member named `map' xwin.c:3005: error: structure has no member named `cmap1' xwin.c: In function `StoreCmap0': xwin.c:3041: error: structure has no member named `cmap0' xwin.c:3043: error: structure has no member named `display' xwin.c:3043: error: structure has no member named `map' xwin.c:3043: error: structure has no member named `cmap0' xwin.c:3045: error: structure has no member named `display' xwin.c:3045: error: structure has no member named `map' xwin.c:3045: error: structure has no member named `cmap0' xwin.c: In function `StoreCmap1': xwin.c:3069: error: structure has no member named `cmap1' xwin.c:3071: error: structure has no member named `display' xwin.c:3071: error: structure has no member named `map' xwin.c:3071: error: structure has no member named `cmap1' xwin.c:3073: error: structure has no member named `display' xwin.c:3073: error: structure has no member named `map' xwin.c:3073: error: structure has no member named `cmap1' xwin.c: At top level: xwin.c:3089: error: syntax error before "XColor" xwin.c: In function `PLColor_to_XColor': xwin.c:3091: error: `xcolor' undeclared (first use in this function) xwin.c:3091: error: `plcolor' undeclared (first use in this function) xwin.c:3094: error: `DoRed' undeclared (first use in this function) xwin.c:3094: error: `DoGreen' undeclared (first use in this function) xwin.c:3094: error: `DoBlue' undeclared (first use in this function) xwin.c: At top level: xwin.c:3105: error: syntax error before "XColor" xwin.c: In function `PLColor_from_XColor': xwin.c:3107: error: `plcolor' undeclared (first use in this function) xwin.c:3107: error: `xcolor' undeclared (first use in this function) xwin.c: At top level: xwin.c:3121: error: syntax error before '*' token xwin.c: In function `AreWeGrayscale': xwin.c:3129: error: `XVisualInfo' undeclared (first use in this function) xwin.c:3129: error: `visuals' undeclared (first use in this function) xwin.c:3133: error: `display' undeclared (first use in this function) xwin.c:3138: error: `GrayScale' undeclared (first use in this function) xwin.c:3139: error: `StaticGray' undeclared (first use in this function) xwin.c: At top level: xwin.c:3196: error: syntax error before '*' token xwin.c: In function `GetImageErrorHandler': xwin.c:3198: error: `error' undeclared (first use in this function) xwin.c:3198: error: `BadMatch' undeclared (first use in this function) xwin.c:3200: error: `display' undeclared (first use in this function) xwin.c: In function `DrawImage': xwin.c:3218: error: `XImage' undeclared (first use in this function) xwin.c:3218: error: `ximg' undeclared (first use in this function) xwin.c:3219: error: syntax error before "curcolor" xwin.c:3222: error: syntax error before '*' token xwin.c:3246: warning: assignment makes pointer from integer without a cast xwin.c:3248: error: structure has no member named `display' xwin.c:3250: error: structure has no member named `display' xwin.c:3250: error: structure has no member named `pixmap' xwin.c:3251: error: `AllPlanes' undeclared (first use in this function) xwin.c:3251: error: `ZPixmap' undeclared (first use in this function) xwin.c:3254: error: structure has no member named `display' xwin.c:3254: error: structure has no member named `window' xwin.c:3333: error: `curcolor' undeclared (first use in this function) xwin.c:3333: error: structure has no member named `cmap1' xwin.c:3335: error: structure has no member named `fgcolor' xwin.c:3375: error: structure has no member named `display' xwin.c:3375: error: structure has no member named `pixmap' xwin.c:3375: error: structure has no member named `gc' xwin.c:3378: error: structure has no member named `display' xwin.c:3378: error: structure has no member named `window' xwin.c:3378: error: structure has no member named `gc' xwin.c: In function `imageops': xwin.c:3406: error: structure has no member named `display' gmake[2]: *** [xwin.lo] Error 1 gmake[2]: Leaving directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' gmake[1]: *** [all-recursive] Error 1 gmake[1]: Leaving directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' gmake: *** [all-recursive] Error 1 gama# ^Dexit Script done on Tue Mar 17 09:17:41 2009 From ajb at ebi.ac.uk Wed Mar 18 11:31:35 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Wed, 18 Mar 2009 15:31:35 -0000 (GMT) Subject: [EMBOSS] emboss-6.0.1 fails to build without X In-Reply-To: <20090317215240.GH34389@iib.unsam.edu.ar> References: <20090317215240.GH34389@iib.unsam.edu.ar> Message-ID: <51494.86.9.126.186.1237390295.squirrel@webmail.ebi.ac.uk> Hi Fernan, Thanks. A fix for you may be to edit the file plplot/plDevs.h and comment out the line #define PLD_xwin I'll adjust the configuration for this, though I'm never entirely happy about compiling without X. The option to do so was added way back in the infancy of EMBOSS and I often have the uneasy feeling that a dragon is sleeping there. I'd be interested to hear how you get on. You'd probably be best defining EMBOSS_GRAPHICS to something like "ps" or "png" otherwise the default graphics prompt will probably remain as "x11" even though it's not actually compiled in. Alan > ./configure --without-x > [ ... succeeds ... ] > make > [ ... fails ... ] > [ lots of errors from xwin.c ...] > xwin.c: In function `imageops': > xwin.c:3406: error: structure has no member named `display' > *** Error code 1 > > This is on FreeBSD-6.3, gcc-3.4.6, gnu make 3.81 > Typescript is attached. > > Cheers, > > Fernan > > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > From sbassi at gmail.com Sun Mar 22 17:45:01 2009 From: sbassi at gmail.com (Sebastian Bassi) Date: Sun, 22 Mar 2009 18:45:01 -0300 Subject: [EMBOSS] libnucleus.la Message-ID: Hello, I am trying to install HMMER from EMBASSY. sb at dnalinux:~/EMBOSS-6.0.1/embassy/HMMER-2.3.2$ make 2> /tmp/xxx Making all in src make[1]: Entering directory `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' make[2]: Entering directory `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' gcc -O2 -o ehmmcalibrate ehmmcalibrate.o ../../../nucleus/libnucleus.la ../../../ajax/libajax.la ../../../plplot/libeplplot.la -lX11 -lm -lgd -lpng -lz -lm make[2]: Leaving directory `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' make[1]: Leaving directory `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' Here is the stderror: ../../../nucleus/libnucleus.la: file not recognized: File format not recognized collect2: ld returned 1 exit status make[2]: *** [ehmmcalibrate] Error 1 make[1]: *** [all-recursive] Error 1 make: *** [all-recursive] Error 1 Here is the libnucleus.la: dlname='libnucleus.so.6' # Names of this library. library_names='libnucleus.so.6.0.0 libnucleus.so.6 libnucleus.so' # The name of the static archive. old_library='libnucleus.a' # Libraries that this one depends upon. dependency_libs='' # Version information for libnucleus. current=6 age=0 revision=0 # Is this an already installed library? installed=yes # Should we warn about portability when linking against -modules? shouldnotlink=no # Files to dlopen/dlpreopen dlopen='' dlpreopen='' # Directory that this library needs to be installed in: libdir='/usr/local/lib' libnucleus.la is in: ~/EMBOSS-6.0.1/nucleus/libnucleus.la From ajb at ebi.ac.uk Mon Mar 23 06:39:05 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Mon, 23 Mar 2009 10:39:05 -0000 (GMT) Subject: [EMBOSS] libnucleus.la In-Reply-To: References: Message-ID: <56992.86.9.126.186.1237804745.squirrel@webmail.ebi.ac.uk> Hello Sebastian, That looks a bit like a libtool problem. I assume that you've tried a fresh extraction (not just a 'make clean') and compilation of EMBOSS and HMMER. That would eliminate various possibilities including changes to libtool between compilation of EMBOSS and HMMER. I also assume that you downloaded a fresh copy of HMMER from the ftp site when you downloaded EMBOSS, otherwise there would be problems, though probably not the one you've reported. If the problem persists then it would be useful if you sent me (not the list): a) Operating system and version used. b) The command line used to configure EMBOSS and the full output of it (not just the stderr) e.g. ./configure [other options] > embossconfig.out 2>&1 Also confirm that this version of EMBOSS works after compilation. Also confirm whether a 'make install' was done or just a 'make'. c) The command line used to configure HMMER and the full output e.g. ./configure [other options] > hmmerconfig.out 2>&1 d) The full output of the HMMER make e.g. make > hmmermake.out 2>&1 It would be useful to check whether there are any old libnucleus* files in any standard system location (e.g. /usr/local/lib) before starting. ATB Alan > Hello, > > I am trying to install HMMER from EMBASSY. > > sb at dnalinux:~/EMBOSS-6.0.1/embassy/HMMER-2.3.2$ make 2> /tmp/xxx > Making all in src > make[1]: Entering directory > `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' > make[2]: Entering directory > `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' > gcc -O2 -o ehmmcalibrate ehmmcalibrate.o > ../../../nucleus/libnucleus.la ../../../ajax/libajax.la > ../../../plplot/libeplplot.la -lX11 -lm -lgd -lpng -lz -lm > make[2]: Leaving directory `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' > make[1]: Leaving directory `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' > > Here is the stderror: > > ../../../nucleus/libnucleus.la: file not recognized: File format not > recognized > collect2: ld returned 1 exit status > make[2]: *** [ehmmcalibrate] Error 1 > make[1]: *** [all-recursive] Error 1 > make: *** [all-recursive] Error 1 > > Here is the libnucleus.la: > > dlname='libnucleus.so.6' > # Names of this library. > library_names='libnucleus.so.6.0.0 libnucleus.so.6 libnucleus.so' > # The name of the static archive. > old_library='libnucleus.a' > # Libraries that this one depends upon. > dependency_libs='' > # Version information for libnucleus. > current=6 > age=0 > revision=0 > # Is this an already installed library? > installed=yes > # Should we warn about portability when linking against -modules? > shouldnotlink=no > # Files to dlopen/dlpreopen > dlopen='' > dlpreopen='' > # Directory that this library needs to be installed in: > libdir='/usr/local/lib' > > > libnucleus.la is in: > > ~/EMBOSS-6.0.1/nucleus/libnucleus.la > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > From sbassi at gmail.com Mon Mar 23 10:27:19 2009 From: sbassi at gmail.com (Sebastian Bassi) Date: Mon, 23 Mar 2009 11:27:19 -0300 Subject: [EMBOSS] libnucleus.la In-Reply-To: <56992.86.9.126.186.1237804745.squirrel@webmail.ebi.ac.uk> References: <56992.86.9.126.186.1237804745.squirrel@webmail.ebi.ac.uk> Message-ID: On Mon, Mar 23, 2009 at 7:39 AM, wrote: > Hello Sebastian, > That looks a bit like a libtool problem. I assume that No, it was PEBKAC (Problem Exists Between Keyboard And Chair). I was following instructions as it were a cvs copy instead of instrucctions for a tar.gz package. So I did aclocal and other comands instead of the classic configure, make, make install. My mistake was due to I read the INSTALL file very fast and I followed the first instruction I found :( Now it is everything OK. Thank you for answer. Best, SB. From hubert75 at gmx.at Tue Mar 24 14:18:14 2009 From: hubert75 at gmx.at (Hubert Renauld) Date: Tue, 24 Mar 2009 19:18:14 +0100 Subject: [EMBOSS] problems installing EMBOSS on MacOSX 10.5.6 Message-ID: <20090324181814.234660@gmx.net> Good evening, I cannot manage to install EMBOSS 6.0 and jemboss privately, on a Mac OS X version 10.5.6. (This is the first time I am trying to install EMBOSS.) I have no formal computer background, so I am afraid my questions will sound naive. I downloaded everything into /Applications/EMBOSS (I created). Downloaded there all .tgz files from the xfree86 as you mentioned. When running the sh Xinstall.sh, lots of permissions denied, yet "installation successfully completed" (very confusing). I tried to compile, but I have no "make". Where should I install it, and get it from, please? I downloaded the make-3.81 from http://mac.softpedia.com/get/Developer-Tools/GNU-Make.shtml, gunzipped and tar'ed it, but the make clean command is unknown. Could anybody please help me? I guess I have paths and permissions problems (also). I have no formal computer background, so I am afraid my questions will sound naive, and I may not understand lots of abbreviations and jargon. However, I loved working with EMBOSS while at Sanger, and would like to spread its use. Many Thanks in advance, Hubert -- Psssst! Schon vom neuen GMX MultiMessenger geh?rt? Der kann`s mit allen: http://www.gmx.net/de/go/multimessenger01 From lueck at ipk-gatersleben.de Wed Mar 25 09:54:26 2009 From: lueck at ipk-gatersleben.de (=?iso-8859-1?Q?Stefanie_L=FCck?=) Date: Wed, 25 Mar 2009 14:54:26 +0100 Subject: [EMBOSS] Eprimer3 gcclamp argument Message-ID: <008801c9ad51$362d3b60$1022a8c0@ipkgatersleben.de> Hi everybody! I'm using the gcclamp argument (value=1). Is it possible to limit the G or C's at the end to maximum of one G or C? Thanks in advance! Stefanie From lueck at ipk-gatersleben.de Wed Mar 25 09:54:44 2009 From: lueck at ipk-gatersleben.de (=?iso-8859-1?Q?Stefanie_L=FCck?=) Date: Wed, 25 Mar 2009 14:54:44 +0100 Subject: [EMBOSS] Eprimer3 alternative output formats Message-ID: <009901c9ad51$40dcfaf0$1022a8c0@ipkgatersleben.de> Hi! Is there an argument in the eprimer 3 to get an alternative output format? Something like this, which I got once from primer3 running on a server: PRIMER_SEQUENCE_ID=HF15E08r SEQUENCE=GCATGTAATAATGCCAAAGCTCACAGCTGCAGTTGAATCTTGGGACCCGCGGAGCGAGAATGTACCAATCCATGTATGGGTACACCCATGGCTGCCAACTCTAGGGCAAAGGATAGATACACTGTGCCACTCTATCCGGTACAAGCTGAGTAGTGTCCTCCAATTATGGCAAGCTCACGATTCATCAGCTTATGCTGTGCTATCTCCATGGAAGGGTGTATTTGATCCAGCAAGTTGGGAAGACTTGATAGTGCGTTATATCATTCCTAAACTGAAAATGGCACTCCAGGAGTTCCAGATTAACCCAGCAAGCCAAAAGTTTGACCAGTTTAACTGGGTTATGATCTGGGCTTCTGCTGTCCCGGTACACCATATGGTCCATATGTTGGAAGTTGATTTCTTTAGCAAGTGGCAGCTGGTTTTGTACCATTGGCTGAGCTCACCAAATCCTGATTTCAATGAGATAATGAATTGGTAT PRIMER_PRODUCT_SIZE_RANGE=500-1000 450-500 400-450 350-400 300-350 250-300 200-250 150-200 PRIMER_OPT_TM=60.0 PRIMER_MIN_TM=58.0 PRIMER_MAX_TM=65.0 PRIMER_MAX_DIFF_TM=3.0 PRIMER_DNA_CONC=420 PRIMER_NUM_RETURN=1 PRIMER_PAIR_PENALTY=0.8691 PRIMER_LEFT_PENALTY=0.708329 PRIMER_RIGHT_PENALTY=0.160746 PRIMER_LEFT_SEQUENCE=GCATGTAATAATGCCAAAGC PRIMER_RIGHT_SEQUENCE=TTGAAATCAGGATTTGGTGA PRIMER_LEFT=0,20 PRIMER_RIGHT=458,20 PRIMER_LEFT_TM=59.292 PRIMER_RIGHT_TM=60.161 PRIMER_LEFT_GC_PERCENT=40.000 PRIMER_RIGHT_GC_PERCENT=35.000 PRIMER_LEFT_SELF_ANY=7.00 PRIMER_RIGHT_SELF_ANY=8.00 PRIMER_LEFT_SELF_END=2.00 PRIMER_RIGHT_SELF_END=2.00 PRIMER_LEFT_END_STABILITY=8.5000 PRIMER_RIGHT_END_STABILITY=7.9000 PRIMER_PAIR_COMPL_ANY=5.00 PRIMER_PAIR_COMPL_END=3.00 PRIMER_PRODUCT_SIZE=459 Thanks in advance! Stefanie From ajb at ebi.ac.uk Wed Mar 25 13:28:44 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Wed, 25 Mar 2009 17:28:44 -0000 (GMT) Subject: [EMBOSS] Eprimer3 alternative output formats In-Reply-To: <009901c9ad51$40dcfaf0$1022a8c0@ipkgatersleben.de> References: <009901c9ad51$40dcfaf0$1022a8c0@ipkgatersleben.de> Message-ID: <32838.86.9.126.186.1238002124.squirrel@webmail.ebi.ac.uk> Hello Stefanie, There is currently no such argument but it is a trivial thing to hack in to the source code - the attached patch against EMBOSS-6.0.1 would do it by adding a '-originalformat' switch. As it stands, the output is provided in what was deemed a more easily digestible format. Out of interest, is there a specific reason why you need the original output format e.g. do you use a subsequent application that requires it? We try to be flexible if there's reasonable demand for something. HTH Alan > Hi! > > Is there an argument in the eprimer 3 to get an alternative output format? > > Something like this, which I got once from primer3 running on a server: > > PRIMER_SEQUENCE_ID=HF15E08r > SEQUENCE=GCATGTAATAATGCCAAAGCTCACAGCTGCAGTTGAATCTTGGGACCCGCGGAGCGAGAATGTACCAATCCATGTATGGGTACACCCATGGCTGCCAACTCTAGGGCAAAGGATAGATACACTGTGCCACTCTATCCGGTACAAGCTGAGTAGTGTCCTCCAATTATGGCAAGCTCACGATTCATCAGCTTATGCTGTGCTATCTCCATGGAAGGGTGTATTTGATCCAGCAAGTTGGGAAGACTTGATAGTGCGTTATATCATTCCTAAACTGAAAATGGCACTCCAGGAGTTCCAGATTAACCCAGCAAGCCAAAAGTTTGACCAGTTTAACTGGGTTATGATCTGGGCTTCTGCTGTCCCGGTACACCATATGGTCCATATGTTGGAAGTTGATTTCTTTAGCAAGTGGCAGCTGGTTTTGTACCATTGGCTGAGCTCACCAAATCCTGATTTCAATGAGATAATGAATTGGTAT > PRIMER_PRODUCT_SIZE_RANGE=500-1000 450-500 400-450 350-400 300-350 250-300 > 200-250 150-200 > PRIMER_OPT_TM=60.0 > PRIMER_MIN_TM=58.0 > PRIMER_MAX_TM=65.0 > PRIMER_MAX_DIFF_TM=3.0 > PRIMER_DNA_CONC=420 > PRIMER_NUM_RETURN=1 > PRIMER_PAIR_PENALTY=0.8691 > PRIMER_LEFT_PENALTY=0.708329 > PRIMER_RIGHT_PENALTY=0.160746 > PRIMER_LEFT_SEQUENCE=GCATGTAATAATGCCAAAGC > PRIMER_RIGHT_SEQUENCE=TTGAAATCAGGATTTGGTGA > PRIMER_LEFT=0,20 > PRIMER_RIGHT=458,20 > PRIMER_LEFT_TM=59.292 > PRIMER_RIGHT_TM=60.161 > PRIMER_LEFT_GC_PERCENT=40.000 > PRIMER_RIGHT_GC_PERCENT=35.000 > PRIMER_LEFT_SELF_ANY=7.00 > PRIMER_RIGHT_SELF_ANY=8.00 > PRIMER_LEFT_SELF_END=2.00 > PRIMER_RIGHT_SELF_END=2.00 > PRIMER_LEFT_END_STABILITY=8.5000 > PRIMER_RIGHT_END_STABILITY=7.9000 > PRIMER_PAIR_COMPL_ANY=5.00 > PRIMER_PAIR_COMPL_END=3.00 > PRIMER_PRODUCT_SIZE=459 > > Thanks in advance! > Stefanie > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > -------------- next part -------------- A non-text attachment was scrubbed... Name: ep3hack_patch.gz Type: application/x-gzip Size: 1164 bytes Desc: not available URL: From koenvanderdrift at gmail.com Wed Mar 25 13:37:11 2009 From: koenvanderdrift at gmail.com (Koen van der Drift) Date: Wed, 25 Mar 2009 13:37:11 -0400 Subject: [EMBOSS] problems installing EMBOSS on MacOSX 10.5.6 Message-ID: <5cba6b9f0903251037q19bc0942u9a33c84f8f42bd4a@mail.gmail.com> > I cannot manage to install EMBOSS 6.0 and jemboss privately, on a Mac OS X version 10.5.6.??(This is the first time I am trying to install EMBOSS.)??I have no formal computer background, so I am afraid my questions will sound naive. Hubert, Did you have a look at fink (fink.sf.net)? With this package you will be able to install emboss without worrying about all other packages you need. Let me know if you need any assistance for it. It doesn't install jemboss, though. - Koen. From sylvain.foisy at diploide.net Wed Mar 25 16:24:47 2009 From: sylvain.foisy at diploide.net (Sylvain Foisy) Date: Wed, 25 Mar 2009 16:24:47 -0400 Subject: [EMBOSS] problems installing EMBOSS on MacOSX 10.5.6 Message-ID: Hi, Ok, what you need to do is make sure that you have the developer's tools intalled on your Mac. Put the Install DVD in the machine and look for them. Make sure too that you have installed the X11 development headers. In addition, you will have to install GD. Go through this link to help you out: http://www.kenior.com/macintosh/adding-gd-library-for-mac-os-x-leopard I have installed EMBOSS on all versions of Mac OS X since 10 Public beta. When all the prerequisite are installed, it is pretty easy ;-) Good luck Sylvain =================================================================== Sylvain Foisy, Ph. D. Consultant Bio-informatique / Bioinformatics Diploide.net - TI pour la vie / IT for Life Courriel: sylvain.foisy at diploide.net Web: http://www.diploide.net Tel: (514) 893-4363 =================================================================== From sylvain.foisy at diploide.net Wed Mar 25 16:28:26 2009 From: sylvain.foisy at diploide.net (Sylvain Foisy) Date: Wed, 25 Mar 2009 16:28:26 -0400 Subject: [EMBOSS] problems installing EMBOSS on MacOSX 10.5.6 Message-ID: Hi, Actually, a better link for the GD install: http://osx.topicdesk.com/content/view/135/41/ Good luck Sylvain =================================================================== Sylvain Foisy, Ph. D. Consultant Bio-informatique / Bioinformatics Diploide.net - TI pour la vie / IT for Life Courriel: sylvain.foisy at diploide.net Web: http://www.diploide.net Tel: (514) 893-4363 =================================================================== From jfrancoe at mitre.org Wed Mar 25 16:47:20 2009 From: jfrancoe at mitre.org (Francoeur, Joseph A.) Date: Wed, 25 Mar 2009 16:47:20 -0400 Subject: [EMBOSS] meaning of "(Reversed)" in diffseq? Message-ID: <2DE2192C7939824C86330E7245F6BC00533CF23056@IMCMBX3.MITRE.ORG> Hello, I ran diffseq on 2 FASTA-formatted DNA sequence files on my local installation of EMBOSS, and I have entries in the .diffseq output file labeled as "(Reversed)". Looking at both sequences in an editor, neither of these sequence segments is reversed (the "Sequence" string in the diffseq file matches the original FASTA file). Does anyone know what is meant by this? I'm analyzing the EMBOSS source code, and it looks as though it's related to a strand feature. That's puzzling me, because my local installation has no databases installed, and it seems that this kind of information wouldn't be embedded in the FASTA file. How does diffseq determine this strand information, and how should I interpret it? Thanks, Joe --- Joseph A. Francoeur Senior Software Systems Engineer The MITRE Corporation 202 Burlington Road MS K228 Bedford, MA 01730-1420 e-mail: jfrancoe at mitre.org From andrespinzon at gmail.com Wed Mar 25 17:04:23 2009 From: andrespinzon at gmail.com (Andres Pinzon) Date: Wed, 25 Mar 2009 17:04:23 -0400 Subject: [EMBOSS] meaning of "(Reversed)" in diffseq? In-Reply-To: <2DE2192C7939824C86330E7245F6BC00533CF23056@IMCMBX3.MITRE.ORG> References: <2DE2192C7939824C86330E7245F6BC00533CF23056@IMCMBX3.MITRE.ORG> Message-ID: <8968fc7e0903251404k77b17be3o787570fad49ee10a@mail.gmail.com> I extracted this from the EMBOSS documentation, perhaps it'll help you (specially the las paragraph): "[...] Each report consists of 4 or more lines. - The first line has the name of the first sequence followed by the start and end positions of the mismatched region in that sequence, followed by the length of the mismatched region. If the mismatched region is of zero length in this sequence, then only the position of the last matching base before the mismatch is given. - If a feature of the first sequence overlaps with this mismatch region, then one or more lines starting with 'Feature:' comes next with the type, position and tag field of the feature. - Next is a line starting "Sequence:" giving the sequence of the mismatch in the first sequence. This is followed by the equivalent information for the second sequence, but in the reverse order, namely 'Sequence:' line, 'Feature:' lines and line giving the position of the mismatch in the second sequence.[...]" Best, On Wed, Mar 25, 2009 at 4:47 PM, Francoeur, Joseph A. wrote: > Hello, > > I ran diffseq on 2 FASTA-formatted DNA sequence files on my local > installation of EMBOSS, and I have entries in the .diffseq output file > labeled as "(Reversed)". Looking at both sequences in an editor, neither of > these sequence segments is reversed (the "Sequence" string in the diffseq > file matches the original FASTA file). Does anyone know what is meant by > this? I'm analyzing the EMBOSS source code, and it looks as though it's > related to a strand feature. That's puzzling me, because my local > installation has no databases installed, and it seems that this kind of > information wouldn't be embedded in the FASTA file. How does diffseq > determine this strand information, and how should I interpret it? > > Thanks, > Joe > --- > > Joseph A. Francoeur > Senior Software Systems Engineer > The MITRE Corporation > 202 Burlington Road MS K228 > Bedford, MA 01730-1420 > > e-mail: jfrancoe at mitre.org > > > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > -- Andr?s Pinz?n http://bioinf.ibun.unal.edu.co/~apinzon/ Bioinformatics Center, Colombia EMBnet node http://bioinf.ibun.unal.edu.co Tel +57 3165000 ext 16961 Fax +571 3165415 Micology and Phytopathology Laboratory - Los Andes University. http://bioinf.uniandes.edu.co Tel +571 3394949 ext. 2768 From jfrancoe at mitre.org Wed Mar 25 17:15:13 2009 From: jfrancoe at mitre.org (Francoeur, Joseph A.) Date: Wed, 25 Mar 2009 17:15:13 -0400 Subject: [EMBOSS] meaning of "(Reversed)" in diffseq? In-Reply-To: <8968fc7e0903251404k77b17be3o787570fad49ee10a@mail.gmail.com> References: <2DE2192C7939824C86330E7245F6BC00533CF23056@IMCMBX3.MITRE.ORG> <8968fc7e0903251404k77b17be3o787570fad49ee10a@mail.gmail.com> Message-ID: <2DE2192C7939824C86330E7245F6BC00533CF23066@IMCMBX3.MITRE.ORG> Thanks, Andres, but I don't think that explains it. The label "(Reversed)" only appears for selected output lines in the diffseq report. The documentation you cited just states that the reverse ordering of the lines always occurs in the report. Joe From: Andres Pinzon [mailto:andrespinzon at gmail.com] Sent: Wednesday, March 25, 2009 5:04 PM To: Francoeur, Joseph A. Cc: emboss at emboss.open-bio.org Subject: Re: [EMBOSS] meaning of "(Reversed)" in diffseq? I extracted this from the EMBOSS documentation, perhaps it'll help you (specially the las paragraph): "[...] Each report consists of 4 or more lines. * The first line has the name of the first sequence followed by the start and end positions of the mismatched region in that sequence, followed by the length of the mismatched region. If the mismatched region is of zero length in this sequence, then only the position of the last matching base before the mismatch is given. * If a feature of the first sequence overlaps with this mismatch region, then one or more lines starting with 'Feature:' comes next with the type, position and tag field of the feature. * Next is a line starting "Sequence:" giving the sequence of the mismatch in the first sequence. This is followed by the equivalent information for the second sequence, but in the reverse order, namely 'Sequence:' line, 'Feature:' lines and line giving the position of the mismatch in the second sequence.[...]" Best, On Wed, Mar 25, 2009 at 4:47 PM, Francoeur, Joseph A. > wrote: Hello, I ran diffseq on 2 FASTA-formatted DNA sequence files on my local installation of EMBOSS, and I have entries in the .diffseq output file labeled as "(Reversed)". Looking at both sequences in an editor, neither of these sequence segments is reversed (the "Sequence" string in the diffseq file matches the original FASTA file). Does anyone know what is meant by this? I'm analyzing the EMBOSS source code, and it looks as though it's related to a strand feature. That's puzzling me, because my local installation has no databases installed, and it seems that this kind of information wouldn't be embedded in the FASTA file. How does diffseq determine this strand information, and how should I interpret it? Thanks, Joe --- Joseph A. Francoeur Senior Software Systems Engineer The MITRE Corporation 202 Burlington Road MS K228 Bedford, MA 01730-1420 e-mail: jfrancoe at mitre.org> _______________________________________________ EMBOSS mailing list EMBOSS at lists.open-bio.org http://lists.open-bio.org/mailman/listinfo/emboss -- Andr?s Pinz?n http://bioinf.ibun.unal.edu.co/~apinzon/ Bioinformatics Center, Colombia EMBnet node http://bioinf.ibun.unal.edu.co Tel +57 3165000 ext 16961 Fax +571 3165415 Micology and Phytopathology Laboratory - Los Andes University. http://bioinf.uniandes.edu.co Tel +571 3394949 ext. 2768 From lueck at ipk-gatersleben.de Thu Mar 26 05:37:58 2009 From: lueck at ipk-gatersleben.de (=?iso-8859-1?Q?Stefanie_L=FCck?=) Date: Thu, 26 Mar 2009 10:37:58 +0100 Subject: [EMBOSS] Eprimer3 alternative output formats References: <009901c9ad51$40dcfaf0$1022a8c0@ipkgatersleben.de> <32838.86.9.126.186.1238002124.squirrel@webmail.ebi.ac.uk> Message-ID: <003901c9adf6$8c76b640$1022a8c0@ipkgatersleben.de> Hi Alan! Thanks a lot for the patch! I design hundrets of primers in a batch mode and want to parse it in a bit more convenient way to look at /oder the primers. In addition it's good to know all informations about the designed primers for documentation purposes. I need something like this: Thanks again and have a nice day! Stefanie ----- Original Message ----- From: To: "Stefanie L?ck" Cc: Sent: Wednesday, March 25, 2009 6:28 PM Subject: Re: [EMBOSS] Eprimer3 alternative output formats > Hello Stefanie, > > There is currently no such argument but it is a trivial thing to hack > in to the source code - the attached patch against EMBOSS-6.0.1 would do > it > by adding a '-originalformat' switch. > > As it stands, the output is provided in what was deemed a more > easily digestible format. > > Out of interest, is there a specific reason why you need the original > output format e.g. do you use a subsequent application that requires it? > We try to be flexible if there's reasonable demand for something. > > HTH > > Alan > > >> Hi! >> >> Is there an argument in the eprimer 3 to get an alternative output >> format? >> >> Something like this, which I got once from primer3 running on a server: >> >> PRIMER_SEQUENCE_ID=HF15E08r >> SEQUENCE=GCATGTAATAATGCCAAAGCTCACAGCTGCAGTTGAATCTTGGGACCCGCGGAGCGAGAATGTACCAATCCATGTATGGGTACACCCATGGCTGCCAACTCTAGGGCAAAGGATAGATACACTGTGCCACTCTATCCGGTACAAGCTGAGTAGTGTCCTCCAATTATGGCAAGCTCACGATTCATCAGCTTATGCTGTGCTATCTCCATGGAAGGGTGTATTTGATCCAGCAAGTTGGGAAGACTTGATAGTGCGTTATATCATTCCTAAACTGAAAATGGCACTCCAGGAGTTCCAGATTAACCCAGCAAGCCAAAAGTTTGACCAGTTTAACTGGGTTATGATCTGGGCTTCTGCTGTCCCGGTACACCATATGGTCCATATGTTGGAAGTTGATTTCTTTAGCAAGTGGCAGCTGGTTTTGTACCATTGGCTGAGCTCACCAAATCCTGATTTCAATGAGATAATGAATTGGTAT >> PRIMER_PRODUCT_SIZE_RANGE=500-1000 450-500 400-450 350-400 300-350 >> 250-300 >> 200-250 150-200 >> PRIMER_OPT_TM=60.0 >> PRIMER_MIN_TM=58.0 >> PRIMER_MAX_TM=65.0 >> PRIMER_MAX_DIFF_TM=3.0 >> PRIMER_DNA_CONC=420 >> PRIMER_NUM_RETURN=1 >> PRIMER_PAIR_PENALTY=0.8691 >> PRIMER_LEFT_PENALTY=0.708329 >> PRIMER_RIGHT_PENALTY=0.160746 >> PRIMER_LEFT_SEQUENCE=GCATGTAATAATGCCAAAGC >> PRIMER_RIGHT_SEQUENCE=TTGAAATCAGGATTTGGTGA >> PRIMER_LEFT=0,20 >> PRIMER_RIGHT=458,20 >> PRIMER_LEFT_TM=59.292 >> PRIMER_RIGHT_TM=60.161 >> PRIMER_LEFT_GC_PERCENT=40.000 >> PRIMER_RIGHT_GC_PERCENT=35.000 >> PRIMER_LEFT_SELF_ANY=7.00 >> PRIMER_RIGHT_SELF_ANY=8.00 >> PRIMER_LEFT_SELF_END=2.00 >> PRIMER_RIGHT_SELF_END=2.00 >> PRIMER_LEFT_END_STABILITY=8.5000 >> PRIMER_RIGHT_END_STABILITY=7.9000 >> PRIMER_PAIR_COMPL_ANY=5.00 >> PRIMER_PAIR_COMPL_END=3.00 >> PRIMER_PRODUCT_SIZE=459 >> >> Thanks in advance! >> Stefanie >> _______________________________________________ >> EMBOSS mailing list >> EMBOSS at lists.open-bio.org >> http://lists.open-bio.org/mailman/listinfo/emboss >> > From ajb at ebi.ac.uk Thu Mar 26 13:59:36 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Thu, 26 Mar 2009 17:59:36 -0000 (GMT) Subject: [EMBOSS] meaning of "(Reversed)" in diffseq? In-Reply-To: <2DE2192C7939824C86330E7245F6BC00533CF23056@IMCMBX3.MITRE.ORG> References: <2DE2192C7939824C86330E7245F6BC00533CF23056@IMCMBX3.MITRE.ORG> Message-ID: <52110.86.9.126.186.1238090376.squirrel@webmail.ebi.ac.uk> Hello Joe, Interesting. I'm not entirely convinced it's intentional either, if so then the documentation probably needs a little work. To answer your question, diffseq holds the differences internally by storing them in a feature table. The features within this table are added using feature constructors. If some of these feature constructors are given a start position in the sequence that is greater than the end position then they will mark the strand of the feature as being '-'. If the diffseq report format output sees a strand marked as '-' then it will print (Reversed). Owing to internal representations of differences in diffseq (for example a start>end can be a convenient way of representing a gap) you'll get a '(Reversed)' feature report appearing if the second sequence has an insertion at that point. Diffseq will generally then show the last couple of residues of the first sequence and then the insertion in the second sequence. We're depleted a little by holidays here but I'll raise the issue of whether this is intentional and/or the best way of representing/documenting this when we're quorate again (though you may well get another response before then depending on the order holiday email is dealt with). HTH Alan > Hello, > > I ran diffseq on 2 FASTA-formatted DNA sequence files on my local > installation of EMBOSS, and I have entries in the .diffseq output file > labeled as "(Reversed)". Looking at both sequences in an editor, neither > of these sequence segments is reversed (the "Sequence" string in the > diffseq file matches the original FASTA file). Does anyone know what is > meant by this? I'm analyzing the EMBOSS source code, and it looks as > though it's related to a strand feature. That's puzzling me, because my > local installation has no databases installed, and it seems that this kind > of information wouldn't be embedded in the FASTA file. How does diffseq > determine this strand information, and how should I interpret it? > > Thanks, > Joe > --- > > Joseph A. Francoeur > Senior Software Systems Engineer > The MITRE Corporation > 202 Burlington Road MS K228 > Bedford, MA 01730-1420 > > e-mail: jfrancoe at mitre.org > > > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > From pmiguel at purdue.edu Fri Mar 27 15:30:15 2009 From: pmiguel at purdue.edu (Phillip San Miguel) Date: Fri, 27 Mar 2009 15:30:15 -0400 Subject: [EMBOSS] How to turn off GFF file creation in wordmatch? Message-ID: <49CD2947.60802@purdue.edu> I'm running wordmatch from EMBOSS v 5.0.0. In the manual for wordmatch it is said: This program takes two sequences and finds regions where they are identical. These regions are reported in the output file (and optionally) in GFF (Gene Feature Format) files. I would like wordmatch not to create the (optional) .gff files. But they are created by default and I don't see a means to prevent this. Any ideas? Thanks, Phillip Purdue Genomics Core Facilty From ajb at ebi.ac.uk Fri Mar 27 16:26:16 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Fri, 27 Mar 2009 20:26:16 -0000 (GMT) Subject: [EMBOSS] How to turn off GFF file creation in wordmatch? In-Reply-To: <49CD2947.60802@purdue.edu> References: <49CD2947.60802@purdue.edu> Message-ID: <53744.86.9.126.186.1238185576.squirrel@webmail.ebi.ac.uk> Hello Phillip, Yes, the documentation does incorrectly describe the GFF files as optional. Thanks for spotting that. Assuming you're on a UNIX system of some type you could give the filename /dev/null for both the gff output files. HTH Alan > I'm running wordmatch from EMBOSS v 5.0.0. In the manual for wordmatch > it is said: > > This program takes two sequences and finds regions where they are > identical. These regions are reported in the output file (and > optionally) in GFF (Gene Feature Format) files. > > > I would like wordmatch not to create the (optional) .gff files. But they > are created by default and I don't see a means to prevent this. Any ideas? > > Thanks, > Phillip > Purdue Genomics Core Facilty > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > From d.leader at bio.gla.ac.uk Sat Mar 28 15:07:03 2009 From: d.leader at bio.gla.ac.uk (David Leader) Date: Sat, 28 Mar 2009 19:07:03 +0000 Subject: [EMBOSS] Png problem on Mac OS 10.5 Message-ID: I have installed Emboss v.5 successfully on several different G4 Macs running OS X 10.4, as well as on a Sun box running Solaris, so, although not a unix-head I am not a novice. I have just got round to installing unix software on a 64-bit Intel iMac running the latest 10.5.x on which I had already used MacPorts to install the various graphics libraries (including libpng) needed to run GD in Perl. This is runnning fine so the libpng library is properly installed. I did an install of Emboss v.6 on the machine and all seemed to proceed fine - configure, make and make install, and the programs run. (I also installed the emboss explorer package and they run from this.) However, although the programs run OK, I get an error message when I select png graphics, to the effect that png isn't an option - the available options being listed. However PostScript graphics work ok. Unless there is a problem with v.6 of Emboss and the Mac, I suspect it may be a 32-bit/64-bit problem. It is known, for example, (and I know from personal experience), that if you install the pre-compiled 64-bit version of MySQL then the Perl drivers don't work because the Perl that comes on Mac OS X 10.5 is 32-bit. For similar reasons one is advised to use 32-bit versions of PHP. So, could it be that Emboss has compiled in a 64-bit version, which is incompatible with the libpng library? If so, is there any way I can recompile Emboss forcing it into a 32-bit version? David PS Apologies if this is a known problem. I have just joined the list and don't see a search function. _______________________________________________________________ Dr. David P. Leader, Faculty of Biomedical & Life Sciences, University of Glasgow, Glasgow G12 8QQ, UK Phone: +44 (0)141 330 5905 http://doolittle.ibls.gla.ac.uk/leader The University of Glasgow, charity number SC004401 _______________________________________________________________ From moldoverb at gmail.com Mon Mar 30 14:12:56 2009 From: moldoverb at gmail.com (Brian Moldover) Date: Mon, 30 Mar 2009 14:12:56 -0400 Subject: [EMBOSS] formatting databases Message-ID: <005d01c9b163$27a01110$76e03330$@com> Hi All, Just finished setting up the EMBOSS software. Now I'm trying to install databases locally and finding it to be a bit more work. I downloaded part of EMBL (rel_con_*) and trying to index with dbiflat. I get an error message "rel_con_mam_01_r99 too large for DBI indexing". Still not entirely sure what I'm doing regarding getting databases up and running which I why I started with a subset of EMBL. Suggestions? - Brian From pmr at ebi.ac.uk Tue Mar 31 07:44:10 2009 From: pmr at ebi.ac.uk (Peter Rice) Date: Tue, 31 Mar 2009 12:44:10 +0100 Subject: [EMBOSS] formatting databases In-Reply-To: <005d01c9b163$27a01110$76e03330$@com> References: <005d01c9b163$27a01110$76e03330$@com> Message-ID: <49D2020A.1020604@ebi.ac.uk> Brian Moldover wrote: > Just finished setting up the EMBOSS software. Now I'm trying to install > databases locally and finding it to be a bit more work. I downloaded part of > EMBL (rel_con_*) and trying to index with dbiflat. I get an error message > "rel_con_mam_01_r99 too large for DBI indexing". Sadly this does happen for occasional EMBL or GenBank releasees. The files are supposed to stay within a 2Gb size limit. There is a scripts/emblsplit.pl file included in the EMBOSS distribution that will split a file at 1,900,000,000 bytes. You need to clean up the original file after running it. The 2Gb limit could be increased to 4Gb at the risk of breaking some third party applications (Staden, Sanger efetch). We could change for the next release to issue a warning if the file size is between 2Gb and 4Gb as the index file has enough space to store the 4Gb file pointers. Are other users interested in allowing this? > Still not entirely sure what I'm doing regarding getting databases up and > running which I why I started with a subset of EMBL. Suggestions? If you do not need to process the whole database you can also use remote access to fetch single entries on demand. This saves you doing any database indexing. You can also use the dbx indexing programs which support larger files. regards, Peter Rice From georgios at biotek.uio.no Tue Mar 31 07:49:28 2009 From: georgios at biotek.uio.no (George Magklaras) Date: Tue, 31 Mar 2009 13:49:28 +0200 Subject: [EMBOSS] formatting databases In-Reply-To: <005d01c9b163$27a01110$76e03330$@com> References: <005d01c9b163$27a01110$76e03330$@com> Message-ID: <49D20348.8040807@biotek.uio.no> Hi Brian, Use dbxflat for formatting databases. The 'dbiflat' app is old and has file size limits. dbxflat has no such limits. For more info: http://www.no.embnet.org/html/dbxflat.html -- GM http://www.no.embnet.org Brian Moldover wrote: > Hi All, > > > > Just finished setting up the EMBOSS software. Now I'm trying to install > databases locally and finding it to be a bit more work. I downloaded part of > EMBL (rel_con_*) and trying to index with dbiflat. I get an error message > "rel_con_mam_01_r99 too large for DBI indexing". > > > > Still not entirely sure what I'm doing regarding getting databases up and > running which I why I started with a subset of EMBL. Suggestions? > > > > - Brian > > > > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > From ggeca at bas.bg Tue Mar 31 14:25:04 2009 From: ggeca at bas.bg (ggeca at bas.bg) Date: Tue, 31 Mar 2009 21:25:04 +0300 (EEST) Subject: [EMBOSS] (no subject) Message-ID: Hi, We have stumbled upon a dead end situation in an attempt to build EMBOSS 6.01 without X support (SUSE 10 64-bit platform). Appreciation goes for any advice, geca, bas From ajb at ebi.ac.uk Tue Mar 31 15:13:07 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Tue, 31 Mar 2009 20:13:07 +0100 (BST) Subject: [EMBOSS] Without X query. was: (no subject) In-Reply-To: References: Message-ID: <57240.86.9.126.186.1238526787.squirrel@webmail.ebi.ac.uk> This thread may be of help. http://lists.open-bio.org/pipermail/emboss/2009-March/003538.html Basically edit the plpliot/plDevs.h file as described and then configure using the --without-x switch. This has been fixed for the next release. THT Alan > Hi, > > We have stumbled upon a dead end situation in an attempt to build EMBOSS > 6.01 > without X support (SUSE 10 64-bit platform). > > Appreciation goes for any advice, > > geca, > bas > > > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > From moldoverb at gmail.com Tue Mar 31 16:17:58 2009 From: moldoverb at gmail.com (Brian Moldover) Date: Tue, 31 Mar 2009 16:17:58 -0400 Subject: [EMBOSS] wEMBOSS Message-ID: <006001c9b23d$ca0404e0$5e0c0ea0$@com> I'm back J Hopefully someone can answer this one. I've set up wEMBOSS, and now I receive this message when I try and access the web interface: error, catch: Sorry, the owner of this process is not allowed to run catch program, ask wEMBOSS manager! - Brian From ajb at ebi.ac.uk Tue Mar 31 18:03:56 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Tue, 31 Mar 2009 23:03:56 +0100 (BST) Subject: [EMBOSS] Without X query. was: (no subject) In-Reply-To: <520894aa0903311302o34c56d83l2d6628a8f8c56ff@mail.gmail.com> References: <57240.86.9.126.186.1238526787.squirrel@webmail.ebi.ac.uk> <520894aa0903311302o34c56d83l2d6628a8f8c56ff@mail.gmail.com> Message-ID: <33171.86.9.126.186.1238537036.squirrel@webmail.ebi.ac.uk> Hello Fernan, I'm not sure I see your problem. To compile with X11 support you neither edit the file nor add the --without-x switch. The next release will allow you to control whether X11 is activated or not by using the switch alone i.e. there will be no need to edit the file. It has been the case in the past that people with servers do want to completely deactivate X11 and I understood that to be what you required. If your original meaning was that X11 wouldn't compile and you wanted X11 support then the mention of --without-x in the original query was perhaps the cause of misunderstanding. The cause of X11 not compiling, with the kind of error you described, is usually because the X11 libraries have been installed but not the X11 development (header files). After they have been installed then you need to perform the configuration step again and 'make clean' As the latter problem is becoming asked more frequently I've altered the configuration for the next release such that, if you haven't deselected X11 and if the X11 headers are missing then the configuration process will terminate with a helpful message. Please feel free to contact me off-list if you do require X11 and continue to have problems compiling EMBOSS on FreeBSD. HTH Alan > On Tue, Mar 31, 2009 at 9:13 PM, wrote: >> This thread may be of help. >> >> http://lists.open-bio.org/pipermail/emboss/2009-March/003538.html >> >> Basically edit the plpliot/plDevs.h file as described and then >> configure using the --without-x switch. > > I have tried this in FreeBSD and we're stuck in a dead-end situation. > Commenting out that line and using --without-x works. But now, when we > compile emboss without using '--without-x' ... everything builds fine > but then we don't have x11 (vga) output in graphic programs (plotorf). > > Now there is now way to get emboss with X11 graphical output anymore! > > Fernan > >> This has been fixed for the next release. >> >> THT >> >> Alan >> >> >> >>> Hi, >>> >>> We have stumbled upon a dead end situation in an attempt to build >>> EMBOSS >>> 6.01 >>> without X support (SUSE 10 64-bit platform). >>> >>> Appreciation goes for any advice, >>> >>> geca, >>> bas >>> >>> >>> _______________________________________________ >>> EMBOSS mailing list >>> EMBOSS at lists.open-bio.org >>> http://lists.open-bio.org/mailman/listinfo/emboss >>> >> >> >> _______________________________________________ >> EMBOSS mailing list >> EMBOSS at lists.open-bio.org >> http://lists.open-bio.org/mailman/listinfo/emboss >> >> > > > > -- > fernan > From maoj at helix.nih.gov Mon Mar 2 17:06:22 2009 From: maoj at helix.nih.gov (jean mao) Date: Mon, 2 Mar 2009 12:06:22 -0500 (EST) Subject: [EMBOSS] Error in EMMA Message-ID: Hi, The version of EMBOSS I am using is 4.0.0. I received an error from 'EMMA'. I will appreciate if someone can help me with this: Error: Failed to open filename '00028079B' Problem writing out EMBOSS alignment file CLUSTAL 2.0.9 Multiple Sequence Alignments Error: parameter required for /dnamatrix Under our .../htdocs/emboss/output/955836 are files: total 8 -rw-r--r-- 1 webcpu webcpu 2121 Mar 2 09:18 00028079A -rw-r--r-- 1 webcpu webcpu 0 Mar 2 09:18 dendoutfile -rw-r--r-- 1 webcpu webcpu 3999 Mar 2 09:18 index.html -rw-r--r-- 1 webcpu webcpu 0 Mar 2 09:18 outseq The sequences I used is at the bottom of this message. I did some googling on this and found someone suggested to modify emma.c file to : dna_matrix = ajAcdGetListSingle( "dnamatrix"); m2c = ajStrGetCharFirst(dna_matrix); if(m2c=='i') ajStrAssignC(&m2str,"iub"); else if(m2c=='c') ajStrAssignC(&m2str,"clustalw"); else if(m2c=='o') ajStrAssignC(&m2str,"own"); I did that but still got the same error. Could someone help me with this? Thank you very much. Jean Mao >gyrAprobe ttccgcagtttacgacaccatcgtccgtat >gyrA atgaccgacgcaaccatccgccacgaccacaaattcgccctcgaaaccctgcccgtcagc cttgaagacgaaatgcgcaaaagctatctcgactacgccatgagcgtcattgtcgggcgc gcgctgccggacgttcgcgacggcctaaagccggtgcaccggcgcgtactgtacgcgatg cacgagctgaaaaataactggaatgccgcctacaaaaaatcggcgcgcatcgtcggcgac gtcatcggtaaataccacccccacggcgattccgcagtttacgacaccatcgtccgtatg gcgcaaaatttcgctatgcgttatgtgctgatagacggacagggcaacttcggatcggtg gacgggcttgccgccgcagccatgcgctataccgaaatccgcatggcgaaaatctcacat gaaatgctggcagacattgaggaagaaaccgttaatttcggcccgaactacgacggtagc gaacacgagccgcttgtactgccgacccgtttccccacactgctcgtcaacggctcgtcc ggtatcgccgtcggtatggcgaccaacatcccgccgcacaacctcaccgacaccatcaac gcctgtctgcgtcttttggacgaacccaaaaccgaaatcgacgaactgatcgacattatc caagcccccgacttcccgaccggggcaaccatctacggcttgggcggcgtgcgcgaaggc tataaaacaggccgcggccgcgttgttatgcgcggtaagacccatatcgaacccataggc aaaaacggcgaacgcgaacgcatcgttatcgacgaaatcccctatcaggtcaacaaagcc >gyrANM atgaccgacgcaaccatccgccacgaccacaaattcgccctcgaaaccctgccggtaagc cttgaagacgaaatgcgcaaaagctatctcgactacgccatgagcgtcattgtcgggcgc gcgctgccggacgttcgcgacggtctcaagccggtacaccgccgcgtactgtacgcgatg cacgagctgaaaaacaactggaatgccgcctacaaaaaatcggcgcgcattgtcggcgac gtcatcggtaaataccacccccacggcgataccgccgtatacgacaccatcgtccgtatg gcgcaaaatttcgctatgcgttatgtgctgatagacggacagggcaacttcggatcggtg gacgggcttgccgccgcagccatgcgctacaccgaaatccgcatggcgaaaatttcccac gaaatgctggcagacattgaggaagaaaccgtcaatttcggcccgaactacgacggtagc gaacacgagccgcttgtactgccgacccgtttccccacactgctcgtcaacggctcgtcc ggcatcgccgtcggcatggcgaccaatatcccgccgcacaacctttctgataccgtcaat gcctgcctgcgcctgctcgatgcacccgacaccgaaatcgacgaactgatcgacattatc caagcccccgacttcccgaccggggcaaccatctacggcttgagcggcgtgcgcgaaggc tataaaacaggccgcggccgcgtcgttatgcgcggtaagacccatatcgaacccataggc agaaacggcgaacgcgaagccatcgttatcgacgaaatcccctatcaggtcaacaaagcc >gyrA338rt gccctcgaaaccctgccggtaagccttgaagacgaaatgcgcaaaagctatctcgactac gccatgagcgtcattgtcgggcgcgcgctgccggacgttcgcgacggtctcaagccggta caccgccgcgtactgtacgcgatgcacgaattgaaaaacaactggaatgccgcctacaaa aaatcggcacgcatcgtcggcgacgtcatcggtaaataccacccccacggcgataccgcc gtatacgacaccatcgtccgtatggcacaaaatttcgctatgcgttatgtgctgatagac ggacagggcaacttcggatcggtggacgggctgccgccgc From georgios at biotek.uio.no Tue Mar 3 10:49:22 2009 From: georgios at biotek.uio.no (George Magklaras) Date: Tue, 03 Mar 2009 11:49:22 +0100 Subject: [EMBOSS] Error in EMMA In-Reply-To: References: Message-ID: <49AD0B32.4020009@biotek.uio.no> Hi, I am under the impression that the version of emboss you are using (4) is designed to interface to version 1.8x of clustalw and hence there could be difficulties. I think the interface to clustal 2.0.x series was addressed in a latter version of EMBOSS (5 or perhaps 6). On my EMBOSS version 6.0.1 server, I ran this against clustalw 2.0.10 flawlessly (files attached). So, I suggest that you either: i)Upgrade to EMBOSS 6.0.1 ii)try to run emboss 4.0.0 emma with clustalw 1.8x . Obviously i) is better than ii). GM -- -- George Magklaras BSc Hons MPhil RHCE:805008309135525 Senior Computer Systems Engineer/UNIX-Linux Systems Administrator EMBnet Technical Management Board The Biotechnology Centre of Oslo, University of Oslo http://www.no.embnet.org jean mao wrote: > Hi, > The version of EMBOSS I am using is 4.0.0. I received an error from > 'EMMA'. I will appreciate if someone can help me with this: > > Error: Failed to open filename '00028079B' > Problem writing out EMBOSS alignment file > > CLUSTAL 2.0.9 Multiple Sequence Alignments > Error: parameter required for /dnamatrix > > Under our .../htdocs/emboss/output/955836 > are files: > > total 8 > -rw-r--r-- 1 webcpu webcpu 2121 Mar 2 09:18 00028079A > -rw-r--r-- 1 webcpu webcpu 0 Mar 2 09:18 dendoutfile > -rw-r--r-- 1 webcpu webcpu 3999 Mar 2 09:18 index.html > -rw-r--r-- 1 webcpu webcpu 0 Mar 2 09:18 outseq > > The sequences I used is at the bottom of this message. > > I did some googling on this and found someone suggested to modify emma.c > file to : > dna_matrix = ajAcdGetListSingle( "dnamatrix"); > m2c = ajStrGetCharFirst(dna_matrix); > > if(m2c=='i') > ajStrAssignC(&m2str,"iub"); > else if(m2c=='c') > ajStrAssignC(&m2str,"clustalw"); > else if(m2c=='o') > ajStrAssignC(&m2str,"own"); > > I did that but still got the same error. > > Could someone help me with this? Thank you very much. > > Jean Mao > >> gyrAprobe > ttccgcagtttacgacaccatcgtccgtat >> gyrA > atgaccgacgcaaccatccgccacgaccacaaattcgccctcgaaaccctgcccgtcagc > cttgaagacgaaatgcgcaaaagctatctcgactacgccatgagcgtcattgtcgggcgc > gcgctgccggacgttcgcgacggcctaaagccggtgcaccggcgcgtactgtacgcgatg > cacgagctgaaaaataactggaatgccgcctacaaaaaatcggcgcgcatcgtcggcgac > gtcatcggtaaataccacccccacggcgattccgcagtttacgacaccatcgtccgtatg > gcgcaaaatttcgctatgcgttatgtgctgatagacggacagggcaacttcggatcggtg > gacgggcttgccgccgcagccatgcgctataccgaaatccgcatggcgaaaatctcacat > gaaatgctggcagacattgaggaagaaaccgttaatttcggcccgaactacgacggtagc > gaacacgagccgcttgtactgccgacccgtttccccacactgctcgtcaacggctcgtcc > ggtatcgccgtcggtatggcgaccaacatcccgccgcacaacctcaccgacaccatcaac > gcctgtctgcgtcttttggacgaacccaaaaccgaaatcgacgaactgatcgacattatc > caagcccccgacttcccgaccggggcaaccatctacggcttgggcggcgtgcgcgaaggc > tataaaacaggccgcggccgcgttgttatgcgcggtaagacccatatcgaacccataggc > aaaaacggcgaacgcgaacgcatcgttatcgacgaaatcccctatcaggtcaacaaagcc >> gyrANM > atgaccgacgcaaccatccgccacgaccacaaattcgccctcgaaaccctgccggtaagc > cttgaagacgaaatgcgcaaaagctatctcgactacgccatgagcgtcattgtcgggcgc > gcgctgccggacgttcgcgacggtctcaagccggtacaccgccgcgtactgtacgcgatg > cacgagctgaaaaacaactggaatgccgcctacaaaaaatcggcgcgcattgtcggcgac > gtcatcggtaaataccacccccacggcgataccgccgtatacgacaccatcgtccgtatg > gcgcaaaatttcgctatgcgttatgtgctgatagacggacagggcaacttcggatcggtg > gacgggcttgccgccgcagccatgcgctacaccgaaatccgcatggcgaaaatttcccac > gaaatgctggcagacattgaggaagaaaccgtcaatttcggcccgaactacgacggtagc > gaacacgagccgcttgtactgccgacccgtttccccacactgctcgtcaacggctcgtcc > ggcatcgccgtcggcatggcgaccaatatcccgccgcacaacctttctgataccgtcaat > gcctgcctgcgcctgctcgatgcacccgacaccgaaatcgacgaactgatcgacattatc > caagcccccgacttcccgaccggggcaaccatctacggcttgagcggcgtgcgcgaaggc > tataaaacaggccgcggccgcgtcgttatgcgcggtaagacccatatcgaacccataggc > agaaacggcgaacgcgaagccatcgttatcgacgaaatcccctatcaggtcaacaaagcc >> gyrA338rt > gccctcgaaaccctgccggtaagccttgaagacgaaatgcgcaaaagctatctcgactac > gccatgagcgtcattgtcgggcgcgcgctgccggacgttcgcgacggtctcaagccggta > caccgccgcgtactgtacgcgatgcacgaattgaaaaacaactggaatgccgcctacaaa > aaatcggcacgcatcgtcggcgacgtcatcggtaaataccacccccacggcgataccgcc > gtatacgacaccatcgtccgtatggcacaaaatttcgctatgcgttatgtgctgatagac > ggacagggcaacttcggatcggtggacgggctgccgccgc > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > -------------- next part -------------- An embedded and charset-unspecified text was scrubbed... Name: gyraprobe.dnd URL: -------------- next part -------------- An embedded and charset-unspecified text was scrubbed... Name: gyraprobe.aln URL: From uludag at ebi.ac.uk Tue Mar 3 12:10:24 2009 From: uludag at ebi.ac.uk (Mahmut Uludag) Date: Tue, 03 Mar 2009 12:10:24 +0000 Subject: [EMBOSS] Error in EMMA In-Reply-To: References: Message-ID: <1236082224.24851.7.camel@emboss2.ebi.ac.uk> Hi, > I did some googling on this and found someone suggested to modify emma.c > file > to : > dna_matrix = ajAcdGetListSingle( "dnamatrix"); > m2c = ajStrGetCharFirst(dna_matrix); > > if(m2c=='i') > ajStrAssignC(&m2str,"iub"); > else if(m2c=='c') > ajStrAssignC(&m2str,"clustalw"); > else if(m2c=='o') > ajStrAssignC(&m2str,"own"); > > I did that but still got the same error. After the above changes made I'm able to use clustalw-2.0.7 with EMBOSS-4.1.0. Regards, Mahmut From jeedward at yahoo.com Sun Mar 8 11:04:43 2009 From: jeedward at yahoo.com (John Edward) Date: Sun, 8 Mar 2009 04:04:43 -0700 (PDT) Subject: [EMBOSS] Draft paper submission is extended (will not be extended further): BCBGC-09 Message-ID: <575752.17388.qm@web45904.mail.sp1.yahoo.com> Draft paper submission is extended (will not be extended further): BCBGC-09 ? ? *Apologies if you receive multiple copies of this email. Please forward to interested people.* ? The deadline for draft paper submission at the 2009 International Conference on Bioinformatics, Computational Biology, Genomics and Chemoinformatics (BCBGC-09) (website: http://www.PromoteResearch.org ) is extended due to numerous requests from the authors. The conference will be held during July 13-16 2009 in Orlando, FL, USA. We invite draft paper submissions. The conference will take place at the same time and venue where several other international conferences are taking place. The other conferences include: ????????? International Conference on Artificial Intelligence and Pattern Recognition (AIPR-09) ????????? International Conference on Automation, Robotics and Control Systems (ARCS-09) ????????? International Conference on Enterprise Information Systems and Web Technologies (EISWT-09) ????????? International Conference on High Performance Computing, Networking and Communication Systems (HPCNCS-09) ????????? International Conference on Information Security and Privacy (ISP-09) ????????? International Conference on Recent Advances in Information Technology and Applications (RAITA-09) ????????? International Conference on Software Engineering Theory and Practice (SETP-09) ????????? International Conference on Theory and Applications of Computational Science (TACS-09) ????????? International Conference on Theoretical and Mathematical Foundations of Computer Science (TMFCS-09) ? The website http://www.PromoteResearch.org contains more details. ? Sincerely John Edward Publicity committee ? ? From mmiller at sdsc.edu Mon Mar 9 15:33:31 2009 From: mmiller at sdsc.edu (Mark Miller) Date: Mon, 9 Mar 2009 08:33:31 -0700 Subject: [EMBOSS] epestfind In-Reply-To: References: <492D621D.6050104@umdnj.edu> Message-ID: <4826ED3C5DF4664C8C2B222B0DDCD12FFD49C1@et.ad.sdsc.edu> Hi all, I am implementing epestfind for my users. I am having trouble making some of the flags work, and wonder if they are vestigial: persisting in the manual but no longer in the code. I looked in the changelog, but don't see anything relevant. Specifically, 1. I cannot find a way to make the sequence modifier -snucleotide1 work. Does the program really accept DNA sequences as input? (I don't see this option in other online portals) 2. for the graph labels, the "subtitle" flag places subtitle text strings in postscript and png files, but the others (xtitle, ytitle, and gtitle) do not. (I see this behavior in other online portals as well: the entry form is there, but it does not produce the promised result). Any advice most appreciated.... Mark From gbottu at vub.ac.be Thu Mar 12 15:41:08 2009 From: gbottu at vub.ac.be (Guy Bottu) Date: Thu, 12 Mar 2009 16:41:08 +0100 Subject: [EMBOSS] MSE blues Message-ID: <49B92D14.2070304@vub.ac.be> Dear friends, I had not used MSE for a long time. I recently discovered that with the most recent versions of some terminal emulation software, like TeraTerm-SSH, MSE does not function properly : it is not possible to delete bases/amino acids by pressing the "Delete" key of the PC, presumably because the character is not relayed properly to the distant computer running EMBOSS. Could the EMBOSS development team mend this by extending the list of characters recognized as a "delete" ? Or do you consider that it is not worth spending effort on MSE ? Regards, Guy Bottu, BEN From andrespinzon at gmail.com Fri Mar 13 00:13:15 2009 From: andrespinzon at gmail.com (Andres Pinzon) Date: Thu, 12 Mar 2009 20:13:15 -0400 Subject: [EMBOSS] recursive backtranslate Message-ID: <8968fc7e0903121713n5b049caby6ee1fc4d55262a0b@mail.gmail.com> Hi everyone, Is it possible to give backtranseq a muliple fasta file as input and have all the sequences in it translated? I have tried several times but backtranseq backtranslates just the first sequence of my multiple fasta file. best, -- Andr?s Pinz?n http://bioinf.ibun.unal.edu.co/~apinzon/ Bioinformatics Center, Colombia EMBnet node http://bioinf.ibun.unal.edu.co Tel +57 3165000 ext 16961 Fax +571 3165415 Micology and Phytopathology Laboratory - Los Andes University. http://bioinf.uniandes.edu.co Tel +571 3394949 ext. 2768 From david.bauer at bayerhealthcare.com Fri Mar 13 06:41:23 2009 From: david.bauer at bayerhealthcare.com (david.bauer at bayerhealthcare.com) Date: Fri, 13 Mar 2009 07:41:23 +0100 Subject: [EMBOSS] recursive backtranslate In-Reply-To: <8968fc7e0903121713n5b049caby6ee1fc4d55262a0b@mail.gmail.com> Message-ID: Hi Andr?s, it just takes one sequence as input. Btw. you can see this if you look what the emboss programs say with -help. > backtranseq -help Standard (Mandatory) qualifiers: [-sequence] sequence (Gapped) protein sequence filename and optional format, or reference (input USA) If it says "sequence" than it takes just one sequence as input. > infoseq -help Standard (Mandatory) qualifiers: [-sequence] seqall (Gapped) sequence(s) filename and optional format, or reference (input USA) If you see "seqall" than the program can work on more than one sequence. For your problem you can either use "seqretsplit" to split up our file into individual sequences or you can write a script which iterates through the multiple fasta file with "skipseq" and sends its output to backtranseq. Cheers, David. emboss-bounces at lists.open-bio.org schrieb am 13/03/2009 01:13:15: > Hi everyone, > Is it possible to give backtranseq a muliple fasta file as input and > have all the sequences in it translated? > I have tried several times but backtranseq backtranslates just the > first sequence of my multiple fasta file. > > best, > > -- > Andr?s Pinz?n > http://bioinf.ibun.unal.edu.co/~apinzon/ > Bioinformatics Center, Colombia EMBnet node > http://bioinf.ibun.unal.edu.co > Tel +57 3165000 ext 16961 Fax +571 3165415 > Micology and Phytopathology Laboratory - Los Andes University. > http://bioinf.uniandes.edu.co > Tel +571 3394949 ext. 2768 > > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss From stephen.taylor at imm.ox.ac.uk Fri Mar 13 08:09:06 2009 From: stephen.taylor at imm.ox.ac.uk (Steve Taylor) Date: Fri, 13 Mar 2009 08:09:06 +0000 Subject: [EMBOSS] fuzzpro oddity Message-ID: <49BA14A2.5060400@imm.ox.ac.uk> Hi, I have an odd problem. I am trying to search a multi-fasta set of proteins. If I do: fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXXW -stdout -auto I get: Error: Sequence is not a protein fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXX -stdout -auto returns results. Any thoughts why? Is this a cryptic way of saying it can't find the motif or some other problem? I have tried this on Solaris 9 EMBOSS version 3.0 and Linux FC8 EMBOSS 6.0 and both give the same responses. Thanks for any help, Steve ------------------------------------------------------------------ Medical Sciences Division Weatherall Institute of Molecular Medicine/Sir William Dunn School Oxford University From pmr at ebi.ac.uk Fri Mar 13 09:30:35 2009 From: pmr at ebi.ac.uk (Peter Rice) Date: Fri, 13 Mar 2009 09:30:35 +0000 Subject: [EMBOSS] recursive backtranslate In-Reply-To: References: Message-ID: <49BA27BB.6010304@ebi.ac.uk> david.bauer at bayerhealthcare.com wrote: emboss-bounces at lists.open-bio.org schrieb am 13/03/2009 01:13:15: > > Is it possible to give backtranseq a muliple fasta file as input and > > have all the sequences in it translated? > > I have tried several times but backtranseq backtranslates just the > > first sequence of my multiple fasta file. > > it just takes one sequence as input. > > For your problem you can either use "seqretsplit" to split up our file > into individual sequences or you can write a script which iterates through > the multiple fasta file with "skipseq" and sends its output to > backtranseq. We have already extended backtranseq for the next release to work over multiple sequences. The changes needed are not difficult if you want to try a little programming. regards, Peter Rice From pmr at ebi.ac.uk Fri Mar 13 09:51:27 2009 From: pmr at ebi.ac.uk (Peter Rice) Date: Fri, 13 Mar 2009 09:51:27 +0000 Subject: [EMBOSS] fuzzpro oddity In-Reply-To: <49BA14A2.5060400@imm.ox.ac.uk> References: <49BA14A2.5060400@imm.ox.ac.uk> Message-ID: <49BA2C9F.5030802@ebi.ac.uk> Steve Taylor wrote: > Hi, > > I have an odd problem. I am trying to search a multi-fasta set of > proteins. If I do: > > fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXXW > -stdout -auto > > I get: > > Error: Sequence is not a protein > > I have tried this on Solaris 9 EMBOSS version 3.0 and Linux FC8 EMBOSS > 6.0 and both give the same responses. We have never seen a report like this before, but we believe you if it happens in version 6 and version 3 ! The message should only come from reading an input sequence from invertebrate.protein.faa and that part should be the same in both cases. Can you please send the invertebrate.protein.faa file to emboss-bug at emboss.open-bio.org You have aroused our curiosity :-) regards, Peter From pmr at ebi.ac.uk Fri Mar 13 14:41:45 2009 From: pmr at ebi.ac.uk (Peter Rice) Date: Fri, 13 Mar 2009 14:41:45 +0000 Subject: [EMBOSS] fuzzpro oddity In-Reply-To: <49BA14A2.5060400@imm.ox.ac.uk> References: <49BA14A2.5060400@imm.ox.ac.uk> Message-ID: <49BA70A9.9010508@ebi.ac.uk> Steve Taylor wrote: > Hi, > > I have an odd problem. I am trying to search a multi-fasta set of > proteins. If I do: > > fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXXW > -stdout -auto > > I get: > > Error: Sequence is not a protein > > fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXX > -stdout -auto > > returns results. > > Any thoughts why? Is this a cryptic way of saying it can't find the > motif or some other problem? Nothing to do with the pattern. There is a strange sequence there: >gi|170590912|ref|XP_001900215.1| hypothetical protein Bm1_43765 [Brugia malayi] MAAQKERLTGDIYJESDIRQKSALSSSATVPSPQMNSQASRSASERQNIWEHRLGIRAPEQNSEQKKYWEYRNIYHIPVP QGIEFWEDEDKKRWEMINIGGLDESEANRQIKKAKLQLARERQQENRGSRTPQTTHIFFIISLICFGLQIVLAAICIGFC IYQIFNNSQIEAGIAFLLLALMLLIGAAGGIFSALKRSENLAICTAVYNVTSAVGIIVAIINLYSFRVGQSGNLSAFIPI AGVVALVQNFNKLS This sequence has a 'J' which is a mass-spec ambiguity code for "I or L" and has somehow crept into a translation (perhaps with an ambiguous codon - there are several possibilties) EMBOSS 3.0.0 refuses to read it. EMBOSS 4.0.0 also fails. EMBOSS 5.0.0 and 6.0.0 understand J and should be able to process it and convert it to X As for the difference between the patterns - they both fail, but without the W it gives some results before it reaches the bad sequence. As you are reporting the results to stdout, it is not so easy to spot ... but just before the tail of the report I get the "Error: Sequence is not a protein" line (as one it to stdout and one is to stderr you may not see it in exactly the same place) Solutions are: edit the J (and any others) to X in the file and of course to update your EMBOSS installation to 6.0.0 As to the missing second message about the bad sequence ... if this were the only sequence in the file it would issue a message because it can read nothing. When reading through a file with many sequences it assumes the first failure is end of file. We need to do something about that - such as adding the sequence name to the message so you know where it stopped. Thanks for the report - it was fun to look into. Peter From pmr at ebi.ac.uk Fri Mar 13 15:26:20 2009 From: pmr at ebi.ac.uk (Peter Rice) Date: Fri, 13 Mar 2009 15:26:20 +0000 Subject: [EMBOSS] fuzzpro oddity In-Reply-To: <49BA76EB.6000409@imm.ox.ac.uk> References: <49BA14A2.5060400@imm.ox.ac.uk> <49BA70A9.9010508@ebi.ac.uk> <49BA76EB.6000409@imm.ox.ac.uk> Message-ID: <49BA7B1C.3010400@ebi.ac.uk> Steve Taylor wrote: > Thanks Peter. > > Nice detective work. I wonder if anybody in NCBI/RefSeq is reading this? > This is where the source is from...I wonder how blast indexing handles > not having a > for example? There was a '>' ... my mailer uses it for quoting so it got converted to '>' but the file was OK. It was only the 'J' in the sequnece that broke things. Peter From andrespinzon at gmail.com Fri Mar 13 15:29:53 2009 From: andrespinzon at gmail.com (Andres Pinzon) Date: Fri, 13 Mar 2009 11:29:53 -0400 Subject: [EMBOSS] recursive backtranslate In-Reply-To: <49BA27BB.6010304@ebi.ac.uk> References: <49BA27BB.6010304@ebi.ac.uk> Message-ID: <8968fc7e0903130829h20d4e967m26df9691b8d13c3a@mail.gmail.com> Hi all, thank you for your answers, Just in case anyone could need it, this is a small bash script which does the job: ============== #!/bin/bash LIST=`ls *.fasta` for i in $LIST do backtranseq -sequence $i -auto done ============ First run seqretsplit on your multiple fasta file, and run this script from the directory where your fasta files were stored. Best, On Fri, Mar 13, 2009 at 5:30 AM, Peter Rice wrote: > david.bauer at bayerhealthcare.com wrote: > emboss-bounces at lists.open-bio.org schrieb am 13/03/2009 01:13:15: >> >> > Is it possible to give backtranseq a muliple fasta file as input and >> > have all the sequences in it translated? >> > I have tried several times but backtranseq ?backtranslates just the >> > first sequence of my multiple fasta file. >> >> it just takes one sequence as input. >> >> For your problem you can either use "seqretsplit" to split up our file >> into individual sequences or you can write a script which iterates through >> the multiple fasta file with "skipseq" and sends its output to backtranseq. > > We have already extended backtranseq for the next release to work over > multiple sequences. > > The changes needed are not difficult if you want to try a little > programming. > > regards, > > Peter Rice > -- Andr?s Pinz?n http://bioinf.ibun.unal.edu.co/~apinzon/ Bioinformatics Center, Colombia EMBnet node http://bioinf.ibun.unal.edu.co Tel +57 3165000 ext 16961 Fax +571 3165415 Micology and Phytopathology Laboratory - Los Andes University. http://bioinf.uniandes.edu.co Tel +571 3394949 ext. 2768 From andrespinzon at gmail.com Fri Mar 13 15:36:17 2009 From: andrespinzon at gmail.com (Andres Pinzon) Date: Fri, 13 Mar 2009 11:36:17 -0400 Subject: [EMBOSS] fuzzpro oddity In-Reply-To: <49BA7B1C.3010400@ebi.ac.uk> References: <49BA14A2.5060400@imm.ox.ac.uk> <49BA70A9.9010508@ebi.ac.uk> <49BA76EB.6000409@imm.ox.ac.uk> <49BA7B1C.3010400@ebi.ac.uk> Message-ID: <8968fc7e0903130836k4fb9a8edn96e7ac535afa659f@mail.gmail.com> Hi Steve, just in case you have to change J for X in several fasta files, several times, this bash script does the job: find -type f -name '*.fasta' -print0 | xargs --null perl -pi -e 's/J/X/' Hope it helps, Best On Fri, Mar 13, 2009 at 11:26 AM, Peter Rice wrote: > Steve Taylor wrote: >> >> Thanks Peter. >> >> Nice detective work. I wonder if anybody in NCBI/RefSeq is reading this? >> This is where the source is from...I wonder how blast indexing handles not >> having a > for example? > > There was a '>' ... my mailer uses it for quoting so it got converted to > '>' but the file was OK. It was only the 'J' in the sequnece that broke > things. > > Peter > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > -- Andr?s Pinz?n http://bioinf.ibun.unal.edu.co/~apinzon/ Bioinformatics Center, Colombia EMBnet node http://bioinf.ibun.unal.edu.co Tel +57 3165000 ext 16961 Fax +571 3165415 Micology and Phytopathology Laboratory - Los Andes University. http://bioinf.uniandes.edu.co Tel +571 3394949 ext. 2768 From stephen.taylor at imm.ox.ac.uk Fri Mar 13 15:08:27 2009 From: stephen.taylor at imm.ox.ac.uk (Steve Taylor) Date: Fri, 13 Mar 2009 15:08:27 +0000 Subject: [EMBOSS] fuzzpro oddity In-Reply-To: <49BA70A9.9010508@ebi.ac.uk> References: <49BA14A2.5060400@imm.ox.ac.uk> <49BA70A9.9010508@ebi.ac.uk> Message-ID: <49BA76EB.6000409@imm.ox.ac.uk> Thanks Peter. Nice detective work. I wonder if anybody in NCBI/RefSeq is reading this? This is where the source is from...I wonder how blast indexing handles not having a > for example? Steve >> >> I have an odd problem. I am trying to search a multi-fasta set of >> proteins. If I do: >> >> fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXXW >> -stdout -auto >> >> I get: >> >> Error: Sequence is not a protein >> >> fuzzpro -sequence invertebrate.protein.faa -pattern CXXXXFYPXXXXX >> -stdout -auto >> >> returns results. >> >> Any thoughts why? Is this a cryptic way of saying it can't find the >> motif or some other problem? > > > Nothing to do with the pattern. There is a strange sequence there: > > >gi|170590912|ref|XP_001900215.1| hypothetical protein Bm1_43765 > [Brugia malayi] > MAAQKERLTGDIYJESDIRQKSALSSSATVPSPQMNSQASRSASERQNIWEHRLGIRAPEQNSEQKKYWEYRNIYHIPVP > > QGIEFWEDEDKKRWEMINIGGLDESEANRQIKKAKLQLARERQQENRGSRTPQTTHIFFIISLICFGLQIVLAAICIGFC > > IYQIFNNSQIEAGIAFLLLALMLLIGAAGGIFSALKRSENLAICTAVYNVTSAVGIIVAIINLYSFRVGQSGNLSAFIPI > > AGVVALVQNFNKLS > > This sequence has a 'J' which is a mass-spec ambiguity code for "I or L" > and has somehow crept into a translation (perhaps with an ambiguous > codon - there are several possibilties) > > EMBOSS 3.0.0 refuses to read it. EMBOSS 4.0.0 also fails. > > EMBOSS 5.0.0 and 6.0.0 understand J and should be able to process it and > convert it to X > > As for the difference between the patterns - they both fail, but without > the W it gives some results before it reaches the bad sequence. > > As you are reporting the results to stdout, it is not so easy to spot ... > but just before the tail of the report I get the "Error: Sequence is not > a protein" line (as one it to stdout and one is to stderr you may not > see it in exactly the same place) > > Solutions are: edit the J (and any others) to X in the file > and of course to update your EMBOSS installation to 6.0.0 > > As to the missing second message about the bad sequence ... if this were > the > only sequence in the file it would issue a message because it can read > nothing. When reading through a file with many sequences it assumes the > first failure is end of file. We need to do something about that - such > as adding the sequence name to the message so you know where it stopped. > > Thanks for the report - it was fun to look into. > > Peter > > > From mincloud at gmail.com Wed Mar 18 05:12:38 2009 From: mincloud at gmail.com (yun zheng) Date: Wed, 18 Mar 2009 13:12:38 +0800 Subject: [EMBOSS] make error Message-ID: <8f6eb9540903172212n289d21e2y1b42c517645aac6c@mail.gmail.com> Hi, I met a lot of errors when I typed make in EMBOSS 6.0.1 folder. #./configure #make ... xwin.c:3394: error: 'XwDev' has no member named 'write_to_window' xwin.c:3398: error: 'XwDev' has no member named 'write_to_window' xwin.c:3402: error: 'XwDev' has no member named 'write_to_pixmap' xwin.c:3406: error: 'XwDisplay' has no member named 'display' xwin.c:3407: error: 'XwDev' has no member named 'write_to_pixmap' make[2]: *** [xwin.lo] Error 1 make[2]: Leaving directory `/home/zhengy/software/EMBOSS-6.0.1/EMBOSS-6.0.1/plplot' make[1]: *** [all-recursive] Error 1 make[1]: Leaving directory `/home/zhengy/software/EMBOSS-6.0.1/EMBOSS-6.0.1/plplot' make: *** [all-recursive] Error 1 My machine is installed with a 64-bit GNU Linux (CentOS). # uname -a Linux IDM-DNA 2.6.18-92.1.22.el5 #1 SMP Tue Dec 16 11:57:43 EST 2008 x86_64 x86_64 x86_64 GNU/Linux Could you help me to solve the problem? Many thanks. sincerely zheng, yun Institute of Deveopmental Biology and Molecular Medicine Fudan University 200 Handan Rd Shanghai, China 200433 From ajb at ebi.ac.uk Wed Mar 18 09:09:49 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Wed, 18 Mar 2009 09:09:49 -0000 (GMT) Subject: [EMBOSS] make error In-Reply-To: <8f6eb9540903172212n289d21e2y1b42c517645aac6c@mail.gmail.com> References: <8f6eb9540903172212n289d21e2y1b42c517645aac6c@mail.gmail.com> Message-ID: <60593.86.9.126.186.1237367389.squirrel@webmail.ebi.ac.uk> Hi, You need to install the X11 development files for CentOS from your DVD. For that Linux distribution the RPM is probably called 'xorg-x11-proto-devel'. While you're doing that you may want to install the 'gd-devel' RPM at the same time (which will enable PNG support). After that do a 'make clean' and redo the './configure' step. The FAQ does give a hint to the above but I'll see whether it needs updating for CentOS. Alan > Hi, I met a lot of errors when I typed make in EMBOSS 6.0.1 folder. > > #./configure > #make > ... > xwin.c:3394: error: 'XwDev' has no member named 'write_to_window' > xwin.c:3398: error: 'XwDev' has no member named 'write_to_window' > xwin.c:3402: error: 'XwDev' has no member named 'write_to_pixmap' > xwin.c:3406: error: 'XwDisplay' has no member named 'display' > xwin.c:3407: error: 'XwDev' has no member named 'write_to_pixmap' > make[2]: *** [xwin.lo] Error 1 > make[2]: Leaving directory > `/home/zhengy/software/EMBOSS-6.0.1/EMBOSS-6.0.1/plplot' > make[1]: *** [all-recursive] Error 1 > make[1]: Leaving directory > `/home/zhengy/software/EMBOSS-6.0.1/EMBOSS-6.0.1/plplot' > make: *** [all-recursive] Error 1 > > My machine is installed with a 64-bit GNU Linux (CentOS). > # uname -a > Linux IDM-DNA 2.6.18-92.1.22.el5 #1 SMP Tue Dec 16 11:57:43 EST 2008 > x86_64 > x86_64 x86_64 GNU/Linux > > Could you help me to solve the problem? > > Many thanks. > > sincerely > zheng, yun > > Institute of Deveopmental Biology and Molecular Medicine > Fudan University > 200 Handan Rd > Shanghai, China 200433 > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > From fernan at iib.unsam.edu.ar Tue Mar 17 12:19:33 2009 From: fernan at iib.unsam.edu.ar (Fernan Aguero) Date: Tue, 17 Mar 2009 09:19:33 -0300 Subject: [EMBOSS] emboss-6.0.1 fails to build without X Message-ID: <20090317121933.GC68123@iib.unsam.edu.ar> ./configure --without-x [ ... succeeds ... ] make [ ... fails ... ] [ lots of errors from xwin.c ...] xwin.c: In function `imageops': xwin.c:3406: error: structure has no member named `display' *** Error code 1 This is on FreeBSD-6.3, gcc-3.4.6, gnu make 3.81 Typescript is attached. Cheers, Fernan -------------- next part -------------- Script started on Tue Mar 17 09:15:38 2009 gama# ./configfgguure --without-x checking for a BSD-compatible install... /usr/bin/install -c checking whether build environment is sane... yes checking for a thread-safe mkdir -p... ./install-sh -c -d checking for gawk... no checking for mawk... no checking for nawk... nawk checking whether make sets $(MAKE)... yes checking for gawk... (cached) nawk checking for gcc... gcc checking for C compiler default output file name... a.out checking whether the C compiler works... yes checking whether we are cross compiling... no checking for suffix of executables... checking for suffix of object files... o checking whether we are using the GNU C compiler... yes checking whether gcc accepts -g... yes checking for gcc option to accept ISO C89... none needed checking for style of include used by make... GNU checking dependency style of gcc... gcc3 checking how to run the C preprocessor... gcc -E checking build system type... i386-unknown-freebsd6.3 checking host system type... i386-unknown-freebsd6.3 checking for a sed that does not truncate output... /usr/bin/sed checking for grep that handles long lines and -e... /usr/bin/grep checking for egrep... /usr/bin/grep -E checking for ld used by gcc... /usr/bin/ld checking if the linker (/usr/bin/ld) is GNU ld... yes checking for /usr/bin/ld option to reload object files... -r checking for BSD-compatible nm... /usr/bin/nm -B checking whether ln -s works... yes checking how to recognize dependent libraries... pass_all checking for ANSI C header files... yes checking for sys/types.h... yes checking for sys/stat.h... yes checking for stdlib.h... yes checking for string.h... yes checking for memory.h... yes checking for strings.h... yes checking for inttypes.h... yes checking for stdint.h... yes checking for unistd.h... yes checking dlfcn.h usability... yes checking dlfcn.h presence... yes checking for dlfcn.h... yes checking for g++... g++ checking whether we are using the GNU C++ compiler... yes checking whether g++ accepts -g... yes checking dependency style of g++... gcc3 checking how to run the C++ preprocessor... g++ -E checking for g77... no checking for xlf... no checking for f77... f77 checking whether we are using the GNU Fortran 77 compiler... yes checking whether f77 accepts -g... yes checking the maximum length of command line arguments... 196608 checking command to parse /usr/bin/nm -B output from gcc object... ok checking for objdir... .libs checking for ar... ar checking for ranlib... ranlib checking for strip... strip checking if gcc supports -fno-rtti -fno-exceptions... no checking for gcc option to produce PIC... -fPIC checking if gcc PIC flag -fPIC works... yes checking if gcc static flag -static works... yes checking if gcc supports -c -o file.o... yes checking whether the gcc linker (/usr/bin/ld) supports shared libraries... yes checking whether -lc should be explicitly linked in... yes checking dynamic linker characteristics... freebsd6.3 ld.so checking how to hardcode library paths into programs... immediate checking whether stripping libraries is possible... yes checking if libtool supports shared libraries... yes checking whether to build shared libraries... yes checking whether to build static libraries... yes configure: creating libtool appending configuration tag "CXX" to libtool checking for ld used by g++... /usr/bin/ld checking if the linker (/usr/bin/ld) is GNU ld... yes checking whether the g++ linker (/usr/bin/ld) supports shared libraries... yes checking for g++ option to produce PIC... -fPIC checking if g++ PIC flag -fPIC works... yes checking if g++ static flag -static works... yes checking if g++ supports -c -o file.o... yes checking whether the g++ linker (/usr/bin/ld) supports shared libraries... yes checking dynamic linker characteristics... freebsd6.3 ld.so checking how to hardcode library paths into programs... immediate appending configuration tag "F77" to libtool checking if libtool supports shared libraries... yes checking whether to build shared libraries... yes checking whether to build static libraries... yes checking for f77 option to produce PIC... -fPIC checking if f77 PIC flag -fPIC works... yes checking if f77 static flag -static works... yes checking if f77 supports -c -o file.o... yes checking whether the f77 linker (/usr/bin/ld) supports shared libraries... yes checking dynamic linker characteristics... freebsd6.3 ld.so checking how to hardcode library paths into programs... immediate checking whether byte ordering is bigendian... no checking for a BSD-compatible install... /usr/bin/install -c checking whether ln -s works... yes checking whether make sets $(MAKE)... (cached) yes checking for ranlib... (cached) ranlib checking for X... disabled checking for dirent.h that defines DIR... yes checking for library containing opendir... none required checking for ANSI C header files... (cached) yes checking for unistd.h... (cached) yes checking for an ANSI C-conforming const... yes checking for pid_t... yes checking for size_t... yes checking whether struct tm is in sys/time.h or time.h... time.h checking whether getpgrp requires zero arguments... yes checking for strftime... yes checking vfork.h usability... no checking vfork.h presence... no checking for vfork.h... no checking for fork... yes checking for vfork... yes checking for working fork... yes checking for working vfork... (cached) yes checking for vprintf... yes checking for _doprnt... no checking for memmove... yes checking for gethostbyname in -lc... yes checking for socket in -lc... yes checking for main in -lm... yes ./configure: line 23442: !=: command not found checking if docroot is given... no checking if gcc profiling is selected... no checking if java include directory given... no checking if java OS include directory given... no checking if png driver is wanted... yes checking for inflateEnd in -lz... yes checking for png_destroy_read_struct in -lpng... no No png driver will be made due to librarys missing/old. checking if any authorisation type is given... no checking for gdome2... no checking if Linux x86_64... no checking for large file support... done checking for purify... no checking for cygwin... no checking for mprobe... no checking for savestats... no checking if any threading type is given... no configure: creating ./config.status config.status: creating plplot/Makefile config.status: creating plplot/lib/Makefile config.status: creating nucleus/Makefile config.status: creating ajax/Makefile config.status: creating emboss/Makefile config.status: creating emboss/acd/Makefile config.status: creating test/Makefile config.status: creating test/data/Makefile config.status: creating test/embl/Makefile config.status: creating test/genbank/Makefile config.status: creating test/gb/Makefile config.status: creating test/pir/Makefile config.status: creating test/swiss/Makefile config.status: creating test/swnew/Makefile config.status: creating test/testdb/Makefile config.status: creating test/wormpep/Makefile config.status: creating emboss/data/Makefile config.status: creating emboss/data/AAINDEX/Makefile config.status: creating emboss/data/CODONS/Makefile config.status: creating emboss/data/REBASE/Makefile config.status: creating emboss/data/JASPAR_CORE/Makefile config.status: creating emboss/data/JASPAR_FAM/Makefile config.status: creating emboss/data/JASPAR_PHYLOFACTS/Makefile config.status: creating emboss/data/JASPAR_CNE/Makefile config.status: creating emboss/data/JASPAR_POLII/Makefile config.status: creating emboss/data/JASPAR_SPLICE/Makefile config.status: creating emboss/data/PRINTS/Makefile config.status: creating emboss/data/PROSITE/Makefile config.status: creating doc/Makefile config.status: creating doc/manuals/Makefile config.status: creating doc/tutorials/Makefile config.status: creating doc/programs/Makefile config.status: creating doc/programs/html/Makefile config.status: creating doc/programs/text/Makefile config.status: creating jemboss/Makefile config.status: creating jemboss/api/Makefile config.status: creating jemboss/api/org/Makefile config.status: creating jemboss/api/org/emboss/Makefile config.status: creating jemboss/api/org/emboss/jemboss/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/filetree/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/form/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/sequenceChooser/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/startup/Makefile config.status: creating jemboss/api/org/emboss/jemboss/parser/Makefile config.status: creating jemboss/api/org/emboss/jemboss/parser/acd/Makefile config.status: creating jemboss/api/org/emboss/jemboss/programs/Makefile config.status: creating jemboss/api/org/emboss/jemboss/soap/Makefile config.status: creating jemboss/images/Makefile config.status: creating jemboss/lib/Makefile config.status: creating jemboss/lib/axis/Makefile config.status: creating jemboss/org/Makefile config.status: creating jemboss/org/emboss/Makefile config.status: creating jemboss/org/emboss/jemboss/Makefile config.status: creating jemboss/org/emboss/jemboss/graphics/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/filetree/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/form/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/startup/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/sequenceChooser/Makefile config.status: creating jemboss/org/emboss/jemboss/parser/Makefile config.status: creating jemboss/org/emboss/jemboss/parser/acd/Makefile config.status: creating jemboss/org/emboss/jemboss/programs/Makefile config.status: creating jemboss/org/emboss/jemboss/server/Makefile config.status: creating jemboss/org/emboss/jemboss/soap/Makefile config.status: creating jemboss/org/emboss/jemboss/editor/Makefile config.status: creating jemboss/org/emboss/jemboss/draw/Makefile config.status: creating jemboss/resources/Makefile config.status: creating jemboss/utils/Makefile config.status: creating Makefile config.status: executing depfiles commands gama# gmake Making all in plplot gmake[1]: Entering directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' Making all in lib gmake[2]: Entering directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot/lib' gmake[2]: Nothing to be done for `all'. gmake[2]: Leaving directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot/lib' gmake[2]: Entering directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pdfutils.lo -MD -MP -MF .deps/pdfutils.Tpo -c -o pdfutils.lo pdfutils.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pdfutils.lo -MD -MP -MF .deps/pdfutils.Tpo -c pdfutils.c -fPIC -DPIC -o .libs/pdfutils.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pdfutils.lo -MD -MP -MF .deps/pdfutils.Tpo -c pdfutils.c -o pdfutils.o >/dev/null 2>&1 mv -f .deps/pdfutils.Tpo .deps/pdfutils.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plargs.lo -MD -MP -MF .deps/plargs.Tpo -c -o plargs.lo plargs.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plargs.lo -MD -MP -MF .deps/plargs.Tpo -c plargs.c -fPIC -DPIC -o .libs/plargs.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plargs.lo -MD -MP -MF .deps/plargs.Tpo -c plargs.c -o plargs.o >/dev/null 2>&1 mv -f .deps/plargs.Tpo .deps/plargs.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbox.lo -MD -MP -MF .deps/plbox.Tpo -c -o plbox.lo plbox.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbox.lo -MD -MP -MF .deps/plbox.Tpo -c plbox.c -fPIC -DPIC -o .libs/plbox.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbox.lo -MD -MP -MF .deps/plbox.Tpo -c plbox.c -o plbox.o >/dev/null 2>&1 mv -f .deps/plbox.Tpo .deps/plbox.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcont.lo -MD -MP -MF .deps/plcont.Tpo -c -o plcont.lo plcont.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcont.lo -MD -MP -MF .deps/plcont.Tpo -c plcont.c -fPIC -DPIC -o .libs/plcont.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcont.lo -MD -MP -MF .deps/plcont.Tpo -c plcont.c -o plcont.o >/dev/null 2>&1 mv -f .deps/plcont.Tpo .deps/plcont.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcore.lo -MD -MP -MF .deps/plcore.Tpo -c -o plcore.lo plcore.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcore.lo -MD -MP -MF .deps/plcore.Tpo -c plcore.c -fPIC -DPIC -o .libs/plcore.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcore.lo -MD -MP -MF .deps/plcore.Tpo -c plcore.c -o plcore.o >/dev/null 2>&1 mv -f .deps/plcore.Tpo .deps/plcore.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plctrl.lo -MD -MP -MF .deps/plctrl.Tpo -c -o plctrl.lo plctrl.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plctrl.lo -MD -MP -MF .deps/plctrl.Tpo -c plctrl.c -fPIC -DPIC -o .libs/plctrl.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plctrl.lo -MD -MP -MF .deps/plctrl.Tpo -c plctrl.c -o plctrl.o >/dev/null 2>&1 mv -f .deps/plctrl.Tpo .deps/plctrl.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcvt.lo -MD -MP -MF .deps/plcvt.Tpo -c -o plcvt.lo plcvt.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcvt.lo -MD -MP -MF .deps/plcvt.Tpo -c plcvt.c -fPIC -DPIC -o .libs/plcvt.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcvt.lo -MD -MP -MF .deps/plcvt.Tpo -c plcvt.c -o plcvt.o >/dev/null 2>&1 mv -f .deps/plcvt.Tpo .deps/plcvt.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pldtik.lo -MD -MP -MF .deps/pldtik.Tpo -c -o pldtik.lo pldtik.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pldtik.lo -MD -MP -MF .deps/pldtik.Tpo -c pldtik.c -fPIC -DPIC -o .libs/pldtik.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pldtik.lo -MD -MP -MF .deps/pldtik.Tpo -c pldtik.c -o pldtik.o >/dev/null 2>&1 mv -f .deps/pldtik.Tpo .deps/pldtik.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plfill.lo -MD -MP -MF .deps/plfill.Tpo -c -o plfill.lo plfill.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plfill.lo -MD -MP -MF .deps/plfill.Tpo -c plfill.c -fPIC -DPIC -o .libs/plfill.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plfill.lo -MD -MP -MF .deps/plfill.Tpo -c plfill.c -o plfill.o >/dev/null 2>&1 mv -f .deps/plfill.Tpo .deps/plfill.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plhist.lo -MD -MP -MF .deps/plhist.Tpo -c -o plhist.lo plhist.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plhist.lo -MD -MP -MF .deps/plhist.Tpo -c plhist.c -fPIC -DPIC -o .libs/plhist.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plhist.lo -MD -MP -MF .deps/plhist.Tpo -c plhist.c -o plhist.o >/dev/null 2>&1 mv -f .deps/plhist.Tpo .deps/plhist.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plline.lo -MD -MP -MF .deps/plline.Tpo -c -o plline.lo plline.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plline.lo -MD -MP -MF .deps/plline.Tpo -c plline.c -fPIC -DPIC -o .libs/plline.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plline.lo -MD -MP -MF .deps/plline.Tpo -c plline.c -o plline.o >/dev/null 2>&1 mv -f .deps/plline.Tpo .deps/plline.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmap.lo -MD -MP -MF .deps/plmap.Tpo -c -o plmap.lo plmap.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmap.lo -MD -MP -MF .deps/plmap.Tpo -c plmap.c -fPIC -DPIC -o .libs/plmap.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmap.lo -MD -MP -MF .deps/plmap.Tpo -c plmap.c -o plmap.o >/dev/null 2>&1 mv -f .deps/plmap.Tpo .deps/plmap.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plot3d.lo -MD -MP -MF .deps/plot3d.Tpo -c -o plot3d.lo plot3d.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plot3d.lo -MD -MP -MF .deps/plot3d.Tpo -c plot3d.c -fPIC -DPIC -o .libs/plot3d.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plot3d.lo -MD -MP -MF .deps/plot3d.Tpo -c plot3d.c -o plot3d.o >/dev/null 2>&1 mv -f .deps/plot3d.Tpo .deps/plot3d.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plpage.lo -MD -MP -MF .deps/plpage.Tpo -c -o plpage.lo plpage.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plpage.lo -MD -MP -MF .deps/plpage.Tpo -c plpage.c -fPIC -DPIC -o .libs/plpage.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plpage.lo -MD -MP -MF .deps/plpage.Tpo -c plpage.c -o plpage.o >/dev/null 2>&1 mv -f .deps/plpage.Tpo .deps/plpage.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsdef.lo -MD -MP -MF .deps/plsdef.Tpo -c -o plsdef.lo plsdef.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsdef.lo -MD -MP -MF .deps/plsdef.Tpo -c plsdef.c -fPIC -DPIC -o .libs/plsdef.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsdef.lo -MD -MP -MF .deps/plsdef.Tpo -c plsdef.c -o plsdef.o >/dev/null 2>&1 mv -f .deps/plsdef.Tpo .deps/plsdef.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plshade.lo -MD -MP -MF .deps/plshade.Tpo -c -o plshade.lo plshade.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plshade.lo -MD -MP -MF .deps/plshade.Tpo -c plshade.c -fPIC -DPIC -o .libs/plshade.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plshade.lo -MD -MP -MF .deps/plshade.Tpo -c plshade.c -o plshade.o >/dev/null 2>&1 mv -f .deps/plshade.Tpo .deps/plshade.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsym.lo -MD -MP -MF .deps/plsym.Tpo -c -o plsym.lo plsym.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsym.lo -MD -MP -MF .deps/plsym.Tpo -c plsym.c -fPIC -DPIC -o .libs/plsym.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsym.lo -MD -MP -MF .deps/plsym.Tpo -c plsym.c -o plsym.o >/dev/null 2>&1 mv -f .deps/plsym.Tpo .deps/plsym.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pltick.lo -MD -MP -MF .deps/pltick.Tpo -c -o pltick.lo pltick.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pltick.lo -MD -MP -MF .deps/pltick.Tpo -c pltick.c -fPIC -DPIC -o .libs/pltick.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pltick.lo -MD -MP -MF .deps/pltick.Tpo -c pltick.c -o pltick.o >/dev/null 2>&1 mv -f .deps/pltick.Tpo .deps/pltick.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plvpor.lo -MD -MP -MF .deps/plvpor.Tpo -c -o plvpor.lo plvpor.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plvpor.lo -MD -MP -MF .deps/plvpor.Tpo -c plvpor.c -fPIC -DPIC -o .libs/plvpor.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plvpor.lo -MD -MP -MF .deps/plvpor.Tpo -c plvpor.c -o plvpor.o >/dev/null 2>&1 mv -f .deps/plvpor.Tpo .deps/plvpor.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plwind.lo -MD -MP -MF .deps/plwind.Tpo -c -o plwind.lo plwind.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plwind.lo -MD -MP -MF .deps/plwind.Tpo -c plwind.c -fPIC -DPIC -o .libs/plwind.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plwind.lo -MD -MP -MF .deps/plwind.Tpo -c plwind.c -o plwind.o >/dev/null 2>&1 mv -f .deps/plwind.Tpo .deps/plwind.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plstripc.lo -MD -MP -MF .deps/plstripc.Tpo -c -o plstripc.lo plstripc.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plstripc.lo -MD -MP -MF .deps/plstripc.Tpo -c plstripc.c -fPIC -DPIC -o .libs/plstripc.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plstripc.lo -MD -MP -MF .deps/plstripc.Tpo -c plstripc.c -o plstripc.o >/dev/null 2>&1 mv -f .deps/plstripc.Tpo .deps/plstripc.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT hpgl.lo -MD -MP -MF .deps/hpgl.Tpo -c -o hpgl.lo hpgl.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT hpgl.lo -MD -MP -MF .deps/hpgl.Tpo -c hpgl.c -fPIC -DPIC -o .libs/hpgl.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT hpgl.lo -MD -MP -MF .deps/hpgl.Tpo -c hpgl.c -o hpgl.o >/dev/null 2>&1 mv -f .deps/hpgl.Tpo .deps/hpgl.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT impress.lo -MD -MP -MF .deps/impress.Tpo -c -o impress.lo impress.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT impress.lo -MD -MP -MF .deps/impress.Tpo -c impress.c -fPIC -DPIC -o .libs/impress.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT impress.lo -MD -MP -MF .deps/impress.Tpo -c impress.c -o impress.o >/dev/null 2>&1 mv -f .deps/impress.Tpo .deps/impress.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljiip.lo -MD -MP -MF .deps/ljiip.Tpo -c -o ljiip.lo ljiip.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljiip.lo -MD -MP -MF .deps/ljiip.Tpo -c ljiip.c -fPIC -DPIC -o .libs/ljiip.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljiip.lo -MD -MP -MF .deps/ljiip.Tpo -c ljiip.c -o ljiip.o >/dev/null 2>&1 mv -f .deps/ljiip.Tpo .deps/ljiip.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljii.lo -MD -MP -MF .deps/ljii.Tpo -c -o ljii.lo ljii.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljii.lo -MD -MP -MF .deps/ljii.Tpo -c ljii.c -fPIC -DPIC -o .libs/ljii.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljii.lo -MD -MP -MF .deps/ljii.Tpo -c ljii.c -o ljii.o >/dev/null 2>&1 mv -f .deps/ljii.Tpo .deps/ljii.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT null.lo -MD -MP -MF .deps/null.Tpo -c -o null.lo null.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT null.lo -MD -MP -MF .deps/null.Tpo -c null.c -fPIC -DPIC -o .libs/null.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT null.lo -MD -MP -MF .deps/null.Tpo -c null.c -o null.o >/dev/null 2>&1 mv -f .deps/null.Tpo .deps/null.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT data.lo -MD -MP -MF .deps/data.Tpo -c -o data.lo data.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT data.lo -MD -MP -MF .deps/data.Tpo -c data.c -fPIC -DPIC -o .libs/data.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT data.lo -MD -MP -MF .deps/data.Tpo -c data.c -o data.o >/dev/null 2>&1 mv -f .deps/data.Tpo .deps/data.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pbm.lo -MD -MP -MF .deps/pbm.Tpo -c -o pbm.lo pbm.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pbm.lo -MD -MP -MF .deps/pbm.Tpo -c pbm.c -fPIC -DPIC -o .libs/pbm.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pbm.lo -MD -MP -MF .deps/pbm.Tpo -c pbm.c -o pbm.o >/dev/null 2>&1 mv -f .deps/pbm.Tpo .deps/pbm.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbuf.lo -MD -MP -MF .deps/plbuf.Tpo -c -o plbuf.lo plbuf.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbuf.lo -MD -MP -MF .deps/plbuf.Tpo -c plbuf.c -fPIC -DPIC -o .libs/plbuf.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbuf.lo -MD -MP -MF .deps/plbuf.Tpo -c plbuf.c -o plbuf.o >/dev/null 2>&1 mv -f .deps/plbuf.Tpo .deps/plbuf.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmeta.lo -MD -MP -MF .deps/plmeta.Tpo -c -o plmeta.lo plmeta.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmeta.lo -MD -MP -MF .deps/plmeta.Tpo -c plmeta.c -fPIC -DPIC -o .libs/plmeta.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmeta.lo -MD -MP -MF .deps/plmeta.Tpo -c plmeta.c -o plmeta.o >/dev/null 2>&1 mv -f .deps/plmeta.Tpo .deps/plmeta.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ps.lo -MD -MP -MF .deps/ps.Tpo -c -o ps.lo ps.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ps.lo -MD -MP -MF .deps/ps.Tpo -c ps.c -fPIC -DPIC -o .libs/ps.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ps.lo -MD -MP -MF .deps/ps.Tpo -c ps.c -o ps.o >/dev/null 2>&1 mv -f .deps/ps.Tpo .deps/ps.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT tek.lo -MD -MP -MF .deps/tek.Tpo -c -o tek.lo tek.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT tek.lo -MD -MP -MF .deps/tek.Tpo -c tek.c -fPIC -DPIC -o .libs/tek.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT tek.lo -MD -MP -MF .deps/tek.Tpo -c tek.c -o tek.o >/dev/null 2>&1 mv -f .deps/tek.Tpo .deps/tek.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xfig.lo -MD -MP -MF .deps/xfig.Tpo -c -o xfig.lo xfig.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xfig.lo -MD -MP -MF .deps/xfig.Tpo -c xfig.c -fPIC -DPIC -o .libs/xfig.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xfig.lo -MD -MP -MF .deps/xfig.Tpo -c xfig.c -o xfig.o >/dev/null 2>&1 mv -f .deps/xfig.Tpo .deps/xfig.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xwin.lo -MD -MP -MF .deps/xwin.Tpo -c -o xwin.lo xwin.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xwin.lo -MD -MP -MF .deps/xwin.Tpo -c xwin.c -fPIC -DPIC -o .libs/xwin.o In file included from xwin.c:34: plxwd.h:22:22: X11/Xlib.h: No such file or directory plxwd.h:23:23: X11/Xutil.h: No such file or directory plxwd.h:24:28: X11/cursorfont.h: No such file or directory plxwd.h:25:24: X11/keysym.h: No such file or directory In file included from xwin.c:34: plxwd.h:51: error: syntax error before "Display" plxwd.h:61: error: syntax error before "XColor" plxwd.h:76: error: syntax error before "Window" plxwd.h:107: error: syntax error before "XPoint" plxwd.h:109: error: syntax error before "XEvent" xwin.c:119: error: syntax error before "sxwm_colors" xwin.c:119: warning: data definition has no type or storage class xwin.c:154: error: syntax error before '*' token xwin.c:164: error: syntax error before "XEvent" xwin.c:165: error: syntax error before "XEvent" xwin.c:166: error: syntax error before "XEvent" xwin.c:167: error: syntax error before "XEvent" xwin.c:168: error: syntax error before "XEvent" xwin.c:169: error: syntax error before "XEvent" xwin.c:170: error: syntax error before "XEvent" xwin.c:171: error: syntax error before "XEvent" xwin.c:172: error: syntax error before "XEvent" xwin.c:173: error: syntax error before "XEvent" xwin.c:208: error: syntax error before "XColor" xwin.c:209: error: syntax error before "XColor" xwin.c: In function `plD_line_xw': xwin.c:375: error: structure has no member named `display' xwin.c:375: error: structure has no member named `window' xwin.c:375: error: structure has no member named `gc' xwin.c:378: error: structure has no member named `display' xwin.c:378: error: structure has no member named `pixmap' xwin.c:378: error: structure has no member named `gc' xwin.c: In function `XorMod': xwin.c:399: error: structure has no member named `display' xwin.c:399: error: structure has no member named `gc' xwin.c:399: error: `GXcopy' undeclared (first use in this function) xwin.c:399: error: (Each undeclared identifier is reported only once xwin.c:399: error: for each function it appears in.) xwin.c:401: error: structure has no member named `display' xwin.c:401: error: structure has no member named `gc' xwin.c:401: error: `GXxor' undeclared (first use in this function) xwin.c: In function `plD_polyline_xw': xwin.c:417: error: syntax error before "pts" xwin.c:432: error: `pts' undeclared (first use in this function) xwin.c:437: error: structure has no member named `display' xwin.c:437: error: structure has no member named `window' xwin.c:437: error: structure has no member named `gc' xwin.c:438: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:441: error: structure has no member named `display' xwin.c:441: error: structure has no member named `pixmap' xwin.c:441: error: structure has no member named `gc' xwin.c: In function `plD_eop_xw': xwin.c:469: error: structure has no member named `display' xwin.c: In function `plD_bop_xw': xwin.c:502: error: structure has no member named `display' xwin.c:502: error: structure has no member named `window' xwin.c:505: error: structure has no member named `display' xwin.c:505: error: structure has no member named `gc' xwin.c:505: error: structure has no member named `cmap0' xwin.c:506: error: structure has no member named `display' xwin.c:506: error: structure has no member named `pixmap' xwin.c:506: error: structure has no member named `gc' xwin.c:508: error: structure has no member named `display' xwin.c:508: error: structure has no member named `gc' xwin.c:508: error: structure has no member named `curcolor' xwin.c:510: error: structure has no member named `display' xwin.c: In function `plD_tidy_xw': xwin.c:547: error: structure has no member named `display' xwin.c:547: error: structure has no member named `window' xwin.c:549: error: structure has no member named `display' xwin.c:549: error: structure has no member named `pixmap' xwin.c:550: error: structure has no member named `display' xwin.c:556: error: structure has no member named `display' xwin.c:556: error: structure has no member named `gc' xwin.c:557: error: structure has no member named `display' xwin.c:557: error: structure has no member named `gcXor' xwin.c:558: error: structure has no member named `display' xwin.c:559: error: structure has no member named `cmap0' xwin.c:559: error: structure has no member named `cmap0' xwin.c:559: error: structure has no member named `cmap0' xwin.c:560: error: structure has no member named `cmap1' xwin.c:560: error: structure has no member named `cmap1' xwin.c:560: error: structure has no member named `cmap1' xwin.c: In function `plD_state_xw': xwin.c:592: error: structure has no member named `display' xwin.c:592: error: structure has no member named `gc' xwin.c:593: error: `LineSolid' undeclared (first use in this function) xwin.c:593: error: `CapRound' undeclared (first use in this function) xwin.c:593: error: `JoinMiter' undeclared (first use in this function) xwin.c:600: error: structure has no member named `curcolor' xwin.c:601: error: structure has no member named `display' xwin.c:601: error: structure has no member named `map' xwin.c:601: error: structure has no member named `curcolor' xwin.c:603: error: structure has no member named `curcolor' xwin.c:603: error: structure has no member named `fgcolor' xwin.c:606: error: structure has no member named `curcolor' xwin.c:606: error: structure has no member named `cmap0' xwin.c:608: error: structure has no member named `display' xwin.c:608: error: structure has no member named `gc' xwin.c:608: error: structure has no member named `curcolor' xwin.c:611: error: structure has no member named `curcolor' xwin.c:611: error: structure has no member named `fgcolor' xwin.c:612: error: structure has no member named `display' xwin.c:612: error: structure has no member named `gc' xwin.c:612: error: structure has no member named `curcolor' xwin.c:628: error: structure has no member named `curcolor' xwin.c:628: error: structure has no member named `cmap1' xwin.c:630: error: structure has no member named `curcolor' xwin.c:630: error: structure has no member named `fgcolor' xwin.c:632: error: structure has no member named `display' xwin.c:632: error: structure has no member named `gc' xwin.c:632: error: structure has no member named `curcolor' xwin.c: In function `plD_esc_xw': xwin.c:712: error: structure has no member named `display' xwin.c:744: error: `XColor' undeclared (first use in this function) xwin.c:744: error: syntax error before ')' token xwin.c:748: error: syntax error before ')' token xwin.c: In function `GetCursorCmd': xwin.c:777: error: syntax error before "event" xwin.c:789: error: structure has no member named `display' xwin.c:789: error: structure has no member named `window' xwin.c:789: error: `event' undeclared (first use in this function) xwin.c: In function `FillPolygonCmd': xwin.c:811: error: syntax error before "pts" xwin.c:820: error: `pts' undeclared (first use in this function) xwin.c:827: error: structure has no member named `display' xwin.c:827: error: structure has no member named `window' xwin.c:827: error: structure has no member named `gc' xwin.c:828: error: `Nonconvex' undeclared (first use in this function) xwin.c:828: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:831: error: structure has no member named `display' xwin.c:831: error: structure has no member named `pixmap' xwin.c:831: error: structure has no member named `gc' xwin.c:838: error: structure has no member named `display' xwin.c:838: error: structure has no member named `gc' xwin.c:838: error: structure has no member named `fgcolor' xwin.c:840: error: structure has no member named `display' xwin.c:840: error: structure has no member named `window' xwin.c:840: error: structure has no member named `gc' xwin.c:844: error: structure has no member named `display' xwin.c:844: error: structure has no member named `pixmap' xwin.c:844: error: structure has no member named `gc' xwin.c:847: error: structure has no member named `display' xwin.c:847: error: structure has no member named `gc' xwin.c:847: error: structure has no member named `curcolor' xwin.c: In function `OpenXwin': xwin.c:929: error: structure has no member named `display' xwin.c:930: error: structure has no member named `display' xwin.c:935: error: structure has no member named `display' xwin.c:937: error: structure has no member named `display' xwin.c:940: error: structure has no member named `map' xwin.c:940: error: structure has no member named `display' xwin.c:952: error: structure has no member named `display' xwin.c:958: error: structure has no member named `cmap0' xwin.c:958: error: `XColor' undeclared (first use in this function) xwin.c:958: error: syntax error before ')' token xwin.c:959: error: structure has no member named `cmap0' xwin.c: In function `Init': xwin.c:995: error: syntax error before "root" xwin.c:1008: error: structure has no member named `window' xwin.c:1014: error: structure has no member named `display' xwin.c:1014: error: structure has no member named `window' xwin.c:1014: error: structure has no member named `map' xwin.c:1018: error: structure has no member named `gc' xwin.c:1019: error: structure has no member named `gc' xwin.c:1019: error: structure has no member named `display' xwin.c:1019: error: structure has no member named `window' xwin.c:1023: error: structure has no member named `gcXor' xwin.c:1024: error: syntax error before "gcValues" xwin.c:1027: error: `gcValues' undeclared (first use in this function) xwin.c:1027: error: structure has no member named `cmap0' xwin.c:1029: error: `GXxor' undeclared (first use in this function) xwin.c:1030: error: `GCForeground' undeclared (first use in this function) xwin.c:1030: error: `GCBackground' undeclared (first use in this function) xwin.c:1030: error: `GCFunction' undeclared (first use in this function) xwin.c:1032: error: structure has no member named `gcXor' xwin.c:1032: error: structure has no member named `display' xwin.c:1032: error: structure has no member named `window' xwin.c:1037: error: structure has no member named `display' xwin.c:1037: error: structure has no member named `window' xwin.c:1037: error: `root' undeclared (first use in this function) xwin.c:1064: error: structure has no member named `display' xwin.c:1064: error: structure has no member named `window' xwin.c:1064: error: structure has no member named `cmap0' xwin.c:1065: error: structure has no member named `display' xwin.c:1065: error: structure has no member named `gc' xwin.c:1065: error: structure has no member named `cmap0' xwin.c: In function `InitMain': xwin.c:1085: error: syntax error before "root" xwin.c:1095: error: structure has no member named `display' xwin.c:1095: error: structure has no member named `display' xwin.c:1096: error: `root' undeclared (first use in this function) xwin.c:1101: error: `hint' undeclared (first use in this function) xwin.c:1103: error: `PSize' undeclared (first use in this function) xwin.c:1105: error: `USSize' undeclared (first use in this function) xwin.c:1121: error: `USPosition' undeclared (first use in this function) xwin.c:1143: error: structure has no member named `window' xwin.c:1144: error: structure has no member named `display' xwin.c:1145: error: structure has no member named `display' xwin.c:1148: error: `InputOutput' undeclared (first use in this function) xwin.c:1148: error: structure has no member named `visual' xwin.c:1151: error: structure has no member named `display' xwin.c:1151: error: structure has no member named `window' xwin.c:1152: error: `None' undeclared (first use in this function) xwin.c: In function `MapMain': xwin.c:1166: error: syntax error before "event" xwin.c:1173: error: `ButtonPressMask' undeclared (first use in this function) xwin.c:1174: error: `KeyPressMask' undeclared (first use in this function) xwin.c:1175: error: `ExposureMask' undeclared (first use in this function) xwin.c:1176: error: `ButtonMotionMask' undeclared (first use in this function) xwin.c:1177: error: `StructureNotifyMask' undeclared (first use in this function) xwin.c:1179: error: structure has no member named `display' xwin.c:1179: error: structure has no member named `window' xwin.c:1183: error: structure has no member named `display' xwin.c:1183: error: structure has no member named `window' xwin.c:1189: error: structure has no member named `display' xwin.c:1189: error: structure has no member named `window' xwin.c:1189: error: `event' undeclared (first use in this function) xwin.c:1190: error: `Expose' undeclared (first use in this function) xwin.c:1191: error: structure has no member named `display' xwin.c:1191: error: structure has no member named `window' xwin.c: In function `WaitForPage': xwin.c:1210: error: syntax error before "event" xwin.c:1215: error: structure has no member named `display' xwin.c:1215: error: structure has no member named `window' xwin.c:1215: error: `event' undeclared (first use in this function) xwin.c: In function `HandleEvents': xwin.c:1363: error: syntax error before "event" xwin.c:1365: error: structure has no member named `display' xwin.c:1365: error: structure has no member named `window' xwin.c:1366: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:1387: error: syntax error before "XEvent" xwin.c: In function `MasterEH': xwin.c:1389: error: `pls' undeclared (first use in this function) xwin.c:1392: error: `event' undeclared (first use in this function) xwin.c:1396: error: `KeyPress' undeclared (first use in this function) xwin.c:1400: error: `ButtonPress' undeclared (first use in this function) xwin.c:1404: error: `Expose' undeclared (first use in this function) xwin.c:1408: error: `ConfigureNotify' undeclared (first use in this function) xwin.c:1412: error: `MotionNotify' undeclared (first use in this function) xwin.c:1418: error: `EnterNotify' undeclared (first use in this function) xwin.c:1422: error: `LeaveNotify' undeclared (first use in this function) xwin.c: At top level: xwin.c:1435: error: syntax error before "XEvent" xwin.c: In function `KeyEH': xwin.c:1437: error: `pls' undeclared (first use in this function) xwin.c:1441: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:1455: error: syntax error before "XEvent" xwin.c: In function `ButtonEH': xwin.c:1457: error: `pls' undeclared (first use in this function) xwin.c:1461: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:1490: error: syntax error before "XEvent" xwin.c: In function `LookupXKeyEvent': xwin.c:1492: error: `pls' undeclared (first use in this function) xwin.c:1494: error: `XKeyEvent' undeclared (first use in this function) xwin.c:1494: error: `keyEvent' undeclared (first use in this function) xwin.c:1494: error: syntax error before ')' token xwin.c:1497: error: syntax error before "cs" xwin.c:1506: error: `keysym' undeclared (first use in this function) xwin.c:1506: error: `cs' undeclared (first use in this function) xwin.c:1514: error: `XK_BackSpace' undeclared (first use in this function) xwin.c:1515: error: `XK_Tab' undeclared (first use in this function) xwin.c:1516: error: `XK_Linefeed' undeclared (first use in this function) xwin.c:1517: error: `XK_Return' undeclared (first use in this function) xwin.c:1518: error: `XK_Escape' undeclared (first use in this function) xwin.c:1519: error: `XK_Delete' undeclared (first use in this function) xwin.c: At top level: xwin.c:1535: error: syntax error before "XEvent" xwin.c: In function `LookupXButtonEvent': xwin.c:1537: error: `pls' undeclared (first use in this function) xwin.c:1539: error: `XButtonEvent' undeclared (first use in this function) xwin.c:1539: error: `buttonEvent' undeclared (first use in this function) xwin.c:1539: error: syntax error before ')' token xwin.c: In function `ProcessButton': xwin.c:1628: error: `Button3' undeclared (first use in this function) xwin.c: In function `LocateKey': xwin.c:1729: error: structure has no member named `display' xwin.c:1729: error: structure has no member named `window' xwin.c:1729: error: `None' undeclared (first use in this function) xwin.c: In function `LocateButton': xwin.c:1755: error: `Button1' undeclared (first use in this function) xwin.c: At top level: xwin.c:1840: error: syntax error before "XEvent" xwin.c: In function `MotionEH': xwin.c:1842: error: `pls' undeclared (first use in this function) xwin.c:1843: error: `XMotionEvent' undeclared (first use in this function) xwin.c:1843: error: `motionEvent' undeclared (first use in this function) xwin.c:1843: error: syntax error before ')' token xwin.c: At top level: xwin.c:1858: error: syntax error before "XEvent" xwin.c: In function `EnterEH': xwin.c:1860: error: `pls' undeclared (first use in this function) xwin.c:1861: error: `XCrossingEvent' undeclared (first use in this function) xwin.c:1861: error: `crossingEvent' undeclared (first use in this function) xwin.c:1861: error: syntax error before ')' token xwin.c: At top level: xwin.c:1876: error: syntax error before "XEvent" xwin.c: In function `LeaveEH': xwin.c:1878: error: `pls' undeclared (first use in this function) xwin.c:1880: error: `event' undeclared (first use in this function) xwin.c: In function `CreateXhairs': xwin.c:1896: error: syntax error before "root" xwin.c:1899: error: syntax error before "event" xwin.c:1903: error: structure has no member named `xhair_cursor' xwin.c:1904: error: structure has no member named `xhair_cursor' xwin.c:1904: error: structure has no member named `display' xwin.c:1904: error: `XC_crosshair' undeclared (first use in this function) xwin.c:1906: error: structure has no member named `display' xwin.c:1906: error: structure has no member named `window' xwin.c:1906: error: structure has no member named `xhair_cursor' xwin.c:1911: error: structure has no member named `display' xwin.c:1911: error: structure has no member named `window' xwin.c:1911: error: `root' undeclared (first use in this function) xwin.c:1911: error: `child' undeclared (first use in this function) xwin.c:1923: error: structure has no member named `display' xwin.c:1924: error: structure has no member named `display' xwin.c:1924: error: structure has no member named `window' xwin.c:1925: error: `PointerMotionMask' undeclared (first use in this function) xwin.c:1925: error: `event' undeclared (first use in this function) xwin.c:1929: error: `EnterWindowMask' undeclared (first use in this function) xwin.c:1929: error: `LeaveWindowMask' undeclared (first use in this function) xwin.c:1930: error: structure has no member named `display' xwin.c:1930: error: structure has no member named `window' xwin.c: In function `DestroyXhairs': xwin.c:1947: error: structure has no member named `display' xwin.c:1947: error: structure has no member named `window' xwin.c:1952: error: `PointerMotionMask' undeclared (first use in this function) xwin.c:1952: error: `EnterWindowMask' undeclared (first use in this function) xwin.c:1952: error: `LeaveWindowMask' undeclared (first use in this function) xwin.c:1953: error: structure has no member named `display' xwin.c:1953: error: structure has no member named `window' xwin.c: In function `DrawXhairs': xwin.c:1978: error: structure has no member named `xhair_x' xwin.c:1978: error: structure has no member named `xhair_x' xwin.c:1979: error: structure has no member named `xhair_x' xwin.c:1979: error: structure has no member named `xhair_x' xwin.c:1981: error: structure has no member named `xhair_y' xwin.c:1981: error: structure has no member named `xhair_y' xwin.c:1982: error: structure has no member named `xhair_y' xwin.c:1982: error: structure has no member named `xhair_y' xwin.c: In function `UpdateXhairs': xwin.c:1999: error: structure has no member named `display' xwin.c:1999: error: structure has no member named `window' xwin.c:1999: error: structure has no member named `gcXor' xwin.c:1999: error: structure has no member named `xhair_x' xwin.c:2000: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:2002: error: structure has no member named `display' xwin.c:2002: error: structure has no member named `window' xwin.c:2002: error: structure has no member named `gcXor' xwin.c:2002: error: structure has no member named `xhair_y' xwin.c: At top level: xwin.c:2014: error: syntax error before "XEvent" xwin.c: In function `ExposeEH': xwin.c:2016: error: `pls' undeclared (first use in this function) xwin.c:2018: error: `XExposeEvent' undeclared (first use in this function) xwin.c:2018: error: `exposeEvent' undeclared (first use in this function) xwin.c:2018: error: syntax error before ')' token xwin.c:2028: error: structure has no member named `display' xwin.c:2037: error: structure has no member named `display' xwin.c:2037: error: structure has no member named `window' xwin.c:2054: error: structure has no member named `display' xwin.c:2054: error: structure has no member named `window' xwin.c:2055: error: `ExposureMask' undeclared (first use in this function) xwin.c:2055: error: `StructureNotifyMask' undeclared (first use in this function) xwin.c:2055: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:2066: error: syntax error before "XEvent" xwin.c: In function `ResizeEH': xwin.c:2068: error: `pls' undeclared (first use in this function) xwin.c:2070: error: `XConfigureEvent' undeclared (first use in this function) xwin.c:2070: error: `configEvent' undeclared (first use in this function) xwin.c:2070: error: syntax error before ')' token xwin.c:2085: error: structure has no member named `display' xwin.c:2097: error: structure has no member named `display' xwin.c:2098: error: structure has no member named `display' xwin.c:2098: error: structure has no member named `window' xwin.c:2099: error: `ExposureMask' undeclared (first use in this function) xwin.c:2099: error: `StructureNotifyMask' undeclared (first use in this function) xwin.c:2099: error: `event' undeclared (first use in this function) xwin.c: In function `ExposeCmd': xwin.c:2143: error: structure has no member named `display' xwin.c:2145: error: structure has no member named `display' xwin.c:2145: error: structure has no member named `pixmap' xwin.c:2145: error: structure has no member named `window' xwin.c:2145: error: structure has no member named `gc' xwin.c:2147: error: structure has no member named `display' xwin.c:2150: error: syntax error before "pts" xwin.c:2152: error: `pts' undeclared (first use in this function) xwin.c:2158: error: structure has no member named `display' xwin.c:2158: error: structure has no member named `window' xwin.c:2158: error: structure has no member named `gc' xwin.c:2159: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:2165: error: structure has no member named `display' xwin.c: In function `ResizeCmd': xwin.c:2227: error: structure has no member named `display' xwin.c:2227: error: structure has no member named `pixmap' xwin.c:2238: error: structure has no member named `display' xwin.c:2244: error: structure has no member named `display' xwin.c:2244: error: structure has no member named `pixmap' xwin.c:2244: error: structure has no member named `window' xwin.c:2244: error: structure has no member named `gc' xwin.c:2246: error: structure has no member named `display' xwin.c: In function `RedrawCmd': xwin.c:2313: error: structure has no member named `display' xwin.c:2320: error: structure has no member named `display' xwin.c:2320: error: structure has no member named `pixmap' xwin.c:2320: error: structure has no member named `window' xwin.c:2320: error: structure has no member named `gc' xwin.c:2322: error: structure has no member named `display' xwin.c: At top level: xwin.c:2337: error: syntax error before '*' token xwin.c: In function `CreatePixmapErrorHandler': xwin.c:2339: error: `error' undeclared (first use in this function) xwin.c:2340: error: `BadAlloc' undeclared (first use in this function) xwin.c:2342: error: `display' undeclared (first use in this function) xwin.c: In function `CreatePixmap': xwin.c:2361: error: syntax error before '*' token xwin.c:2363: warning: assignment makes pointer from integer without a cast xwin.c:2365: error: `Success' undeclared (first use in this function) xwin.c:2370: error: structure has no member named `pixmap' xwin.c:2370: error: structure has no member named `display' xwin.c:2370: error: structure has no member named `window' xwin.c:2372: error: structure has no member named `display' xwin.c: In function `GetVisual': xwin.c:2407: error: syntax error before "vTemplate" xwin.c:2411: error: `vTemplate' undeclared (first use in this function) xwin.c:2414: error: `visualList' undeclared (first use in this function) xwin.c:2414: error: structure has no member named `display' xwin.c:2415: error: `VisualScreenMask' undeclared (first use in this function) xwin.c:2415: error: `VisualDepthMask' undeclared (first use in this function) xwin.c:2462: error: structure has no member named `visual' xwin.c:2469: error: structure has no member named `visual' xwin.c:2469: error: structure has no member named `display' xwin.c:2470: error: structure has no member named `display' xwin.c:2475: error: structure has no member named `visual' xwin.c:2476: error: `TrueColor' undeclared (first use in this function) xwin.c:2477: error: `StaticColor' undeclared (first use in this function) xwin.c:2478: error: `StaticGray' undeclared (first use in this function) xwin.c:2491: error: structure has no member named `visual' xwin.c:2492: error: `PseudoColor' undeclared (first use in this function) xwin.c:2495: error: `GrayScale' undeclared (first use in this function) xwin.c:2498: error: `DirectColor' undeclared (first use in this function) xwin.c: In function `AllocBGFG': xwin.c:2543: error: structure has no member named `display' xwin.c:2543: error: structure has no member named `map' xwin.c:2543: error: `False' undeclared (first use in this function) xwin.c:2547: error: structure has no member named `cmap0' xwin.c:2551: error: structure has no member named `cmap0' xwin.c:2551: error: structure has no member named `display' xwin.c:2552: error: structure has no member named `fgcolor' xwin.c:2552: error: structure has no member named `display' xwin.c:2563: error: structure has no member named `display' xwin.c:2563: error: structure has no member named `map' xwin.c:2575: error: structure has no member named `cmap0' xwin.c:2581: error: structure has no member named `fgcolor' xwin.c:2584: error: structure has no member named `display' xwin.c:2584: error: structure has no member named `map' xwin.c: In function `SetBGFG': xwin.c:2620: error: structure has no member named `cmap0' xwin.c:2639: error: structure has no member named `fgcolor' xwin.c:2644: error: structure has no member named `display' xwin.c:2644: error: structure has no member named `map' xwin.c:2644: error: structure has no member named `fgcolor' xwin.c:2645: error: structure has no member named `display' xwin.c:2645: error: structure has no member named `map' xwin.c:2645: error: structure has no member named `cmap0' xwin.c:2647: error: structure has no member named `display' xwin.c:2647: error: structure has no member named `map' xwin.c:2647: error: structure has no member named `cmap0' xwin.c:2648: error: structure has no member named `display' xwin.c:2648: error: structure has no member named `map' xwin.c:2648: error: structure has no member named `fgcolor' xwin.c: In function `AllocCustomMap': xwin.c:2710: error: syntax error before "xwm_colors" xwin.c:2719: error: `xwm_colors' undeclared (first use in this function) xwin.c:2721: error: structure has no member named `display' xwin.c:2721: error: structure has no member named `map' xwin.c:2729: error: structure has no member named `display' xwin.c:2729: error: structure has no member named `map' xwin.c:2729: error: structure has no member named `fgcolor' xwin.c:2733: error: structure has no member named `map' xwin.c:2733: error: structure has no member named `display' xwin.c:2733: error: structure has no member named `display' xwin.c:2734: error: structure has no member named `visual' xwin.c:2734: error: `AllocNone' undeclared (first use in this function) xwin.c:2740: error: structure has no member named `display' xwin.c:2740: error: structure has no member named `map' xwin.c:2740: error: `False' undeclared (first use in this function) xwin.c:2751: error: structure has no member named `display' xwin.c:2751: error: structure has no member named `map' xwin.c:2758: error: structure has no member named `display' xwin.c:2758: error: structure has no member named `map' xwin.c:2758: error: structure has no member named `cmap0' xwin.c:2759: error: structure has no member named `cmap0' xwin.c:2770: error: request for member `red' in something not a structure or union xwin.c:2771: error: request for member `green' in something not a structure or union xwin.c:2772: error: request for member `blue' in something not a structure or union xwin.c:2775: error: structure has no member named `display' xwin.c:2775: error: structure has no member named `map' xwin.c:2786: error: structure has no member named `display' xwin.c:2786: error: structure has no member named `map' xwin.c: In function `AllocCmap0': xwin.c:2811: error: structure has no member named `cmap0' xwin.c:2812: error: structure has no member named `display' xwin.c:2812: error: structure has no member named `map' xwin.c:2818: error: structure has no member named `cmap0' xwin.c:2818: error: `XColor' undeclared (first use in this function) xwin.c:2818: error: syntax error before ')' token xwin.c:2820: error: structure has no member named `cmap0' xwin.c:2832: error: structure has no member named `display' xwin.c:2832: error: structure has no member named `map' xwin.c:2832: error: `False' undeclared (first use in this function) xwin.c:2842: error: structure has no member named `cmap0' xwin.c:2853: error: syntax error before "c" xwin.c:2854: error: `c' undeclared (first use in this function) xwin.c:2855: error: structure has no member named `display' xwin.c:2855: error: structure has no member named `map' xwin.c:2859: error: structure has no member named `cmap0' xwin.c:2860: error: structure has no member named `cmap0' xwin.c:2864: error: syntax error before "screen_def" xwin.c:2872: error: structure has no member named `display' xwin.c:2872: error: structure has no member named `map' xwin.c:2874: error: `screen_def' undeclared (first use in this function) xwin.c:2874: error: `exact_def' undeclared (first use in this function) xwin.c:2882: error: structure has no member named `cmap0' xwin.c:2883: error: structure has no member named `cmap0' xwin.c:2886: error: structure has no member named `display' xwin.c:2886: error: structure has no member named `map' xwin.c:2890: error: structure has no member named `cmap0' xwin.c:2891: error: structure has no member named `cmap0' xwin.c: In function `AllocCmap1': xwin.c:2932: error: structure has no member named `display' xwin.c:2932: error: structure has no member named `map' xwin.c:2932: error: `False' undeclared (first use in this function) xwin.c:2951: error: structure has no member named `cmap1' xwin.c:2953: error: structure has no member named `cmap1' xwin.c:2953: error: `XColor' undeclared (first use in this function) xwin.c:2953: error: syntax error before ')' token xwin.c:2954: error: structure has no member named `cmap1' xwin.c:2964: error: structure has no member named `cmap1' xwin.c:2976: error: syntax error before "xcol" xwin.c:2981: error: structure has no member named `visual' xwin.c:2982: error: `TrueColor' undeclared (first use in this function) xwin.c:2990: error: structure has no member named `cmap1' xwin.c:2992: error: structure has no member named `cmap1' xwin.c:2992: error: syntax error before ')' token xwin.c:2993: error: structure has no member named `cmap1' xwin.c:2999: error: `xcol' undeclared (first use in this function) xwin.c:3001: error: structure has no member named `display' xwin.c:3001: error: structure has no member named `map' xwin.c:3005: error: structure has no member named `cmap1' xwin.c: In function `StoreCmap0': xwin.c:3041: error: structure has no member named `cmap0' xwin.c:3043: error: structure has no member named `display' xwin.c:3043: error: structure has no member named `map' xwin.c:3043: error: structure has no member named `cmap0' xwin.c:3045: error: structure has no member named `display' xwin.c:3045: error: structure has no member named `map' xwin.c:3045: error: structure has no member named `cmap0' xwin.c: In function `StoreCmap1': xwin.c:3069: error: structure has no member named `cmap1' xwin.c:3071: error: structure has no member named `display' xwin.c:3071: error: structure has no member named `map' xwin.c:3071: error: structure has no member named `cmap1' xwin.c:3073: error: structure has no member named `display' xwin.c:3073: error: structure has no member named `map' xwin.c:3073: error: structure has no member named `cmap1' xwin.c: At top level: xwin.c:3089: error: syntax error before "XColor" xwin.c: In function `PLColor_to_XColor': xwin.c:3091: error: `xcolor' undeclared (first use in this function) xwin.c:3091: error: `plcolor' undeclared (first use in this function) xwin.c:3094: error: `DoRed' undeclared (first use in this function) xwin.c:3094: error: `DoGreen' undeclared (first use in this function) xwin.c:3094: error: `DoBlue' undeclared (first use in this function) xwin.c: At top level: xwin.c:3105: error: syntax error before "XColor" xwin.c: In function `PLColor_from_XColor': xwin.c:3107: error: `plcolor' undeclared (first use in this function) xwin.c:3107: error: `xcolor' undeclared (first use in this function) xwin.c: At top level: xwin.c:3121: error: syntax error before '*' token xwin.c: In function `AreWeGrayscale': xwin.c:3129: error: `XVisualInfo' undeclared (first use in this function) xwin.c:3129: error: `visuals' undeclared (first use in this function) xwin.c:3133: error: `display' undeclared (first use in this function) xwin.c:3138: error: `GrayScale' undeclared (first use in this function) xwin.c:3139: error: `StaticGray' undeclared (first use in this function) xwin.c: At top level: xwin.c:3196: error: syntax error before '*' token xwin.c: In function `GetImageErrorHandler': xwin.c:3198: error: `error' undeclared (first use in this function) xwin.c:3198: error: `BadMatch' undeclared (first use in this function) xwin.c:3200: error: `display' undeclared (first use in this function) xwin.c: In function `DrawImage': xwin.c:3218: error: `XImage' undeclared (first use in this function) xwin.c:3218: error: `ximg' undeclared (first use in this function) xwin.c:3219: error: syntax error before "curcolor" xwin.c:3222: error: syntax error before '*' token xwin.c:3246: warning: assignment makes pointer from integer without a cast xwin.c:3248: error: structure has no member named `display' xwin.c:3250: error: structure has no member named `display' xwin.c:3250: error: structure has no member named `pixmap' xwin.c:3251: error: `AllPlanes' undeclared (first use in this function) xwin.c:3251: error: `ZPixmap' undeclared (first use in this function) xwin.c:3254: error: structure has no member named `display' xwin.c:3254: error: structure has no member named `window' xwin.c:3333: error: `curcolor' undeclared (first use in this function) xwin.c:3333: error: structure has no member named `cmap1' xwin.c:3335: error: structure has no member named `fgcolor' xwin.c:3375: error: structure has no member named `display' xwin.c:3375: error: structure has no member named `pixmap' xwin.c:3375: error: structure has no member named `gc' xwin.c:3378: error: structure has no member named `display' xwin.c:3378: error: structure has no member named `window' xwin.c:3378: error: structure has no member named `gc' xwin.c: In function `imageops': xwin.c:3406: error: structure has no member named `display' gmake[2]: *** [xwin.lo] Error 1 gmake[2]: Leaving directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' gmake[1]: *** [all-recursive] Error 1 gmake[1]: Leaving directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' gmake: *** [all-recursive] Error 1 gama# ^Dexit Script done on Tue Mar 17 09:17:41 2009 From mincloud at gmail.com Wed Mar 18 13:43:39 2009 From: mincloud at gmail.com (yun zheng) Date: Wed, 18 Mar 2009 21:43:39 +0800 Subject: [EMBOSS] make error In-Reply-To: <60593.86.9.126.186.1237367389.squirrel@webmail.ebi.ac.uk> References: <8f6eb9540903172212n289d21e2y1b42c517645aac6c@mail.gmail.com> <60593.86.9.126.186.1237367389.squirrel@webmail.ebi.ac.uk> Message-ID: <8f6eb9540903180643o1eb465ccq1e39096aa59026a7@mail.gmail.com> Alan, Many thanks. I solved the problem successfully. Best regards. sincerely zheng, yun On Wed, Mar 18, 2009 at 5:09 PM, wrote: > Hi, > > You need to install the X11 development files for CentOS from > your DVD. For that Linux distribution the RPM is probably called > 'xorg-x11-proto-devel'. While you're doing that you > may want to install the 'gd-devel' RPM at the same time > (which will enable PNG support). > > After that do a 'make clean' and redo the './configure' step. > > The FAQ does give a hint to the above but I'll see whether > it needs updating for CentOS. > > Alan > > > > Hi, I met a lot of errors when I typed make in EMBOSS 6.0.1 folder. > > > > #./configure > > #make > > ... > > xwin.c:3394: error: 'XwDev' has no member named 'write_to_window' > > xwin.c:3398: error: 'XwDev' has no member named 'write_to_window' > > xwin.c:3402: error: 'XwDev' has no member named 'write_to_pixmap' > > xwin.c:3406: error: 'XwDisplay' has no member named 'display' > > xwin.c:3407: error: 'XwDev' has no member named 'write_to_pixmap' > > make[2]: *** [xwin.lo] Error 1 > > make[2]: Leaving directory > > `/home/zhengy/software/EMBOSS-6.0.1/EMBOSS-6.0.1/plplot' > > make[1]: *** [all-recursive] Error 1 > > make[1]: Leaving directory > > `/home/zhengy/software/EMBOSS-6.0.1/EMBOSS-6.0.1/plplot' > > make: *** [all-recursive] Error 1 > > > > My machine is installed with a 64-bit GNU Linux (CentOS). > > # uname -a > > Linux IDM-DNA 2.6.18-92.1.22.el5 #1 SMP Tue Dec 16 11:57:43 EST 2008 > > x86_64 > > x86_64 x86_64 GNU/Linux > > > > Could you help me to solve the problem? > > > > Many thanks. > > > > sincerely > > zheng, yun > > > > Institute of Deveopmental Biology and Molecular Medicine > > Fudan University > > 200 Handan Rd > > Shanghai, China 200433 > > _______________________________________________ > > EMBOSS mailing list > > EMBOSS at lists.open-bio.org > > http://lists.open-bio.org/mailman/listinfo/emboss > > > > > From fernan at iib.unsam.edu.ar Tue Mar 17 21:52:40 2009 From: fernan at iib.unsam.edu.ar (Fernan Aguero) Date: Tue, 17 Mar 2009 18:52:40 -0300 Subject: [EMBOSS] emboss-6.0.1 fails to build without X Message-ID: <20090317215240.GH34389@iib.unsam.edu.ar> ./configure --without-x [ ... succeeds ... ] make [ ... fails ... ] [ lots of errors from xwin.c ...] xwin.c: In function `imageops': xwin.c:3406: error: structure has no member named `display' *** Error code 1 This is on FreeBSD-6.3, gcc-3.4.6, gnu make 3.81 Typescript is attached. Cheers, Fernan -------------- next part -------------- Script started on Tue Mar 17 09:15:38 2009 gama# ./configfgguure --without-x checking for a BSD-compatible install... /usr/bin/install -c checking whether build environment is sane... yes checking for a thread-safe mkdir -p... ./install-sh -c -d checking for gawk... no checking for mawk... no checking for nawk... nawk checking whether make sets $(MAKE)... yes checking for gawk... (cached) nawk checking for gcc... gcc checking for C compiler default output file name... a.out checking whether the C compiler works... yes checking whether we are cross compiling... no checking for suffix of executables... checking for suffix of object files... o checking whether we are using the GNU C compiler... yes checking whether gcc accepts -g... yes checking for gcc option to accept ISO C89... none needed checking for style of include used by make... GNU checking dependency style of gcc... gcc3 checking how to run the C preprocessor... gcc -E checking build system type... i386-unknown-freebsd6.3 checking host system type... i386-unknown-freebsd6.3 checking for a sed that does not truncate output... /usr/bin/sed checking for grep that handles long lines and -e... /usr/bin/grep checking for egrep... /usr/bin/grep -E checking for ld used by gcc... /usr/bin/ld checking if the linker (/usr/bin/ld) is GNU ld... yes checking for /usr/bin/ld option to reload object files... -r checking for BSD-compatible nm... /usr/bin/nm -B checking whether ln -s works... yes checking how to recognize dependent libraries... pass_all checking for ANSI C header files... yes checking for sys/types.h... yes checking for sys/stat.h... yes checking for stdlib.h... yes checking for string.h... yes checking for memory.h... yes checking for strings.h... yes checking for inttypes.h... yes checking for stdint.h... yes checking for unistd.h... yes checking dlfcn.h usability... yes checking dlfcn.h presence... yes checking for dlfcn.h... yes checking for g++... g++ checking whether we are using the GNU C++ compiler... yes checking whether g++ accepts -g... yes checking dependency style of g++... gcc3 checking how to run the C++ preprocessor... g++ -E checking for g77... no checking for xlf... no checking for f77... f77 checking whether we are using the GNU Fortran 77 compiler... yes checking whether f77 accepts -g... yes checking the maximum length of command line arguments... 196608 checking command to parse /usr/bin/nm -B output from gcc object... ok checking for objdir... .libs checking for ar... ar checking for ranlib... ranlib checking for strip... strip checking if gcc supports -fno-rtti -fno-exceptions... no checking for gcc option to produce PIC... -fPIC checking if gcc PIC flag -fPIC works... yes checking if gcc static flag -static works... yes checking if gcc supports -c -o file.o... yes checking whether the gcc linker (/usr/bin/ld) supports shared libraries... yes checking whether -lc should be explicitly linked in... yes checking dynamic linker characteristics... freebsd6.3 ld.so checking how to hardcode library paths into programs... immediate checking whether stripping libraries is possible... yes checking if libtool supports shared libraries... yes checking whether to build shared libraries... yes checking whether to build static libraries... yes configure: creating libtool appending configuration tag "CXX" to libtool checking for ld used by g++... /usr/bin/ld checking if the linker (/usr/bin/ld) is GNU ld... yes checking whether the g++ linker (/usr/bin/ld) supports shared libraries... yes checking for g++ option to produce PIC... -fPIC checking if g++ PIC flag -fPIC works... yes checking if g++ static flag -static works... yes checking if g++ supports -c -o file.o... yes checking whether the g++ linker (/usr/bin/ld) supports shared libraries... yes checking dynamic linker characteristics... freebsd6.3 ld.so checking how to hardcode library paths into programs... immediate appending configuration tag "F77" to libtool checking if libtool supports shared libraries... yes checking whether to build shared libraries... yes checking whether to build static libraries... yes checking for f77 option to produce PIC... -fPIC checking if f77 PIC flag -fPIC works... yes checking if f77 static flag -static works... yes checking if f77 supports -c -o file.o... yes checking whether the f77 linker (/usr/bin/ld) supports shared libraries... yes checking dynamic linker characteristics... freebsd6.3 ld.so checking how to hardcode library paths into programs... immediate checking whether byte ordering is bigendian... no checking for a BSD-compatible install... /usr/bin/install -c checking whether ln -s works... yes checking whether make sets $(MAKE)... (cached) yes checking for ranlib... (cached) ranlib checking for X... disabled checking for dirent.h that defines DIR... yes checking for library containing opendir... none required checking for ANSI C header files... (cached) yes checking for unistd.h... (cached) yes checking for an ANSI C-conforming const... yes checking for pid_t... yes checking for size_t... yes checking whether struct tm is in sys/time.h or time.h... time.h checking whether getpgrp requires zero arguments... yes checking for strftime... yes checking vfork.h usability... no checking vfork.h presence... no checking for vfork.h... no checking for fork... yes checking for vfork... yes checking for working fork... yes checking for working vfork... (cached) yes checking for vprintf... yes checking for _doprnt... no checking for memmove... yes checking for gethostbyname in -lc... yes checking for socket in -lc... yes checking for main in -lm... yes ./configure: line 23442: !=: command not found checking if docroot is given... no checking if gcc profiling is selected... no checking if java include directory given... no checking if java OS include directory given... no checking if png driver is wanted... yes checking for inflateEnd in -lz... yes checking for png_destroy_read_struct in -lpng... no No png driver will be made due to librarys missing/old. checking if any authorisation type is given... no checking for gdome2... no checking if Linux x86_64... no checking for large file support... done checking for purify... no checking for cygwin... no checking for mprobe... no checking for savestats... no checking if any threading type is given... no configure: creating ./config.status config.status: creating plplot/Makefile config.status: creating plplot/lib/Makefile config.status: creating nucleus/Makefile config.status: creating ajax/Makefile config.status: creating emboss/Makefile config.status: creating emboss/acd/Makefile config.status: creating test/Makefile config.status: creating test/data/Makefile config.status: creating test/embl/Makefile config.status: creating test/genbank/Makefile config.status: creating test/gb/Makefile config.status: creating test/pir/Makefile config.status: creating test/swiss/Makefile config.status: creating test/swnew/Makefile config.status: creating test/testdb/Makefile config.status: creating test/wormpep/Makefile config.status: creating emboss/data/Makefile config.status: creating emboss/data/AAINDEX/Makefile config.status: creating emboss/data/CODONS/Makefile config.status: creating emboss/data/REBASE/Makefile config.status: creating emboss/data/JASPAR_CORE/Makefile config.status: creating emboss/data/JASPAR_FAM/Makefile config.status: creating emboss/data/JASPAR_PHYLOFACTS/Makefile config.status: creating emboss/data/JASPAR_CNE/Makefile config.status: creating emboss/data/JASPAR_POLII/Makefile config.status: creating emboss/data/JASPAR_SPLICE/Makefile config.status: creating emboss/data/PRINTS/Makefile config.status: creating emboss/data/PROSITE/Makefile config.status: creating doc/Makefile config.status: creating doc/manuals/Makefile config.status: creating doc/tutorials/Makefile config.status: creating doc/programs/Makefile config.status: creating doc/programs/html/Makefile config.status: creating doc/programs/text/Makefile config.status: creating jemboss/Makefile config.status: creating jemboss/api/Makefile config.status: creating jemboss/api/org/Makefile config.status: creating jemboss/api/org/emboss/Makefile config.status: creating jemboss/api/org/emboss/jemboss/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/filetree/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/form/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/sequenceChooser/Makefile config.status: creating jemboss/api/org/emboss/jemboss/gui/startup/Makefile config.status: creating jemboss/api/org/emboss/jemboss/parser/Makefile config.status: creating jemboss/api/org/emboss/jemboss/parser/acd/Makefile config.status: creating jemboss/api/org/emboss/jemboss/programs/Makefile config.status: creating jemboss/api/org/emboss/jemboss/soap/Makefile config.status: creating jemboss/images/Makefile config.status: creating jemboss/lib/Makefile config.status: creating jemboss/lib/axis/Makefile config.status: creating jemboss/org/Makefile config.status: creating jemboss/org/emboss/Makefile config.status: creating jemboss/org/emboss/jemboss/Makefile config.status: creating jemboss/org/emboss/jemboss/graphics/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/filetree/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/form/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/startup/Makefile config.status: creating jemboss/org/emboss/jemboss/gui/sequenceChooser/Makefile config.status: creating jemboss/org/emboss/jemboss/parser/Makefile config.status: creating jemboss/org/emboss/jemboss/parser/acd/Makefile config.status: creating jemboss/org/emboss/jemboss/programs/Makefile config.status: creating jemboss/org/emboss/jemboss/server/Makefile config.status: creating jemboss/org/emboss/jemboss/soap/Makefile config.status: creating jemboss/org/emboss/jemboss/editor/Makefile config.status: creating jemboss/org/emboss/jemboss/draw/Makefile config.status: creating jemboss/resources/Makefile config.status: creating jemboss/utils/Makefile config.status: creating Makefile config.status: executing depfiles commands gama# gmake Making all in plplot gmake[1]: Entering directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' Making all in lib gmake[2]: Entering directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot/lib' gmake[2]: Nothing to be done for `all'. gmake[2]: Leaving directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot/lib' gmake[2]: Entering directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pdfutils.lo -MD -MP -MF .deps/pdfutils.Tpo -c -o pdfutils.lo pdfutils.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pdfutils.lo -MD -MP -MF .deps/pdfutils.Tpo -c pdfutils.c -fPIC -DPIC -o .libs/pdfutils.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pdfutils.lo -MD -MP -MF .deps/pdfutils.Tpo -c pdfutils.c -o pdfutils.o >/dev/null 2>&1 mv -f .deps/pdfutils.Tpo .deps/pdfutils.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plargs.lo -MD -MP -MF .deps/plargs.Tpo -c -o plargs.lo plargs.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plargs.lo -MD -MP -MF .deps/plargs.Tpo -c plargs.c -fPIC -DPIC -o .libs/plargs.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plargs.lo -MD -MP -MF .deps/plargs.Tpo -c plargs.c -o plargs.o >/dev/null 2>&1 mv -f .deps/plargs.Tpo .deps/plargs.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbox.lo -MD -MP -MF .deps/plbox.Tpo -c -o plbox.lo plbox.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbox.lo -MD -MP -MF .deps/plbox.Tpo -c plbox.c -fPIC -DPIC -o .libs/plbox.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbox.lo -MD -MP -MF .deps/plbox.Tpo -c plbox.c -o plbox.o >/dev/null 2>&1 mv -f .deps/plbox.Tpo .deps/plbox.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcont.lo -MD -MP -MF .deps/plcont.Tpo -c -o plcont.lo plcont.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcont.lo -MD -MP -MF .deps/plcont.Tpo -c plcont.c -fPIC -DPIC -o .libs/plcont.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcont.lo -MD -MP -MF .deps/plcont.Tpo -c plcont.c -o plcont.o >/dev/null 2>&1 mv -f .deps/plcont.Tpo .deps/plcont.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcore.lo -MD -MP -MF .deps/plcore.Tpo -c -o plcore.lo plcore.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcore.lo -MD -MP -MF .deps/plcore.Tpo -c plcore.c -fPIC -DPIC -o .libs/plcore.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcore.lo -MD -MP -MF .deps/plcore.Tpo -c plcore.c -o plcore.o >/dev/null 2>&1 mv -f .deps/plcore.Tpo .deps/plcore.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plctrl.lo -MD -MP -MF .deps/plctrl.Tpo -c -o plctrl.lo plctrl.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plctrl.lo -MD -MP -MF .deps/plctrl.Tpo -c plctrl.c -fPIC -DPIC -o .libs/plctrl.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plctrl.lo -MD -MP -MF .deps/plctrl.Tpo -c plctrl.c -o plctrl.o >/dev/null 2>&1 mv -f .deps/plctrl.Tpo .deps/plctrl.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcvt.lo -MD -MP -MF .deps/plcvt.Tpo -c -o plcvt.lo plcvt.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcvt.lo -MD -MP -MF .deps/plcvt.Tpo -c plcvt.c -fPIC -DPIC -o .libs/plcvt.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plcvt.lo -MD -MP -MF .deps/plcvt.Tpo -c plcvt.c -o plcvt.o >/dev/null 2>&1 mv -f .deps/plcvt.Tpo .deps/plcvt.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pldtik.lo -MD -MP -MF .deps/pldtik.Tpo -c -o pldtik.lo pldtik.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pldtik.lo -MD -MP -MF .deps/pldtik.Tpo -c pldtik.c -fPIC -DPIC -o .libs/pldtik.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pldtik.lo -MD -MP -MF .deps/pldtik.Tpo -c pldtik.c -o pldtik.o >/dev/null 2>&1 mv -f .deps/pldtik.Tpo .deps/pldtik.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plfill.lo -MD -MP -MF .deps/plfill.Tpo -c -o plfill.lo plfill.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plfill.lo -MD -MP -MF .deps/plfill.Tpo -c plfill.c -fPIC -DPIC -o .libs/plfill.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plfill.lo -MD -MP -MF .deps/plfill.Tpo -c plfill.c -o plfill.o >/dev/null 2>&1 mv -f .deps/plfill.Tpo .deps/plfill.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plhist.lo -MD -MP -MF .deps/plhist.Tpo -c -o plhist.lo plhist.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plhist.lo -MD -MP -MF .deps/plhist.Tpo -c plhist.c -fPIC -DPIC -o .libs/plhist.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plhist.lo -MD -MP -MF .deps/plhist.Tpo -c plhist.c -o plhist.o >/dev/null 2>&1 mv -f .deps/plhist.Tpo .deps/plhist.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plline.lo -MD -MP -MF .deps/plline.Tpo -c -o plline.lo plline.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plline.lo -MD -MP -MF .deps/plline.Tpo -c plline.c -fPIC -DPIC -o .libs/plline.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plline.lo -MD -MP -MF .deps/plline.Tpo -c plline.c -o plline.o >/dev/null 2>&1 mv -f .deps/plline.Tpo .deps/plline.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmap.lo -MD -MP -MF .deps/plmap.Tpo -c -o plmap.lo plmap.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmap.lo -MD -MP -MF .deps/plmap.Tpo -c plmap.c -fPIC -DPIC -o .libs/plmap.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmap.lo -MD -MP -MF .deps/plmap.Tpo -c plmap.c -o plmap.o >/dev/null 2>&1 mv -f .deps/plmap.Tpo .deps/plmap.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plot3d.lo -MD -MP -MF .deps/plot3d.Tpo -c -o plot3d.lo plot3d.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plot3d.lo -MD -MP -MF .deps/plot3d.Tpo -c plot3d.c -fPIC -DPIC -o .libs/plot3d.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plot3d.lo -MD -MP -MF .deps/plot3d.Tpo -c plot3d.c -o plot3d.o >/dev/null 2>&1 mv -f .deps/plot3d.Tpo .deps/plot3d.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plpage.lo -MD -MP -MF .deps/plpage.Tpo -c -o plpage.lo plpage.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plpage.lo -MD -MP -MF .deps/plpage.Tpo -c plpage.c -fPIC -DPIC -o .libs/plpage.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plpage.lo -MD -MP -MF .deps/plpage.Tpo -c plpage.c -o plpage.o >/dev/null 2>&1 mv -f .deps/plpage.Tpo .deps/plpage.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsdef.lo -MD -MP -MF .deps/plsdef.Tpo -c -o plsdef.lo plsdef.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsdef.lo -MD -MP -MF .deps/plsdef.Tpo -c plsdef.c -fPIC -DPIC -o .libs/plsdef.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsdef.lo -MD -MP -MF .deps/plsdef.Tpo -c plsdef.c -o plsdef.o >/dev/null 2>&1 mv -f .deps/plsdef.Tpo .deps/plsdef.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plshade.lo -MD -MP -MF .deps/plshade.Tpo -c -o plshade.lo plshade.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plshade.lo -MD -MP -MF .deps/plshade.Tpo -c plshade.c -fPIC -DPIC -o .libs/plshade.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plshade.lo -MD -MP -MF .deps/plshade.Tpo -c plshade.c -o plshade.o >/dev/null 2>&1 mv -f .deps/plshade.Tpo .deps/plshade.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsym.lo -MD -MP -MF .deps/plsym.Tpo -c -o plsym.lo plsym.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsym.lo -MD -MP -MF .deps/plsym.Tpo -c plsym.c -fPIC -DPIC -o .libs/plsym.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plsym.lo -MD -MP -MF .deps/plsym.Tpo -c plsym.c -o plsym.o >/dev/null 2>&1 mv -f .deps/plsym.Tpo .deps/plsym.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pltick.lo -MD -MP -MF .deps/pltick.Tpo -c -o pltick.lo pltick.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pltick.lo -MD -MP -MF .deps/pltick.Tpo -c pltick.c -fPIC -DPIC -o .libs/pltick.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pltick.lo -MD -MP -MF .deps/pltick.Tpo -c pltick.c -o pltick.o >/dev/null 2>&1 mv -f .deps/pltick.Tpo .deps/pltick.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plvpor.lo -MD -MP -MF .deps/plvpor.Tpo -c -o plvpor.lo plvpor.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plvpor.lo -MD -MP -MF .deps/plvpor.Tpo -c plvpor.c -fPIC -DPIC -o .libs/plvpor.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plvpor.lo -MD -MP -MF .deps/plvpor.Tpo -c plvpor.c -o plvpor.o >/dev/null 2>&1 mv -f .deps/plvpor.Tpo .deps/plvpor.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plwind.lo -MD -MP -MF .deps/plwind.Tpo -c -o plwind.lo plwind.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plwind.lo -MD -MP -MF .deps/plwind.Tpo -c plwind.c -fPIC -DPIC -o .libs/plwind.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plwind.lo -MD -MP -MF .deps/plwind.Tpo -c plwind.c -o plwind.o >/dev/null 2>&1 mv -f .deps/plwind.Tpo .deps/plwind.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plstripc.lo -MD -MP -MF .deps/plstripc.Tpo -c -o plstripc.lo plstripc.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plstripc.lo -MD -MP -MF .deps/plstripc.Tpo -c plstripc.c -fPIC -DPIC -o .libs/plstripc.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plstripc.lo -MD -MP -MF .deps/plstripc.Tpo -c plstripc.c -o plstripc.o >/dev/null 2>&1 mv -f .deps/plstripc.Tpo .deps/plstripc.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT hpgl.lo -MD -MP -MF .deps/hpgl.Tpo -c -o hpgl.lo hpgl.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT hpgl.lo -MD -MP -MF .deps/hpgl.Tpo -c hpgl.c -fPIC -DPIC -o .libs/hpgl.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT hpgl.lo -MD -MP -MF .deps/hpgl.Tpo -c hpgl.c -o hpgl.o >/dev/null 2>&1 mv -f .deps/hpgl.Tpo .deps/hpgl.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT impress.lo -MD -MP -MF .deps/impress.Tpo -c -o impress.lo impress.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT impress.lo -MD -MP -MF .deps/impress.Tpo -c impress.c -fPIC -DPIC -o .libs/impress.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT impress.lo -MD -MP -MF .deps/impress.Tpo -c impress.c -o impress.o >/dev/null 2>&1 mv -f .deps/impress.Tpo .deps/impress.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljiip.lo -MD -MP -MF .deps/ljiip.Tpo -c -o ljiip.lo ljiip.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljiip.lo -MD -MP -MF .deps/ljiip.Tpo -c ljiip.c -fPIC -DPIC -o .libs/ljiip.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljiip.lo -MD -MP -MF .deps/ljiip.Tpo -c ljiip.c -o ljiip.o >/dev/null 2>&1 mv -f .deps/ljiip.Tpo .deps/ljiip.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljii.lo -MD -MP -MF .deps/ljii.Tpo -c -o ljii.lo ljii.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljii.lo -MD -MP -MF .deps/ljii.Tpo -c ljii.c -fPIC -DPIC -o .libs/ljii.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ljii.lo -MD -MP -MF .deps/ljii.Tpo -c ljii.c -o ljii.o >/dev/null 2>&1 mv -f .deps/ljii.Tpo .deps/ljii.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT null.lo -MD -MP -MF .deps/null.Tpo -c -o null.lo null.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT null.lo -MD -MP -MF .deps/null.Tpo -c null.c -fPIC -DPIC -o .libs/null.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT null.lo -MD -MP -MF .deps/null.Tpo -c null.c -o null.o >/dev/null 2>&1 mv -f .deps/null.Tpo .deps/null.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT data.lo -MD -MP -MF .deps/data.Tpo -c -o data.lo data.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT data.lo -MD -MP -MF .deps/data.Tpo -c data.c -fPIC -DPIC -o .libs/data.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT data.lo -MD -MP -MF .deps/data.Tpo -c data.c -o data.o >/dev/null 2>&1 mv -f .deps/data.Tpo .deps/data.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pbm.lo -MD -MP -MF .deps/pbm.Tpo -c -o pbm.lo pbm.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pbm.lo -MD -MP -MF .deps/pbm.Tpo -c pbm.c -fPIC -DPIC -o .libs/pbm.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT pbm.lo -MD -MP -MF .deps/pbm.Tpo -c pbm.c -o pbm.o >/dev/null 2>&1 mv -f .deps/pbm.Tpo .deps/pbm.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbuf.lo -MD -MP -MF .deps/plbuf.Tpo -c -o plbuf.lo plbuf.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbuf.lo -MD -MP -MF .deps/plbuf.Tpo -c plbuf.c -fPIC -DPIC -o .libs/plbuf.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plbuf.lo -MD -MP -MF .deps/plbuf.Tpo -c plbuf.c -o plbuf.o >/dev/null 2>&1 mv -f .deps/plbuf.Tpo .deps/plbuf.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmeta.lo -MD -MP -MF .deps/plmeta.Tpo -c -o plmeta.lo plmeta.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmeta.lo -MD -MP -MF .deps/plmeta.Tpo -c plmeta.c -fPIC -DPIC -o .libs/plmeta.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT plmeta.lo -MD -MP -MF .deps/plmeta.Tpo -c plmeta.c -o plmeta.o >/dev/null 2>&1 mv -f .deps/plmeta.Tpo .deps/plmeta.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ps.lo -MD -MP -MF .deps/ps.Tpo -c -o ps.lo ps.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ps.lo -MD -MP -MF .deps/ps.Tpo -c ps.c -fPIC -DPIC -o .libs/ps.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT ps.lo -MD -MP -MF .deps/ps.Tpo -c ps.c -o ps.o >/dev/null 2>&1 mv -f .deps/ps.Tpo .deps/ps.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT tek.lo -MD -MP -MF .deps/tek.Tpo -c -o tek.lo tek.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT tek.lo -MD -MP -MF .deps/tek.Tpo -c tek.c -fPIC -DPIC -o .libs/tek.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT tek.lo -MD -MP -MF .deps/tek.Tpo -c tek.c -o tek.o >/dev/null 2>&1 mv -f .deps/tek.Tpo .deps/tek.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xfig.lo -MD -MP -MF .deps/xfig.Tpo -c -o xfig.lo xfig.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xfig.lo -MD -MP -MF .deps/xfig.Tpo -c xfig.c -fPIC -DPIC -o .libs/xfig.o gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xfig.lo -MD -MP -MF .deps/xfig.Tpo -c xfig.c -o xfig.o >/dev/null 2>&1 mv -f .deps/xfig.Tpo .deps/xfig.Plo /usr/local/bin/bash /usr/local/bin/libtool --tag=CC --mode=compile gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xwin.lo -MD -MP -MF .deps/xwin.Tpo -c -o xwin.lo xwin.c gcc -DPACKAGE_NAME=\"\" -DPACKAGE_TARNAME=\"\" -DPACKAGE_VERSION=\"\" -DPACKAGE_STRING=\"\" -DPACKAGE_BUGREPORT=\"\" -DPACKAGE=\"EMBOSS\" -DVERSION=\"6.0.1\" -DSTDC_HEADERS=1 -DHAVE_SYS_TYPES_H=1 -DHAVE_SYS_STAT_H=1 -DHAVE_STDLIB_H=1 -DHAVE_STRING_H=1 -DHAVE_MEMORY_H=1 -DHAVE_STRINGS_H=1 -DHAVE_INTTYPES_H=1 -DHAVE_STDINT_H=1 -DHAVE_UNISTD_H=1 -DHAVE_DLFCN_H=1 -DX_DISPLAY_MISSING=1 -DHAVE_DIRENT_H=1 -DSTDC_HEADERS=1 -DHAVE_UNISTD_H=1 -DGETPGRP_VOID=1 -DHAVE_STRFTIME=1 -DHAVE_FORK=1 -DHAVE_VFORK=1 -DHAVE_WORKING_VFORK=1 -DHAVE_WORKING_FORK=1 -DHAVE_VPRINTF=1 -DHAVE_MEMMOVE=1 -DHAVE_LIBM=1 -I. -I./ -I/usr/include/gd -DPREFIX=\"/usr/local\" -DBUILD_DIR=\".\" -DDRV_DIR=\".\" -DEMBOSS_TOP=\"/usr/ports/biology/emboss/work/EMBOSS-6.0.1\" -DAJ_FreeBSDLF -DLENDIAN -DNO_AUTH -O2 -MT xwin.lo -MD -MP -MF .deps/xwin.Tpo -c xwin.c -fPIC -DPIC -o .libs/xwin.o In file included from xwin.c:34: plxwd.h:22:22: X11/Xlib.h: No such file or directory plxwd.h:23:23: X11/Xutil.h: No such file or directory plxwd.h:24:28: X11/cursorfont.h: No such file or directory plxwd.h:25:24: X11/keysym.h: No such file or directory In file included from xwin.c:34: plxwd.h:51: error: syntax error before "Display" plxwd.h:61: error: syntax error before "XColor" plxwd.h:76: error: syntax error before "Window" plxwd.h:107: error: syntax error before "XPoint" plxwd.h:109: error: syntax error before "XEvent" xwin.c:119: error: syntax error before "sxwm_colors" xwin.c:119: warning: data definition has no type or storage class xwin.c:154: error: syntax error before '*' token xwin.c:164: error: syntax error before "XEvent" xwin.c:165: error: syntax error before "XEvent" xwin.c:166: error: syntax error before "XEvent" xwin.c:167: error: syntax error before "XEvent" xwin.c:168: error: syntax error before "XEvent" xwin.c:169: error: syntax error before "XEvent" xwin.c:170: error: syntax error before "XEvent" xwin.c:171: error: syntax error before "XEvent" xwin.c:172: error: syntax error before "XEvent" xwin.c:173: error: syntax error before "XEvent" xwin.c:208: error: syntax error before "XColor" xwin.c:209: error: syntax error before "XColor" xwin.c: In function `plD_line_xw': xwin.c:375: error: structure has no member named `display' xwin.c:375: error: structure has no member named `window' xwin.c:375: error: structure has no member named `gc' xwin.c:378: error: structure has no member named `display' xwin.c:378: error: structure has no member named `pixmap' xwin.c:378: error: structure has no member named `gc' xwin.c: In function `XorMod': xwin.c:399: error: structure has no member named `display' xwin.c:399: error: structure has no member named `gc' xwin.c:399: error: `GXcopy' undeclared (first use in this function) xwin.c:399: error: (Each undeclared identifier is reported only once xwin.c:399: error: for each function it appears in.) xwin.c:401: error: structure has no member named `display' xwin.c:401: error: structure has no member named `gc' xwin.c:401: error: `GXxor' undeclared (first use in this function) xwin.c: In function `plD_polyline_xw': xwin.c:417: error: syntax error before "pts" xwin.c:432: error: `pts' undeclared (first use in this function) xwin.c:437: error: structure has no member named `display' xwin.c:437: error: structure has no member named `window' xwin.c:437: error: structure has no member named `gc' xwin.c:438: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:441: error: structure has no member named `display' xwin.c:441: error: structure has no member named `pixmap' xwin.c:441: error: structure has no member named `gc' xwin.c: In function `plD_eop_xw': xwin.c:469: error: structure has no member named `display' xwin.c: In function `plD_bop_xw': xwin.c:502: error: structure has no member named `display' xwin.c:502: error: structure has no member named `window' xwin.c:505: error: structure has no member named `display' xwin.c:505: error: structure has no member named `gc' xwin.c:505: error: structure has no member named `cmap0' xwin.c:506: error: structure has no member named `display' xwin.c:506: error: structure has no member named `pixmap' xwin.c:506: error: structure has no member named `gc' xwin.c:508: error: structure has no member named `display' xwin.c:508: error: structure has no member named `gc' xwin.c:508: error: structure has no member named `curcolor' xwin.c:510: error: structure has no member named `display' xwin.c: In function `plD_tidy_xw': xwin.c:547: error: structure has no member named `display' xwin.c:547: error: structure has no member named `window' xwin.c:549: error: structure has no member named `display' xwin.c:549: error: structure has no member named `pixmap' xwin.c:550: error: structure has no member named `display' xwin.c:556: error: structure has no member named `display' xwin.c:556: error: structure has no member named `gc' xwin.c:557: error: structure has no member named `display' xwin.c:557: error: structure has no member named `gcXor' xwin.c:558: error: structure has no member named `display' xwin.c:559: error: structure has no member named `cmap0' xwin.c:559: error: structure has no member named `cmap0' xwin.c:559: error: structure has no member named `cmap0' xwin.c:560: error: structure has no member named `cmap1' xwin.c:560: error: structure has no member named `cmap1' xwin.c:560: error: structure has no member named `cmap1' xwin.c: In function `plD_state_xw': xwin.c:592: error: structure has no member named `display' xwin.c:592: error: structure has no member named `gc' xwin.c:593: error: `LineSolid' undeclared (first use in this function) xwin.c:593: error: `CapRound' undeclared (first use in this function) xwin.c:593: error: `JoinMiter' undeclared (first use in this function) xwin.c:600: error: structure has no member named `curcolor' xwin.c:601: error: structure has no member named `display' xwin.c:601: error: structure has no member named `map' xwin.c:601: error: structure has no member named `curcolor' xwin.c:603: error: structure has no member named `curcolor' xwin.c:603: error: structure has no member named `fgcolor' xwin.c:606: error: structure has no member named `curcolor' xwin.c:606: error: structure has no member named `cmap0' xwin.c:608: error: structure has no member named `display' xwin.c:608: error: structure has no member named `gc' xwin.c:608: error: structure has no member named `curcolor' xwin.c:611: error: structure has no member named `curcolor' xwin.c:611: error: structure has no member named `fgcolor' xwin.c:612: error: structure has no member named `display' xwin.c:612: error: structure has no member named `gc' xwin.c:612: error: structure has no member named `curcolor' xwin.c:628: error: structure has no member named `curcolor' xwin.c:628: error: structure has no member named `cmap1' xwin.c:630: error: structure has no member named `curcolor' xwin.c:630: error: structure has no member named `fgcolor' xwin.c:632: error: structure has no member named `display' xwin.c:632: error: structure has no member named `gc' xwin.c:632: error: structure has no member named `curcolor' xwin.c: In function `plD_esc_xw': xwin.c:712: error: structure has no member named `display' xwin.c:744: error: `XColor' undeclared (first use in this function) xwin.c:744: error: syntax error before ')' token xwin.c:748: error: syntax error before ')' token xwin.c: In function `GetCursorCmd': xwin.c:777: error: syntax error before "event" xwin.c:789: error: structure has no member named `display' xwin.c:789: error: structure has no member named `window' xwin.c:789: error: `event' undeclared (first use in this function) xwin.c: In function `FillPolygonCmd': xwin.c:811: error: syntax error before "pts" xwin.c:820: error: `pts' undeclared (first use in this function) xwin.c:827: error: structure has no member named `display' xwin.c:827: error: structure has no member named `window' xwin.c:827: error: structure has no member named `gc' xwin.c:828: error: `Nonconvex' undeclared (first use in this function) xwin.c:828: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:831: error: structure has no member named `display' xwin.c:831: error: structure has no member named `pixmap' xwin.c:831: error: structure has no member named `gc' xwin.c:838: error: structure has no member named `display' xwin.c:838: error: structure has no member named `gc' xwin.c:838: error: structure has no member named `fgcolor' xwin.c:840: error: structure has no member named `display' xwin.c:840: error: structure has no member named `window' xwin.c:840: error: structure has no member named `gc' xwin.c:844: error: structure has no member named `display' xwin.c:844: error: structure has no member named `pixmap' xwin.c:844: error: structure has no member named `gc' xwin.c:847: error: structure has no member named `display' xwin.c:847: error: structure has no member named `gc' xwin.c:847: error: structure has no member named `curcolor' xwin.c: In function `OpenXwin': xwin.c:929: error: structure has no member named `display' xwin.c:930: error: structure has no member named `display' xwin.c:935: error: structure has no member named `display' xwin.c:937: error: structure has no member named `display' xwin.c:940: error: structure has no member named `map' xwin.c:940: error: structure has no member named `display' xwin.c:952: error: structure has no member named `display' xwin.c:958: error: structure has no member named `cmap0' xwin.c:958: error: `XColor' undeclared (first use in this function) xwin.c:958: error: syntax error before ')' token xwin.c:959: error: structure has no member named `cmap0' xwin.c: In function `Init': xwin.c:995: error: syntax error before "root" xwin.c:1008: error: structure has no member named `window' xwin.c:1014: error: structure has no member named `display' xwin.c:1014: error: structure has no member named `window' xwin.c:1014: error: structure has no member named `map' xwin.c:1018: error: structure has no member named `gc' xwin.c:1019: error: structure has no member named `gc' xwin.c:1019: error: structure has no member named `display' xwin.c:1019: error: structure has no member named `window' xwin.c:1023: error: structure has no member named `gcXor' xwin.c:1024: error: syntax error before "gcValues" xwin.c:1027: error: `gcValues' undeclared (first use in this function) xwin.c:1027: error: structure has no member named `cmap0' xwin.c:1029: error: `GXxor' undeclared (first use in this function) xwin.c:1030: error: `GCForeground' undeclared (first use in this function) xwin.c:1030: error: `GCBackground' undeclared (first use in this function) xwin.c:1030: error: `GCFunction' undeclared (first use in this function) xwin.c:1032: error: structure has no member named `gcXor' xwin.c:1032: error: structure has no member named `display' xwin.c:1032: error: structure has no member named `window' xwin.c:1037: error: structure has no member named `display' xwin.c:1037: error: structure has no member named `window' xwin.c:1037: error: `root' undeclared (first use in this function) xwin.c:1064: error: structure has no member named `display' xwin.c:1064: error: structure has no member named `window' xwin.c:1064: error: structure has no member named `cmap0' xwin.c:1065: error: structure has no member named `display' xwin.c:1065: error: structure has no member named `gc' xwin.c:1065: error: structure has no member named `cmap0' xwin.c: In function `InitMain': xwin.c:1085: error: syntax error before "root" xwin.c:1095: error: structure has no member named `display' xwin.c:1095: error: structure has no member named `display' xwin.c:1096: error: `root' undeclared (first use in this function) xwin.c:1101: error: `hint' undeclared (first use in this function) xwin.c:1103: error: `PSize' undeclared (first use in this function) xwin.c:1105: error: `USSize' undeclared (first use in this function) xwin.c:1121: error: `USPosition' undeclared (first use in this function) xwin.c:1143: error: structure has no member named `window' xwin.c:1144: error: structure has no member named `display' xwin.c:1145: error: structure has no member named `display' xwin.c:1148: error: `InputOutput' undeclared (first use in this function) xwin.c:1148: error: structure has no member named `visual' xwin.c:1151: error: structure has no member named `display' xwin.c:1151: error: structure has no member named `window' xwin.c:1152: error: `None' undeclared (first use in this function) xwin.c: In function `MapMain': xwin.c:1166: error: syntax error before "event" xwin.c:1173: error: `ButtonPressMask' undeclared (first use in this function) xwin.c:1174: error: `KeyPressMask' undeclared (first use in this function) xwin.c:1175: error: `ExposureMask' undeclared (first use in this function) xwin.c:1176: error: `ButtonMotionMask' undeclared (first use in this function) xwin.c:1177: error: `StructureNotifyMask' undeclared (first use in this function) xwin.c:1179: error: structure has no member named `display' xwin.c:1179: error: structure has no member named `window' xwin.c:1183: error: structure has no member named `display' xwin.c:1183: error: structure has no member named `window' xwin.c:1189: error: structure has no member named `display' xwin.c:1189: error: structure has no member named `window' xwin.c:1189: error: `event' undeclared (first use in this function) xwin.c:1190: error: `Expose' undeclared (first use in this function) xwin.c:1191: error: structure has no member named `display' xwin.c:1191: error: structure has no member named `window' xwin.c: In function `WaitForPage': xwin.c:1210: error: syntax error before "event" xwin.c:1215: error: structure has no member named `display' xwin.c:1215: error: structure has no member named `window' xwin.c:1215: error: `event' undeclared (first use in this function) xwin.c: In function `HandleEvents': xwin.c:1363: error: syntax error before "event" xwin.c:1365: error: structure has no member named `display' xwin.c:1365: error: structure has no member named `window' xwin.c:1366: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:1387: error: syntax error before "XEvent" xwin.c: In function `MasterEH': xwin.c:1389: error: `pls' undeclared (first use in this function) xwin.c:1392: error: `event' undeclared (first use in this function) xwin.c:1396: error: `KeyPress' undeclared (first use in this function) xwin.c:1400: error: `ButtonPress' undeclared (first use in this function) xwin.c:1404: error: `Expose' undeclared (first use in this function) xwin.c:1408: error: `ConfigureNotify' undeclared (first use in this function) xwin.c:1412: error: `MotionNotify' undeclared (first use in this function) xwin.c:1418: error: `EnterNotify' undeclared (first use in this function) xwin.c:1422: error: `LeaveNotify' undeclared (first use in this function) xwin.c: At top level: xwin.c:1435: error: syntax error before "XEvent" xwin.c: In function `KeyEH': xwin.c:1437: error: `pls' undeclared (first use in this function) xwin.c:1441: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:1455: error: syntax error before "XEvent" xwin.c: In function `ButtonEH': xwin.c:1457: error: `pls' undeclared (first use in this function) xwin.c:1461: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:1490: error: syntax error before "XEvent" xwin.c: In function `LookupXKeyEvent': xwin.c:1492: error: `pls' undeclared (first use in this function) xwin.c:1494: error: `XKeyEvent' undeclared (first use in this function) xwin.c:1494: error: `keyEvent' undeclared (first use in this function) xwin.c:1494: error: syntax error before ')' token xwin.c:1497: error: syntax error before "cs" xwin.c:1506: error: `keysym' undeclared (first use in this function) xwin.c:1506: error: `cs' undeclared (first use in this function) xwin.c:1514: error: `XK_BackSpace' undeclared (first use in this function) xwin.c:1515: error: `XK_Tab' undeclared (first use in this function) xwin.c:1516: error: `XK_Linefeed' undeclared (first use in this function) xwin.c:1517: error: `XK_Return' undeclared (first use in this function) xwin.c:1518: error: `XK_Escape' undeclared (first use in this function) xwin.c:1519: error: `XK_Delete' undeclared (first use in this function) xwin.c: At top level: xwin.c:1535: error: syntax error before "XEvent" xwin.c: In function `LookupXButtonEvent': xwin.c:1537: error: `pls' undeclared (first use in this function) xwin.c:1539: error: `XButtonEvent' undeclared (first use in this function) xwin.c:1539: error: `buttonEvent' undeclared (first use in this function) xwin.c:1539: error: syntax error before ')' token xwin.c: In function `ProcessButton': xwin.c:1628: error: `Button3' undeclared (first use in this function) xwin.c: In function `LocateKey': xwin.c:1729: error: structure has no member named `display' xwin.c:1729: error: structure has no member named `window' xwin.c:1729: error: `None' undeclared (first use in this function) xwin.c: In function `LocateButton': xwin.c:1755: error: `Button1' undeclared (first use in this function) xwin.c: At top level: xwin.c:1840: error: syntax error before "XEvent" xwin.c: In function `MotionEH': xwin.c:1842: error: `pls' undeclared (first use in this function) xwin.c:1843: error: `XMotionEvent' undeclared (first use in this function) xwin.c:1843: error: `motionEvent' undeclared (first use in this function) xwin.c:1843: error: syntax error before ')' token xwin.c: At top level: xwin.c:1858: error: syntax error before "XEvent" xwin.c: In function `EnterEH': xwin.c:1860: error: `pls' undeclared (first use in this function) xwin.c:1861: error: `XCrossingEvent' undeclared (first use in this function) xwin.c:1861: error: `crossingEvent' undeclared (first use in this function) xwin.c:1861: error: syntax error before ')' token xwin.c: At top level: xwin.c:1876: error: syntax error before "XEvent" xwin.c: In function `LeaveEH': xwin.c:1878: error: `pls' undeclared (first use in this function) xwin.c:1880: error: `event' undeclared (first use in this function) xwin.c: In function `CreateXhairs': xwin.c:1896: error: syntax error before "root" xwin.c:1899: error: syntax error before "event" xwin.c:1903: error: structure has no member named `xhair_cursor' xwin.c:1904: error: structure has no member named `xhair_cursor' xwin.c:1904: error: structure has no member named `display' xwin.c:1904: error: `XC_crosshair' undeclared (first use in this function) xwin.c:1906: error: structure has no member named `display' xwin.c:1906: error: structure has no member named `window' xwin.c:1906: error: structure has no member named `xhair_cursor' xwin.c:1911: error: structure has no member named `display' xwin.c:1911: error: structure has no member named `window' xwin.c:1911: error: `root' undeclared (first use in this function) xwin.c:1911: error: `child' undeclared (first use in this function) xwin.c:1923: error: structure has no member named `display' xwin.c:1924: error: structure has no member named `display' xwin.c:1924: error: structure has no member named `window' xwin.c:1925: error: `PointerMotionMask' undeclared (first use in this function) xwin.c:1925: error: `event' undeclared (first use in this function) xwin.c:1929: error: `EnterWindowMask' undeclared (first use in this function) xwin.c:1929: error: `LeaveWindowMask' undeclared (first use in this function) xwin.c:1930: error: structure has no member named `display' xwin.c:1930: error: structure has no member named `window' xwin.c: In function `DestroyXhairs': xwin.c:1947: error: structure has no member named `display' xwin.c:1947: error: structure has no member named `window' xwin.c:1952: error: `PointerMotionMask' undeclared (first use in this function) xwin.c:1952: error: `EnterWindowMask' undeclared (first use in this function) xwin.c:1952: error: `LeaveWindowMask' undeclared (first use in this function) xwin.c:1953: error: structure has no member named `display' xwin.c:1953: error: structure has no member named `window' xwin.c: In function `DrawXhairs': xwin.c:1978: error: structure has no member named `xhair_x' xwin.c:1978: error: structure has no member named `xhair_x' xwin.c:1979: error: structure has no member named `xhair_x' xwin.c:1979: error: structure has no member named `xhair_x' xwin.c:1981: error: structure has no member named `xhair_y' xwin.c:1981: error: structure has no member named `xhair_y' xwin.c:1982: error: structure has no member named `xhair_y' xwin.c:1982: error: structure has no member named `xhair_y' xwin.c: In function `UpdateXhairs': xwin.c:1999: error: structure has no member named `display' xwin.c:1999: error: structure has no member named `window' xwin.c:1999: error: structure has no member named `gcXor' xwin.c:1999: error: structure has no member named `xhair_x' xwin.c:2000: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:2002: error: structure has no member named `display' xwin.c:2002: error: structure has no member named `window' xwin.c:2002: error: structure has no member named `gcXor' xwin.c:2002: error: structure has no member named `xhair_y' xwin.c: At top level: xwin.c:2014: error: syntax error before "XEvent" xwin.c: In function `ExposeEH': xwin.c:2016: error: `pls' undeclared (first use in this function) xwin.c:2018: error: `XExposeEvent' undeclared (first use in this function) xwin.c:2018: error: `exposeEvent' undeclared (first use in this function) xwin.c:2018: error: syntax error before ')' token xwin.c:2028: error: structure has no member named `display' xwin.c:2037: error: structure has no member named `display' xwin.c:2037: error: structure has no member named `window' xwin.c:2054: error: structure has no member named `display' xwin.c:2054: error: structure has no member named `window' xwin.c:2055: error: `ExposureMask' undeclared (first use in this function) xwin.c:2055: error: `StructureNotifyMask' undeclared (first use in this function) xwin.c:2055: error: `event' undeclared (first use in this function) xwin.c: At top level: xwin.c:2066: error: syntax error before "XEvent" xwin.c: In function `ResizeEH': xwin.c:2068: error: `pls' undeclared (first use in this function) xwin.c:2070: error: `XConfigureEvent' undeclared (first use in this function) xwin.c:2070: error: `configEvent' undeclared (first use in this function) xwin.c:2070: error: syntax error before ')' token xwin.c:2085: error: structure has no member named `display' xwin.c:2097: error: structure has no member named `display' xwin.c:2098: error: structure has no member named `display' xwin.c:2098: error: structure has no member named `window' xwin.c:2099: error: `ExposureMask' undeclared (first use in this function) xwin.c:2099: error: `StructureNotifyMask' undeclared (first use in this function) xwin.c:2099: error: `event' undeclared (first use in this function) xwin.c: In function `ExposeCmd': xwin.c:2143: error: structure has no member named `display' xwin.c:2145: error: structure has no member named `display' xwin.c:2145: error: structure has no member named `pixmap' xwin.c:2145: error: structure has no member named `window' xwin.c:2145: error: structure has no member named `gc' xwin.c:2147: error: structure has no member named `display' xwin.c:2150: error: syntax error before "pts" xwin.c:2152: error: `pts' undeclared (first use in this function) xwin.c:2158: error: structure has no member named `display' xwin.c:2158: error: structure has no member named `window' xwin.c:2158: error: structure has no member named `gc' xwin.c:2159: error: `CoordModeOrigin' undeclared (first use in this function) xwin.c:2165: error: structure has no member named `display' xwin.c: In function `ResizeCmd': xwin.c:2227: error: structure has no member named `display' xwin.c:2227: error: structure has no member named `pixmap' xwin.c:2238: error: structure has no member named `display' xwin.c:2244: error: structure has no member named `display' xwin.c:2244: error: structure has no member named `pixmap' xwin.c:2244: error: structure has no member named `window' xwin.c:2244: error: structure has no member named `gc' xwin.c:2246: error: structure has no member named `display' xwin.c: In function `RedrawCmd': xwin.c:2313: error: structure has no member named `display' xwin.c:2320: error: structure has no member named `display' xwin.c:2320: error: structure has no member named `pixmap' xwin.c:2320: error: structure has no member named `window' xwin.c:2320: error: structure has no member named `gc' xwin.c:2322: error: structure has no member named `display' xwin.c: At top level: xwin.c:2337: error: syntax error before '*' token xwin.c: In function `CreatePixmapErrorHandler': xwin.c:2339: error: `error' undeclared (first use in this function) xwin.c:2340: error: `BadAlloc' undeclared (first use in this function) xwin.c:2342: error: `display' undeclared (first use in this function) xwin.c: In function `CreatePixmap': xwin.c:2361: error: syntax error before '*' token xwin.c:2363: warning: assignment makes pointer from integer without a cast xwin.c:2365: error: `Success' undeclared (first use in this function) xwin.c:2370: error: structure has no member named `pixmap' xwin.c:2370: error: structure has no member named `display' xwin.c:2370: error: structure has no member named `window' xwin.c:2372: error: structure has no member named `display' xwin.c: In function `GetVisual': xwin.c:2407: error: syntax error before "vTemplate" xwin.c:2411: error: `vTemplate' undeclared (first use in this function) xwin.c:2414: error: `visualList' undeclared (first use in this function) xwin.c:2414: error: structure has no member named `display' xwin.c:2415: error: `VisualScreenMask' undeclared (first use in this function) xwin.c:2415: error: `VisualDepthMask' undeclared (first use in this function) xwin.c:2462: error: structure has no member named `visual' xwin.c:2469: error: structure has no member named `visual' xwin.c:2469: error: structure has no member named `display' xwin.c:2470: error: structure has no member named `display' xwin.c:2475: error: structure has no member named `visual' xwin.c:2476: error: `TrueColor' undeclared (first use in this function) xwin.c:2477: error: `StaticColor' undeclared (first use in this function) xwin.c:2478: error: `StaticGray' undeclared (first use in this function) xwin.c:2491: error: structure has no member named `visual' xwin.c:2492: error: `PseudoColor' undeclared (first use in this function) xwin.c:2495: error: `GrayScale' undeclared (first use in this function) xwin.c:2498: error: `DirectColor' undeclared (first use in this function) xwin.c: In function `AllocBGFG': xwin.c:2543: error: structure has no member named `display' xwin.c:2543: error: structure has no member named `map' xwin.c:2543: error: `False' undeclared (first use in this function) xwin.c:2547: error: structure has no member named `cmap0' xwin.c:2551: error: structure has no member named `cmap0' xwin.c:2551: error: structure has no member named `display' xwin.c:2552: error: structure has no member named `fgcolor' xwin.c:2552: error: structure has no member named `display' xwin.c:2563: error: structure has no member named `display' xwin.c:2563: error: structure has no member named `map' xwin.c:2575: error: structure has no member named `cmap0' xwin.c:2581: error: structure has no member named `fgcolor' xwin.c:2584: error: structure has no member named `display' xwin.c:2584: error: structure has no member named `map' xwin.c: In function `SetBGFG': xwin.c:2620: error: structure has no member named `cmap0' xwin.c:2639: error: structure has no member named `fgcolor' xwin.c:2644: error: structure has no member named `display' xwin.c:2644: error: structure has no member named `map' xwin.c:2644: error: structure has no member named `fgcolor' xwin.c:2645: error: structure has no member named `display' xwin.c:2645: error: structure has no member named `map' xwin.c:2645: error: structure has no member named `cmap0' xwin.c:2647: error: structure has no member named `display' xwin.c:2647: error: structure has no member named `map' xwin.c:2647: error: structure has no member named `cmap0' xwin.c:2648: error: structure has no member named `display' xwin.c:2648: error: structure has no member named `map' xwin.c:2648: error: structure has no member named `fgcolor' xwin.c: In function `AllocCustomMap': xwin.c:2710: error: syntax error before "xwm_colors" xwin.c:2719: error: `xwm_colors' undeclared (first use in this function) xwin.c:2721: error: structure has no member named `display' xwin.c:2721: error: structure has no member named `map' xwin.c:2729: error: structure has no member named `display' xwin.c:2729: error: structure has no member named `map' xwin.c:2729: error: structure has no member named `fgcolor' xwin.c:2733: error: structure has no member named `map' xwin.c:2733: error: structure has no member named `display' xwin.c:2733: error: structure has no member named `display' xwin.c:2734: error: structure has no member named `visual' xwin.c:2734: error: `AllocNone' undeclared (first use in this function) xwin.c:2740: error: structure has no member named `display' xwin.c:2740: error: structure has no member named `map' xwin.c:2740: error: `False' undeclared (first use in this function) xwin.c:2751: error: structure has no member named `display' xwin.c:2751: error: structure has no member named `map' xwin.c:2758: error: structure has no member named `display' xwin.c:2758: error: structure has no member named `map' xwin.c:2758: error: structure has no member named `cmap0' xwin.c:2759: error: structure has no member named `cmap0' xwin.c:2770: error: request for member `red' in something not a structure or union xwin.c:2771: error: request for member `green' in something not a structure or union xwin.c:2772: error: request for member `blue' in something not a structure or union xwin.c:2775: error: structure has no member named `display' xwin.c:2775: error: structure has no member named `map' xwin.c:2786: error: structure has no member named `display' xwin.c:2786: error: structure has no member named `map' xwin.c: In function `AllocCmap0': xwin.c:2811: error: structure has no member named `cmap0' xwin.c:2812: error: structure has no member named `display' xwin.c:2812: error: structure has no member named `map' xwin.c:2818: error: structure has no member named `cmap0' xwin.c:2818: error: `XColor' undeclared (first use in this function) xwin.c:2818: error: syntax error before ')' token xwin.c:2820: error: structure has no member named `cmap0' xwin.c:2832: error: structure has no member named `display' xwin.c:2832: error: structure has no member named `map' xwin.c:2832: error: `False' undeclared (first use in this function) xwin.c:2842: error: structure has no member named `cmap0' xwin.c:2853: error: syntax error before "c" xwin.c:2854: error: `c' undeclared (first use in this function) xwin.c:2855: error: structure has no member named `display' xwin.c:2855: error: structure has no member named `map' xwin.c:2859: error: structure has no member named `cmap0' xwin.c:2860: error: structure has no member named `cmap0' xwin.c:2864: error: syntax error before "screen_def" xwin.c:2872: error: structure has no member named `display' xwin.c:2872: error: structure has no member named `map' xwin.c:2874: error: `screen_def' undeclared (first use in this function) xwin.c:2874: error: `exact_def' undeclared (first use in this function) xwin.c:2882: error: structure has no member named `cmap0' xwin.c:2883: error: structure has no member named `cmap0' xwin.c:2886: error: structure has no member named `display' xwin.c:2886: error: structure has no member named `map' xwin.c:2890: error: structure has no member named `cmap0' xwin.c:2891: error: structure has no member named `cmap0' xwin.c: In function `AllocCmap1': xwin.c:2932: error: structure has no member named `display' xwin.c:2932: error: structure has no member named `map' xwin.c:2932: error: `False' undeclared (first use in this function) xwin.c:2951: error: structure has no member named `cmap1' xwin.c:2953: error: structure has no member named `cmap1' xwin.c:2953: error: `XColor' undeclared (first use in this function) xwin.c:2953: error: syntax error before ')' token xwin.c:2954: error: structure has no member named `cmap1' xwin.c:2964: error: structure has no member named `cmap1' xwin.c:2976: error: syntax error before "xcol" xwin.c:2981: error: structure has no member named `visual' xwin.c:2982: error: `TrueColor' undeclared (first use in this function) xwin.c:2990: error: structure has no member named `cmap1' xwin.c:2992: error: structure has no member named `cmap1' xwin.c:2992: error: syntax error before ')' token xwin.c:2993: error: structure has no member named `cmap1' xwin.c:2999: error: `xcol' undeclared (first use in this function) xwin.c:3001: error: structure has no member named `display' xwin.c:3001: error: structure has no member named `map' xwin.c:3005: error: structure has no member named `cmap1' xwin.c: In function `StoreCmap0': xwin.c:3041: error: structure has no member named `cmap0' xwin.c:3043: error: structure has no member named `display' xwin.c:3043: error: structure has no member named `map' xwin.c:3043: error: structure has no member named `cmap0' xwin.c:3045: error: structure has no member named `display' xwin.c:3045: error: structure has no member named `map' xwin.c:3045: error: structure has no member named `cmap0' xwin.c: In function `StoreCmap1': xwin.c:3069: error: structure has no member named `cmap1' xwin.c:3071: error: structure has no member named `display' xwin.c:3071: error: structure has no member named `map' xwin.c:3071: error: structure has no member named `cmap1' xwin.c:3073: error: structure has no member named `display' xwin.c:3073: error: structure has no member named `map' xwin.c:3073: error: structure has no member named `cmap1' xwin.c: At top level: xwin.c:3089: error: syntax error before "XColor" xwin.c: In function `PLColor_to_XColor': xwin.c:3091: error: `xcolor' undeclared (first use in this function) xwin.c:3091: error: `plcolor' undeclared (first use in this function) xwin.c:3094: error: `DoRed' undeclared (first use in this function) xwin.c:3094: error: `DoGreen' undeclared (first use in this function) xwin.c:3094: error: `DoBlue' undeclared (first use in this function) xwin.c: At top level: xwin.c:3105: error: syntax error before "XColor" xwin.c: In function `PLColor_from_XColor': xwin.c:3107: error: `plcolor' undeclared (first use in this function) xwin.c:3107: error: `xcolor' undeclared (first use in this function) xwin.c: At top level: xwin.c:3121: error: syntax error before '*' token xwin.c: In function `AreWeGrayscale': xwin.c:3129: error: `XVisualInfo' undeclared (first use in this function) xwin.c:3129: error: `visuals' undeclared (first use in this function) xwin.c:3133: error: `display' undeclared (first use in this function) xwin.c:3138: error: `GrayScale' undeclared (first use in this function) xwin.c:3139: error: `StaticGray' undeclared (first use in this function) xwin.c: At top level: xwin.c:3196: error: syntax error before '*' token xwin.c: In function `GetImageErrorHandler': xwin.c:3198: error: `error' undeclared (first use in this function) xwin.c:3198: error: `BadMatch' undeclared (first use in this function) xwin.c:3200: error: `display' undeclared (first use in this function) xwin.c: In function `DrawImage': xwin.c:3218: error: `XImage' undeclared (first use in this function) xwin.c:3218: error: `ximg' undeclared (first use in this function) xwin.c:3219: error: syntax error before "curcolor" xwin.c:3222: error: syntax error before '*' token xwin.c:3246: warning: assignment makes pointer from integer without a cast xwin.c:3248: error: structure has no member named `display' xwin.c:3250: error: structure has no member named `display' xwin.c:3250: error: structure has no member named `pixmap' xwin.c:3251: error: `AllPlanes' undeclared (first use in this function) xwin.c:3251: error: `ZPixmap' undeclared (first use in this function) xwin.c:3254: error: structure has no member named `display' xwin.c:3254: error: structure has no member named `window' xwin.c:3333: error: `curcolor' undeclared (first use in this function) xwin.c:3333: error: structure has no member named `cmap1' xwin.c:3335: error: structure has no member named `fgcolor' xwin.c:3375: error: structure has no member named `display' xwin.c:3375: error: structure has no member named `pixmap' xwin.c:3375: error: structure has no member named `gc' xwin.c:3378: error: structure has no member named `display' xwin.c:3378: error: structure has no member named `window' xwin.c:3378: error: structure has no member named `gc' xwin.c: In function `imageops': xwin.c:3406: error: structure has no member named `display' gmake[2]: *** [xwin.lo] Error 1 gmake[2]: Leaving directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' gmake[1]: *** [all-recursive] Error 1 gmake[1]: Leaving directory `/freebsd/ports/biology/emboss/work/EMBOSS-6.0.1/plplot' gmake: *** [all-recursive] Error 1 gama# ^Dexit Script done on Tue Mar 17 09:17:41 2009 From ajb at ebi.ac.uk Wed Mar 18 15:31:35 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Wed, 18 Mar 2009 15:31:35 -0000 (GMT) Subject: [EMBOSS] emboss-6.0.1 fails to build without X In-Reply-To: <20090317215240.GH34389@iib.unsam.edu.ar> References: <20090317215240.GH34389@iib.unsam.edu.ar> Message-ID: <51494.86.9.126.186.1237390295.squirrel@webmail.ebi.ac.uk> Hi Fernan, Thanks. A fix for you may be to edit the file plplot/plDevs.h and comment out the line #define PLD_xwin I'll adjust the configuration for this, though I'm never entirely happy about compiling without X. The option to do so was added way back in the infancy of EMBOSS and I often have the uneasy feeling that a dragon is sleeping there. I'd be interested to hear how you get on. You'd probably be best defining EMBOSS_GRAPHICS to something like "ps" or "png" otherwise the default graphics prompt will probably remain as "x11" even though it's not actually compiled in. Alan > ./configure --without-x > [ ... succeeds ... ] > make > [ ... fails ... ] > [ lots of errors from xwin.c ...] > xwin.c: In function `imageops': > xwin.c:3406: error: structure has no member named `display' > *** Error code 1 > > This is on FreeBSD-6.3, gcc-3.4.6, gnu make 3.81 > Typescript is attached. > > Cheers, > > Fernan > > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > From sbassi at gmail.com Sun Mar 22 21:45:01 2009 From: sbassi at gmail.com (Sebastian Bassi) Date: Sun, 22 Mar 2009 18:45:01 -0300 Subject: [EMBOSS] libnucleus.la Message-ID: Hello, I am trying to install HMMER from EMBASSY. sb at dnalinux:~/EMBOSS-6.0.1/embassy/HMMER-2.3.2$ make 2> /tmp/xxx Making all in src make[1]: Entering directory `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' make[2]: Entering directory `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' gcc -O2 -o ehmmcalibrate ehmmcalibrate.o ../../../nucleus/libnucleus.la ../../../ajax/libajax.la ../../../plplot/libeplplot.la -lX11 -lm -lgd -lpng -lz -lm make[2]: Leaving directory `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' make[1]: Leaving directory `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' Here is the stderror: ../../../nucleus/libnucleus.la: file not recognized: File format not recognized collect2: ld returned 1 exit status make[2]: *** [ehmmcalibrate] Error 1 make[1]: *** [all-recursive] Error 1 make: *** [all-recursive] Error 1 Here is the libnucleus.la: dlname='libnucleus.so.6' # Names of this library. library_names='libnucleus.so.6.0.0 libnucleus.so.6 libnucleus.so' # The name of the static archive. old_library='libnucleus.a' # Libraries that this one depends upon. dependency_libs='' # Version information for libnucleus. current=6 age=0 revision=0 # Is this an already installed library? installed=yes # Should we warn about portability when linking against -modules? shouldnotlink=no # Files to dlopen/dlpreopen dlopen='' dlpreopen='' # Directory that this library needs to be installed in: libdir='/usr/local/lib' libnucleus.la is in: ~/EMBOSS-6.0.1/nucleus/libnucleus.la From ajb at ebi.ac.uk Mon Mar 23 10:39:05 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Mon, 23 Mar 2009 10:39:05 -0000 (GMT) Subject: [EMBOSS] libnucleus.la In-Reply-To: References: Message-ID: <56992.86.9.126.186.1237804745.squirrel@webmail.ebi.ac.uk> Hello Sebastian, That looks a bit like a libtool problem. I assume that you've tried a fresh extraction (not just a 'make clean') and compilation of EMBOSS and HMMER. That would eliminate various possibilities including changes to libtool between compilation of EMBOSS and HMMER. I also assume that you downloaded a fresh copy of HMMER from the ftp site when you downloaded EMBOSS, otherwise there would be problems, though probably not the one you've reported. If the problem persists then it would be useful if you sent me (not the list): a) Operating system and version used. b) The command line used to configure EMBOSS and the full output of it (not just the stderr) e.g. ./configure [other options] > embossconfig.out 2>&1 Also confirm that this version of EMBOSS works after compilation. Also confirm whether a 'make install' was done or just a 'make'. c) The command line used to configure HMMER and the full output e.g. ./configure [other options] > hmmerconfig.out 2>&1 d) The full output of the HMMER make e.g. make > hmmermake.out 2>&1 It would be useful to check whether there are any old libnucleus* files in any standard system location (e.g. /usr/local/lib) before starting. ATB Alan > Hello, > > I am trying to install HMMER from EMBASSY. > > sb at dnalinux:~/EMBOSS-6.0.1/embassy/HMMER-2.3.2$ make 2> /tmp/xxx > Making all in src > make[1]: Entering directory > `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' > make[2]: Entering directory > `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' > gcc -O2 -o ehmmcalibrate ehmmcalibrate.o > ../../../nucleus/libnucleus.la ../../../ajax/libajax.la > ../../../plplot/libeplplot.la -lX11 -lm -lgd -lpng -lz -lm > make[2]: Leaving directory `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' > make[1]: Leaving directory `/home/sb/EMBOSS-6.0.1/embassy/HMMER-2.3.2/src' > > Here is the stderror: > > ../../../nucleus/libnucleus.la: file not recognized: File format not > recognized > collect2: ld returned 1 exit status > make[2]: *** [ehmmcalibrate] Error 1 > make[1]: *** [all-recursive] Error 1 > make: *** [all-recursive] Error 1 > > Here is the libnucleus.la: > > dlname='libnucleus.so.6' > # Names of this library. > library_names='libnucleus.so.6.0.0 libnucleus.so.6 libnucleus.so' > # The name of the static archive. > old_library='libnucleus.a' > # Libraries that this one depends upon. > dependency_libs='' > # Version information for libnucleus. > current=6 > age=0 > revision=0 > # Is this an already installed library? > installed=yes > # Should we warn about portability when linking against -modules? > shouldnotlink=no > # Files to dlopen/dlpreopen > dlopen='' > dlpreopen='' > # Directory that this library needs to be installed in: > libdir='/usr/local/lib' > > > libnucleus.la is in: > > ~/EMBOSS-6.0.1/nucleus/libnucleus.la > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > From sbassi at gmail.com Mon Mar 23 14:27:19 2009 From: sbassi at gmail.com (Sebastian Bassi) Date: Mon, 23 Mar 2009 11:27:19 -0300 Subject: [EMBOSS] libnucleus.la In-Reply-To: <56992.86.9.126.186.1237804745.squirrel@webmail.ebi.ac.uk> References: <56992.86.9.126.186.1237804745.squirrel@webmail.ebi.ac.uk> Message-ID: On Mon, Mar 23, 2009 at 7:39 AM, wrote: > Hello Sebastian, > That looks a bit like a libtool problem. I assume that No, it was PEBKAC (Problem Exists Between Keyboard And Chair). I was following instructions as it were a cvs copy instead of instrucctions for a tar.gz package. So I did aclocal and other comands instead of the classic configure, make, make install. My mistake was due to I read the INSTALL file very fast and I followed the first instruction I found :( Now it is everything OK. Thank you for answer. Best, SB. From hubert75 at gmx.at Tue Mar 24 18:18:14 2009 From: hubert75 at gmx.at (Hubert Renauld) Date: Tue, 24 Mar 2009 19:18:14 +0100 Subject: [EMBOSS] problems installing EMBOSS on MacOSX 10.5.6 Message-ID: <20090324181814.234660@gmx.net> Good evening, I cannot manage to install EMBOSS 6.0 and jemboss privately, on a Mac OS X version 10.5.6. (This is the first time I am trying to install EMBOSS.) I have no formal computer background, so I am afraid my questions will sound naive. I downloaded everything into /Applications/EMBOSS (I created). Downloaded there all .tgz files from the xfree86 as you mentioned. When running the sh Xinstall.sh, lots of permissions denied, yet "installation successfully completed" (very confusing). I tried to compile, but I have no "make". Where should I install it, and get it from, please? I downloaded the make-3.81 from http://mac.softpedia.com/get/Developer-Tools/GNU-Make.shtml, gunzipped and tar'ed it, but the make clean command is unknown. Could anybody please help me? I guess I have paths and permissions problems (also). I have no formal computer background, so I am afraid my questions will sound naive, and I may not understand lots of abbreviations and jargon. However, I loved working with EMBOSS while at Sanger, and would like to spread its use. Many Thanks in advance, Hubert -- Psssst! Schon vom neuen GMX MultiMessenger geh?rt? Der kann`s mit allen: http://www.gmx.net/de/go/multimessenger01 From lueck at ipk-gatersleben.de Wed Mar 25 13:54:26 2009 From: lueck at ipk-gatersleben.de (=?iso-8859-1?Q?Stefanie_L=FCck?=) Date: Wed, 25 Mar 2009 14:54:26 +0100 Subject: [EMBOSS] Eprimer3 gcclamp argument Message-ID: <008801c9ad51$362d3b60$1022a8c0@ipkgatersleben.de> Hi everybody! I'm using the gcclamp argument (value=1). Is it possible to limit the G or C's at the end to maximum of one G or C? Thanks in advance! Stefanie From lueck at ipk-gatersleben.de Wed Mar 25 13:54:44 2009 From: lueck at ipk-gatersleben.de (=?iso-8859-1?Q?Stefanie_L=FCck?=) Date: Wed, 25 Mar 2009 14:54:44 +0100 Subject: [EMBOSS] Eprimer3 alternative output formats Message-ID: <009901c9ad51$40dcfaf0$1022a8c0@ipkgatersleben.de> Hi! Is there an argument in the eprimer 3 to get an alternative output format? Something like this, which I got once from primer3 running on a server: PRIMER_SEQUENCE_ID=HF15E08r SEQUENCE=GCATGTAATAATGCCAAAGCTCACAGCTGCAGTTGAATCTTGGGACCCGCGGAGCGAGAATGTACCAATCCATGTATGGGTACACCCATGGCTGCCAACTCTAGGGCAAAGGATAGATACACTGTGCCACTCTATCCGGTACAAGCTGAGTAGTGTCCTCCAATTATGGCAAGCTCACGATTCATCAGCTTATGCTGTGCTATCTCCATGGAAGGGTGTATTTGATCCAGCAAGTTGGGAAGACTTGATAGTGCGTTATATCATTCCTAAACTGAAAATGGCACTCCAGGAGTTCCAGATTAACCCAGCAAGCCAAAAGTTTGACCAGTTTAACTGGGTTATGATCTGGGCTTCTGCTGTCCCGGTACACCATATGGTCCATATGTTGGAAGTTGATTTCTTTAGCAAGTGGCAGCTGGTTTTGTACCATTGGCTGAGCTCACCAAATCCTGATTTCAATGAGATAATGAATTGGTAT PRIMER_PRODUCT_SIZE_RANGE=500-1000 450-500 400-450 350-400 300-350 250-300 200-250 150-200 PRIMER_OPT_TM=60.0 PRIMER_MIN_TM=58.0 PRIMER_MAX_TM=65.0 PRIMER_MAX_DIFF_TM=3.0 PRIMER_DNA_CONC=420 PRIMER_NUM_RETURN=1 PRIMER_PAIR_PENALTY=0.8691 PRIMER_LEFT_PENALTY=0.708329 PRIMER_RIGHT_PENALTY=0.160746 PRIMER_LEFT_SEQUENCE=GCATGTAATAATGCCAAAGC PRIMER_RIGHT_SEQUENCE=TTGAAATCAGGATTTGGTGA PRIMER_LEFT=0,20 PRIMER_RIGHT=458,20 PRIMER_LEFT_TM=59.292 PRIMER_RIGHT_TM=60.161 PRIMER_LEFT_GC_PERCENT=40.000 PRIMER_RIGHT_GC_PERCENT=35.000 PRIMER_LEFT_SELF_ANY=7.00 PRIMER_RIGHT_SELF_ANY=8.00 PRIMER_LEFT_SELF_END=2.00 PRIMER_RIGHT_SELF_END=2.00 PRIMER_LEFT_END_STABILITY=8.5000 PRIMER_RIGHT_END_STABILITY=7.9000 PRIMER_PAIR_COMPL_ANY=5.00 PRIMER_PAIR_COMPL_END=3.00 PRIMER_PRODUCT_SIZE=459 Thanks in advance! Stefanie From ajb at ebi.ac.uk Wed Mar 25 17:28:44 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Wed, 25 Mar 2009 17:28:44 -0000 (GMT) Subject: [EMBOSS] Eprimer3 alternative output formats In-Reply-To: <009901c9ad51$40dcfaf0$1022a8c0@ipkgatersleben.de> References: <009901c9ad51$40dcfaf0$1022a8c0@ipkgatersleben.de> Message-ID: <32838.86.9.126.186.1238002124.squirrel@webmail.ebi.ac.uk> Hello Stefanie, There is currently no such argument but it is a trivial thing to hack in to the source code - the attached patch against EMBOSS-6.0.1 would do it by adding a '-originalformat' switch. As it stands, the output is provided in what was deemed a more easily digestible format. Out of interest, is there a specific reason why you need the original output format e.g. do you use a subsequent application that requires it? We try to be flexible if there's reasonable demand for something. HTH Alan > Hi! > > Is there an argument in the eprimer 3 to get an alternative output format? > > Something like this, which I got once from primer3 running on a server: > > PRIMER_SEQUENCE_ID=HF15E08r > SEQUENCE=GCATGTAATAATGCCAAAGCTCACAGCTGCAGTTGAATCTTGGGACCCGCGGAGCGAGAATGTACCAATCCATGTATGGGTACACCCATGGCTGCCAACTCTAGGGCAAAGGATAGATACACTGTGCCACTCTATCCGGTACAAGCTGAGTAGTGTCCTCCAATTATGGCAAGCTCACGATTCATCAGCTTATGCTGTGCTATCTCCATGGAAGGGTGTATTTGATCCAGCAAGTTGGGAAGACTTGATAGTGCGTTATATCATTCCTAAACTGAAAATGGCACTCCAGGAGTTCCAGATTAACCCAGCAAGCCAAAAGTTTGACCAGTTTAACTGGGTTATGATCTGGGCTTCTGCTGTCCCGGTACACCATATGGTCCATATGTTGGAAGTTGATTTCTTTAGCAAGTGGCAGCTGGTTTTGTACCATTGGCTGAGCTCACCAAATCCTGATTTCAATGAGATAATGAATTGGTAT > PRIMER_PRODUCT_SIZE_RANGE=500-1000 450-500 400-450 350-400 300-350 250-300 > 200-250 150-200 > PRIMER_OPT_TM=60.0 > PRIMER_MIN_TM=58.0 > PRIMER_MAX_TM=65.0 > PRIMER_MAX_DIFF_TM=3.0 > PRIMER_DNA_CONC=420 > PRIMER_NUM_RETURN=1 > PRIMER_PAIR_PENALTY=0.8691 > PRIMER_LEFT_PENALTY=0.708329 > PRIMER_RIGHT_PENALTY=0.160746 > PRIMER_LEFT_SEQUENCE=GCATGTAATAATGCCAAAGC > PRIMER_RIGHT_SEQUENCE=TTGAAATCAGGATTTGGTGA > PRIMER_LEFT=0,20 > PRIMER_RIGHT=458,20 > PRIMER_LEFT_TM=59.292 > PRIMER_RIGHT_TM=60.161 > PRIMER_LEFT_GC_PERCENT=40.000 > PRIMER_RIGHT_GC_PERCENT=35.000 > PRIMER_LEFT_SELF_ANY=7.00 > PRIMER_RIGHT_SELF_ANY=8.00 > PRIMER_LEFT_SELF_END=2.00 > PRIMER_RIGHT_SELF_END=2.00 > PRIMER_LEFT_END_STABILITY=8.5000 > PRIMER_RIGHT_END_STABILITY=7.9000 > PRIMER_PAIR_COMPL_ANY=5.00 > PRIMER_PAIR_COMPL_END=3.00 > PRIMER_PRODUCT_SIZE=459 > > Thanks in advance! > Stefanie > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > -------------- next part -------------- A non-text attachment was scrubbed... Name: ep3hack_patch.gz Type: application/x-gzip Size: 1164 bytes Desc: not available URL: From koenvanderdrift at gmail.com Wed Mar 25 17:37:11 2009 From: koenvanderdrift at gmail.com (Koen van der Drift) Date: Wed, 25 Mar 2009 13:37:11 -0400 Subject: [EMBOSS] problems installing EMBOSS on MacOSX 10.5.6 Message-ID: <5cba6b9f0903251037q19bc0942u9a33c84f8f42bd4a@mail.gmail.com> > I cannot manage to install EMBOSS 6.0 and jemboss privately, on a Mac OS X version 10.5.6.??(This is the first time I am trying to install EMBOSS.)??I have no formal computer background, so I am afraid my questions will sound naive. Hubert, Did you have a look at fink (fink.sf.net)? With this package you will be able to install emboss without worrying about all other packages you need. Let me know if you need any assistance for it. It doesn't install jemboss, though. - Koen. From sylvain.foisy at diploide.net Wed Mar 25 20:24:47 2009 From: sylvain.foisy at diploide.net (Sylvain Foisy) Date: Wed, 25 Mar 2009 16:24:47 -0400 Subject: [EMBOSS] problems installing EMBOSS on MacOSX 10.5.6 Message-ID: Hi, Ok, what you need to do is make sure that you have the developer's tools intalled on your Mac. Put the Install DVD in the machine and look for them. Make sure too that you have installed the X11 development headers. In addition, you will have to install GD. Go through this link to help you out: http://www.kenior.com/macintosh/adding-gd-library-for-mac-os-x-leopard I have installed EMBOSS on all versions of Mac OS X since 10 Public beta. When all the prerequisite are installed, it is pretty easy ;-) Good luck Sylvain =================================================================== Sylvain Foisy, Ph. D. Consultant Bio-informatique / Bioinformatics Diploide.net - TI pour la vie / IT for Life Courriel: sylvain.foisy at diploide.net Web: http://www.diploide.net Tel: (514) 893-4363 =================================================================== From sylvain.foisy at diploide.net Wed Mar 25 20:28:26 2009 From: sylvain.foisy at diploide.net (Sylvain Foisy) Date: Wed, 25 Mar 2009 16:28:26 -0400 Subject: [EMBOSS] problems installing EMBOSS on MacOSX 10.5.6 Message-ID: Hi, Actually, a better link for the GD install: http://osx.topicdesk.com/content/view/135/41/ Good luck Sylvain =================================================================== Sylvain Foisy, Ph. D. Consultant Bio-informatique / Bioinformatics Diploide.net - TI pour la vie / IT for Life Courriel: sylvain.foisy at diploide.net Web: http://www.diploide.net Tel: (514) 893-4363 =================================================================== From jfrancoe at mitre.org Wed Mar 25 20:47:20 2009 From: jfrancoe at mitre.org (Francoeur, Joseph A.) Date: Wed, 25 Mar 2009 16:47:20 -0400 Subject: [EMBOSS] meaning of "(Reversed)" in diffseq? Message-ID: <2DE2192C7939824C86330E7245F6BC00533CF23056@IMCMBX3.MITRE.ORG> Hello, I ran diffseq on 2 FASTA-formatted DNA sequence files on my local installation of EMBOSS, and I have entries in the .diffseq output file labeled as "(Reversed)". Looking at both sequences in an editor, neither of these sequence segments is reversed (the "Sequence" string in the diffseq file matches the original FASTA file). Does anyone know what is meant by this? I'm analyzing the EMBOSS source code, and it looks as though it's related to a strand feature. That's puzzling me, because my local installation has no databases installed, and it seems that this kind of information wouldn't be embedded in the FASTA file. How does diffseq determine this strand information, and how should I interpret it? Thanks, Joe --- Joseph A. Francoeur Senior Software Systems Engineer The MITRE Corporation 202 Burlington Road MS K228 Bedford, MA 01730-1420 e-mail: jfrancoe at mitre.org From andrespinzon at gmail.com Wed Mar 25 21:04:23 2009 From: andrespinzon at gmail.com (Andres Pinzon) Date: Wed, 25 Mar 2009 17:04:23 -0400 Subject: [EMBOSS] meaning of "(Reversed)" in diffseq? In-Reply-To: <2DE2192C7939824C86330E7245F6BC00533CF23056@IMCMBX3.MITRE.ORG> References: <2DE2192C7939824C86330E7245F6BC00533CF23056@IMCMBX3.MITRE.ORG> Message-ID: <8968fc7e0903251404k77b17be3o787570fad49ee10a@mail.gmail.com> I extracted this from the EMBOSS documentation, perhaps it'll help you (specially the las paragraph): "[...] Each report consists of 4 or more lines. - The first line has the name of the first sequence followed by the start and end positions of the mismatched region in that sequence, followed by the length of the mismatched region. If the mismatched region is of zero length in this sequence, then only the position of the last matching base before the mismatch is given. - If a feature of the first sequence overlaps with this mismatch region, then one or more lines starting with 'Feature:' comes next with the type, position and tag field of the feature. - Next is a line starting "Sequence:" giving the sequence of the mismatch in the first sequence. This is followed by the equivalent information for the second sequence, but in the reverse order, namely 'Sequence:' line, 'Feature:' lines and line giving the position of the mismatch in the second sequence.[...]" Best, On Wed, Mar 25, 2009 at 4:47 PM, Francoeur, Joseph A. wrote: > Hello, > > I ran diffseq on 2 FASTA-formatted DNA sequence files on my local > installation of EMBOSS, and I have entries in the .diffseq output file > labeled as "(Reversed)". Looking at both sequences in an editor, neither of > these sequence segments is reversed (the "Sequence" string in the diffseq > file matches the original FASTA file). Does anyone know what is meant by > this? I'm analyzing the EMBOSS source code, and it looks as though it's > related to a strand feature. That's puzzling me, because my local > installation has no databases installed, and it seems that this kind of > information wouldn't be embedded in the FASTA file. How does diffseq > determine this strand information, and how should I interpret it? > > Thanks, > Joe > --- > > Joseph A. Francoeur > Senior Software Systems Engineer > The MITRE Corporation > 202 Burlington Road MS K228 > Bedford, MA 01730-1420 > > e-mail: jfrancoe at mitre.org > > > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > -- Andr?s Pinz?n http://bioinf.ibun.unal.edu.co/~apinzon/ Bioinformatics Center, Colombia EMBnet node http://bioinf.ibun.unal.edu.co Tel +57 3165000 ext 16961 Fax +571 3165415 Micology and Phytopathology Laboratory - Los Andes University. http://bioinf.uniandes.edu.co Tel +571 3394949 ext. 2768 From jfrancoe at mitre.org Wed Mar 25 21:15:13 2009 From: jfrancoe at mitre.org (Francoeur, Joseph A.) Date: Wed, 25 Mar 2009 17:15:13 -0400 Subject: [EMBOSS] meaning of "(Reversed)" in diffseq? In-Reply-To: <8968fc7e0903251404k77b17be3o787570fad49ee10a@mail.gmail.com> References: <2DE2192C7939824C86330E7245F6BC00533CF23056@IMCMBX3.MITRE.ORG> <8968fc7e0903251404k77b17be3o787570fad49ee10a@mail.gmail.com> Message-ID: <2DE2192C7939824C86330E7245F6BC00533CF23066@IMCMBX3.MITRE.ORG> Thanks, Andres, but I don't think that explains it. The label "(Reversed)" only appears for selected output lines in the diffseq report. The documentation you cited just states that the reverse ordering of the lines always occurs in the report. Joe From: Andres Pinzon [mailto:andrespinzon at gmail.com] Sent: Wednesday, March 25, 2009 5:04 PM To: Francoeur, Joseph A. Cc: emboss at emboss.open-bio.org Subject: Re: [EMBOSS] meaning of "(Reversed)" in diffseq? I extracted this from the EMBOSS documentation, perhaps it'll help you (specially the las paragraph): "[...] Each report consists of 4 or more lines. * The first line has the name of the first sequence followed by the start and end positions of the mismatched region in that sequence, followed by the length of the mismatched region. If the mismatched region is of zero length in this sequence, then only the position of the last matching base before the mismatch is given. * If a feature of the first sequence overlaps with this mismatch region, then one or more lines starting with 'Feature:' comes next with the type, position and tag field of the feature. * Next is a line starting "Sequence:" giving the sequence of the mismatch in the first sequence. This is followed by the equivalent information for the second sequence, but in the reverse order, namely 'Sequence:' line, 'Feature:' lines and line giving the position of the mismatch in the second sequence.[...]" Best, On Wed, Mar 25, 2009 at 4:47 PM, Francoeur, Joseph A. > wrote: Hello, I ran diffseq on 2 FASTA-formatted DNA sequence files on my local installation of EMBOSS, and I have entries in the .diffseq output file labeled as "(Reversed)". Looking at both sequences in an editor, neither of these sequence segments is reversed (the "Sequence" string in the diffseq file matches the original FASTA file). Does anyone know what is meant by this? I'm analyzing the EMBOSS source code, and it looks as though it's related to a strand feature. That's puzzling me, because my local installation has no databases installed, and it seems that this kind of information wouldn't be embedded in the FASTA file. How does diffseq determine this strand information, and how should I interpret it? Thanks, Joe --- Joseph A. Francoeur Senior Software Systems Engineer The MITRE Corporation 202 Burlington Road MS K228 Bedford, MA 01730-1420 e-mail: jfrancoe at mitre.org> _______________________________________________ EMBOSS mailing list EMBOSS at lists.open-bio.org http://lists.open-bio.org/mailman/listinfo/emboss -- Andr?s Pinz?n http://bioinf.ibun.unal.edu.co/~apinzon/ Bioinformatics Center, Colombia EMBnet node http://bioinf.ibun.unal.edu.co Tel +57 3165000 ext 16961 Fax +571 3165415 Micology and Phytopathology Laboratory - Los Andes University. http://bioinf.uniandes.edu.co Tel +571 3394949 ext. 2768 From lueck at ipk-gatersleben.de Thu Mar 26 09:37:58 2009 From: lueck at ipk-gatersleben.de (=?iso-8859-1?Q?Stefanie_L=FCck?=) Date: Thu, 26 Mar 2009 10:37:58 +0100 Subject: [EMBOSS] Eprimer3 alternative output formats References: <009901c9ad51$40dcfaf0$1022a8c0@ipkgatersleben.de> <32838.86.9.126.186.1238002124.squirrel@webmail.ebi.ac.uk> Message-ID: <003901c9adf6$8c76b640$1022a8c0@ipkgatersleben.de> Hi Alan! Thanks a lot for the patch! I design hundrets of primers in a batch mode and want to parse it in a bit more convenient way to look at /oder the primers. In addition it's good to know all informations about the designed primers for documentation purposes. I need something like this: Thanks again and have a nice day! Stefanie ----- Original Message ----- From: To: "Stefanie L?ck" Cc: Sent: Wednesday, March 25, 2009 6:28 PM Subject: Re: [EMBOSS] Eprimer3 alternative output formats > Hello Stefanie, > > There is currently no such argument but it is a trivial thing to hack > in to the source code - the attached patch against EMBOSS-6.0.1 would do > it > by adding a '-originalformat' switch. > > As it stands, the output is provided in what was deemed a more > easily digestible format. > > Out of interest, is there a specific reason why you need the original > output format e.g. do you use a subsequent application that requires it? > We try to be flexible if there's reasonable demand for something. > > HTH > > Alan > > >> Hi! >> >> Is there an argument in the eprimer 3 to get an alternative output >> format? >> >> Something like this, which I got once from primer3 running on a server: >> >> PRIMER_SEQUENCE_ID=HF15E08r >> SEQUENCE=GCATGTAATAATGCCAAAGCTCACAGCTGCAGTTGAATCTTGGGACCCGCGGAGCGAGAATGTACCAATCCATGTATGGGTACACCCATGGCTGCCAACTCTAGGGCAAAGGATAGATACACTGTGCCACTCTATCCGGTACAAGCTGAGTAGTGTCCTCCAATTATGGCAAGCTCACGATTCATCAGCTTATGCTGTGCTATCTCCATGGAAGGGTGTATTTGATCCAGCAAGTTGGGAAGACTTGATAGTGCGTTATATCATTCCTAAACTGAAAATGGCACTCCAGGAGTTCCAGATTAACCCAGCAAGCCAAAAGTTTGACCAGTTTAACTGGGTTATGATCTGGGCTTCTGCTGTCCCGGTACACCATATGGTCCATATGTTGGAAGTTGATTTCTTTAGCAAGTGGCAGCTGGTTTTGTACCATTGGCTGAGCTCACCAAATCCTGATTTCAATGAGATAATGAATTGGTAT >> PRIMER_PRODUCT_SIZE_RANGE=500-1000 450-500 400-450 350-400 300-350 >> 250-300 >> 200-250 150-200 >> PRIMER_OPT_TM=60.0 >> PRIMER_MIN_TM=58.0 >> PRIMER_MAX_TM=65.0 >> PRIMER_MAX_DIFF_TM=3.0 >> PRIMER_DNA_CONC=420 >> PRIMER_NUM_RETURN=1 >> PRIMER_PAIR_PENALTY=0.8691 >> PRIMER_LEFT_PENALTY=0.708329 >> PRIMER_RIGHT_PENALTY=0.160746 >> PRIMER_LEFT_SEQUENCE=GCATGTAATAATGCCAAAGC >> PRIMER_RIGHT_SEQUENCE=TTGAAATCAGGATTTGGTGA >> PRIMER_LEFT=0,20 >> PRIMER_RIGHT=458,20 >> PRIMER_LEFT_TM=59.292 >> PRIMER_RIGHT_TM=60.161 >> PRIMER_LEFT_GC_PERCENT=40.000 >> PRIMER_RIGHT_GC_PERCENT=35.000 >> PRIMER_LEFT_SELF_ANY=7.00 >> PRIMER_RIGHT_SELF_ANY=8.00 >> PRIMER_LEFT_SELF_END=2.00 >> PRIMER_RIGHT_SELF_END=2.00 >> PRIMER_LEFT_END_STABILITY=8.5000 >> PRIMER_RIGHT_END_STABILITY=7.9000 >> PRIMER_PAIR_COMPL_ANY=5.00 >> PRIMER_PAIR_COMPL_END=3.00 >> PRIMER_PRODUCT_SIZE=459 >> >> Thanks in advance! >> Stefanie >> _______________________________________________ >> EMBOSS mailing list >> EMBOSS at lists.open-bio.org >> http://lists.open-bio.org/mailman/listinfo/emboss >> > From ajb at ebi.ac.uk Thu Mar 26 17:59:36 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Thu, 26 Mar 2009 17:59:36 -0000 (GMT) Subject: [EMBOSS] meaning of "(Reversed)" in diffseq? In-Reply-To: <2DE2192C7939824C86330E7245F6BC00533CF23056@IMCMBX3.MITRE.ORG> References: <2DE2192C7939824C86330E7245F6BC00533CF23056@IMCMBX3.MITRE.ORG> Message-ID: <52110.86.9.126.186.1238090376.squirrel@webmail.ebi.ac.uk> Hello Joe, Interesting. I'm not entirely convinced it's intentional either, if so then the documentation probably needs a little work. To answer your question, diffseq holds the differences internally by storing them in a feature table. The features within this table are added using feature constructors. If some of these feature constructors are given a start position in the sequence that is greater than the end position then they will mark the strand of the feature as being '-'. If the diffseq report format output sees a strand marked as '-' then it will print (Reversed). Owing to internal representations of differences in diffseq (for example a start>end can be a convenient way of representing a gap) you'll get a '(Reversed)' feature report appearing if the second sequence has an insertion at that point. Diffseq will generally then show the last couple of residues of the first sequence and then the insertion in the second sequence. We're depleted a little by holidays here but I'll raise the issue of whether this is intentional and/or the best way of representing/documenting this when we're quorate again (though you may well get another response before then depending on the order holiday email is dealt with). HTH Alan > Hello, > > I ran diffseq on 2 FASTA-formatted DNA sequence files on my local > installation of EMBOSS, and I have entries in the .diffseq output file > labeled as "(Reversed)". Looking at both sequences in an editor, neither > of these sequence segments is reversed (the "Sequence" string in the > diffseq file matches the original FASTA file). Does anyone know what is > meant by this? I'm analyzing the EMBOSS source code, and it looks as > though it's related to a strand feature. That's puzzling me, because my > local installation has no databases installed, and it seems that this kind > of information wouldn't be embedded in the FASTA file. How does diffseq > determine this strand information, and how should I interpret it? > > Thanks, > Joe > --- > > Joseph A. Francoeur > Senior Software Systems Engineer > The MITRE Corporation > 202 Burlington Road MS K228 > Bedford, MA 01730-1420 > > e-mail: jfrancoe at mitre.org > > > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > From pmiguel at purdue.edu Fri Mar 27 19:30:15 2009 From: pmiguel at purdue.edu (Phillip San Miguel) Date: Fri, 27 Mar 2009 15:30:15 -0400 Subject: [EMBOSS] How to turn off GFF file creation in wordmatch? Message-ID: <49CD2947.60802@purdue.edu> I'm running wordmatch from EMBOSS v 5.0.0. In the manual for wordmatch it is said: This program takes two sequences and finds regions where they are identical. These regions are reported in the output file (and optionally) in GFF (Gene Feature Format) files. I would like wordmatch not to create the (optional) .gff files. But they are created by default and I don't see a means to prevent this. Any ideas? Thanks, Phillip Purdue Genomics Core Facilty From ajb at ebi.ac.uk Fri Mar 27 20:26:16 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Fri, 27 Mar 2009 20:26:16 -0000 (GMT) Subject: [EMBOSS] How to turn off GFF file creation in wordmatch? In-Reply-To: <49CD2947.60802@purdue.edu> References: <49CD2947.60802@purdue.edu> Message-ID: <53744.86.9.126.186.1238185576.squirrel@webmail.ebi.ac.uk> Hello Phillip, Yes, the documentation does incorrectly describe the GFF files as optional. Thanks for spotting that. Assuming you're on a UNIX system of some type you could give the filename /dev/null for both the gff output files. HTH Alan > I'm running wordmatch from EMBOSS v 5.0.0. In the manual for wordmatch > it is said: > > This program takes two sequences and finds regions where they are > identical. These regions are reported in the output file (and > optionally) in GFF (Gene Feature Format) files. > > > I would like wordmatch not to create the (optional) .gff files. But they > are created by default and I don't see a means to prevent this. Any ideas? > > Thanks, > Phillip > Purdue Genomics Core Facilty > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > From d.leader at bio.gla.ac.uk Sat Mar 28 19:07:03 2009 From: d.leader at bio.gla.ac.uk (David Leader) Date: Sat, 28 Mar 2009 19:07:03 +0000 Subject: [EMBOSS] Png problem on Mac OS 10.5 Message-ID: I have installed Emboss v.5 successfully on several different G4 Macs running OS X 10.4, as well as on a Sun box running Solaris, so, although not a unix-head I am not a novice. I have just got round to installing unix software on a 64-bit Intel iMac running the latest 10.5.x on which I had already used MacPorts to install the various graphics libraries (including libpng) needed to run GD in Perl. This is runnning fine so the libpng library is properly installed. I did an install of Emboss v.6 on the machine and all seemed to proceed fine - configure, make and make install, and the programs run. (I also installed the emboss explorer package and they run from this.) However, although the programs run OK, I get an error message when I select png graphics, to the effect that png isn't an option - the available options being listed. However PostScript graphics work ok. Unless there is a problem with v.6 of Emboss and the Mac, I suspect it may be a 32-bit/64-bit problem. It is known, for example, (and I know from personal experience), that if you install the pre-compiled 64-bit version of MySQL then the Perl drivers don't work because the Perl that comes on Mac OS X 10.5 is 32-bit. For similar reasons one is advised to use 32-bit versions of PHP. So, could it be that Emboss has compiled in a 64-bit version, which is incompatible with the libpng library? If so, is there any way I can recompile Emboss forcing it into a 32-bit version? David PS Apologies if this is a known problem. I have just joined the list and don't see a search function. _______________________________________________________________ Dr. David P. Leader, Faculty of Biomedical & Life Sciences, University of Glasgow, Glasgow G12 8QQ, UK Phone: +44 (0)141 330 5905 http://doolittle.ibls.gla.ac.uk/leader The University of Glasgow, charity number SC004401 _______________________________________________________________ From moldoverb at gmail.com Mon Mar 30 18:12:56 2009 From: moldoverb at gmail.com (Brian Moldover) Date: Mon, 30 Mar 2009 14:12:56 -0400 Subject: [EMBOSS] formatting databases Message-ID: <005d01c9b163$27a01110$76e03330$@com> Hi All, Just finished setting up the EMBOSS software. Now I'm trying to install databases locally and finding it to be a bit more work. I downloaded part of EMBL (rel_con_*) and trying to index with dbiflat. I get an error message "rel_con_mam_01_r99 too large for DBI indexing". Still not entirely sure what I'm doing regarding getting databases up and running which I why I started with a subset of EMBL. Suggestions? - Brian From pmr at ebi.ac.uk Tue Mar 31 11:44:10 2009 From: pmr at ebi.ac.uk (Peter Rice) Date: Tue, 31 Mar 2009 12:44:10 +0100 Subject: [EMBOSS] formatting databases In-Reply-To: <005d01c9b163$27a01110$76e03330$@com> References: <005d01c9b163$27a01110$76e03330$@com> Message-ID: <49D2020A.1020604@ebi.ac.uk> Brian Moldover wrote: > Just finished setting up the EMBOSS software. Now I'm trying to install > databases locally and finding it to be a bit more work. I downloaded part of > EMBL (rel_con_*) and trying to index with dbiflat. I get an error message > "rel_con_mam_01_r99 too large for DBI indexing". Sadly this does happen for occasional EMBL or GenBank releasees. The files are supposed to stay within a 2Gb size limit. There is a scripts/emblsplit.pl file included in the EMBOSS distribution that will split a file at 1,900,000,000 bytes. You need to clean up the original file after running it. The 2Gb limit could be increased to 4Gb at the risk of breaking some third party applications (Staden, Sanger efetch). We could change for the next release to issue a warning if the file size is between 2Gb and 4Gb as the index file has enough space to store the 4Gb file pointers. Are other users interested in allowing this? > Still not entirely sure what I'm doing regarding getting databases up and > running which I why I started with a subset of EMBL. Suggestions? If you do not need to process the whole database you can also use remote access to fetch single entries on demand. This saves you doing any database indexing. You can also use the dbx indexing programs which support larger files. regards, Peter Rice From georgios at biotek.uio.no Tue Mar 31 11:49:28 2009 From: georgios at biotek.uio.no (George Magklaras) Date: Tue, 31 Mar 2009 13:49:28 +0200 Subject: [EMBOSS] formatting databases In-Reply-To: <005d01c9b163$27a01110$76e03330$@com> References: <005d01c9b163$27a01110$76e03330$@com> Message-ID: <49D20348.8040807@biotek.uio.no> Hi Brian, Use dbxflat for formatting databases. The 'dbiflat' app is old and has file size limits. dbxflat has no such limits. For more info: http://www.no.embnet.org/html/dbxflat.html -- GM http://www.no.embnet.org Brian Moldover wrote: > Hi All, > > > > Just finished setting up the EMBOSS software. Now I'm trying to install > databases locally and finding it to be a bit more work. I downloaded part of > EMBL (rel_con_*) and trying to index with dbiflat. I get an error message > "rel_con_mam_01_r99 too large for DBI indexing". > > > > Still not entirely sure what I'm doing regarding getting databases up and > running which I why I started with a subset of EMBL. Suggestions? > > > > - Brian > > > > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > From ggeca at bas.bg Tue Mar 31 18:25:04 2009 From: ggeca at bas.bg (ggeca at bas.bg) Date: Tue, 31 Mar 2009 21:25:04 +0300 (EEST) Subject: [EMBOSS] (no subject) Message-ID: Hi, We have stumbled upon a dead end situation in an attempt to build EMBOSS 6.01 without X support (SUSE 10 64-bit platform). Appreciation goes for any advice, geca, bas From ajb at ebi.ac.uk Tue Mar 31 19:13:07 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Tue, 31 Mar 2009 20:13:07 +0100 (BST) Subject: [EMBOSS] Without X query. was: (no subject) In-Reply-To: References: Message-ID: <57240.86.9.126.186.1238526787.squirrel@webmail.ebi.ac.uk> This thread may be of help. http://lists.open-bio.org/pipermail/emboss/2009-March/003538.html Basically edit the plpliot/plDevs.h file as described and then configure using the --without-x switch. This has been fixed for the next release. THT Alan > Hi, > > We have stumbled upon a dead end situation in an attempt to build EMBOSS > 6.01 > without X support (SUSE 10 64-bit platform). > > Appreciation goes for any advice, > > geca, > bas > > > _______________________________________________ > EMBOSS mailing list > EMBOSS at lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/emboss > From moldoverb at gmail.com Tue Mar 31 20:17:58 2009 From: moldoverb at gmail.com (Brian Moldover) Date: Tue, 31 Mar 2009 16:17:58 -0400 Subject: [EMBOSS] wEMBOSS Message-ID: <006001c9b23d$ca0404e0$5e0c0ea0$@com> I'm back J Hopefully someone can answer this one. I've set up wEMBOSS, and now I receive this message when I try and access the web interface: error, catch: Sorry, the owner of this process is not allowed to run catch program, ask wEMBOSS manager! - Brian From ajb at ebi.ac.uk Tue Mar 31 22:03:56 2009 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Tue, 31 Mar 2009 23:03:56 +0100 (BST) Subject: [EMBOSS] Without X query. was: (no subject) In-Reply-To: <520894aa0903311302o34c56d83l2d6628a8f8c56ff@mail.gmail.com> References: <57240.86.9.126.186.1238526787.squirrel@webmail.ebi.ac.uk> <520894aa0903311302o34c56d83l2d6628a8f8c56ff@mail.gmail.com> Message-ID: <33171.86.9.126.186.1238537036.squirrel@webmail.ebi.ac.uk> Hello Fernan, I'm not sure I see your problem. To compile with X11 support you neither edit the file nor add the --without-x switch. The next release will allow you to control whether X11 is activated or not by using the switch alone i.e. there will be no need to edit the file. It has been the case in the past that people with servers do want to completely deactivate X11 and I understood that to be what you required. If your original meaning was that X11 wouldn't compile and you wanted X11 support then the mention of --without-x in the original query was perhaps the cause of misunderstanding. The cause of X11 not compiling, with the kind of error you described, is usually because the X11 libraries have been installed but not the X11 development (header files). After they have been installed then you need to perform the configuration step again and 'make clean' As the latter problem is becoming asked more frequently I've altered the configuration for the next release such that, if you haven't deselected X11 and if the X11 headers are missing then the configuration process will terminate with a helpful message. Please feel free to contact me off-list if you do require X11 and continue to have problems compiling EMBOSS on FreeBSD. HTH Alan > On Tue, Mar 31, 2009 at 9:13 PM, wrote: >> This thread may be of help. >> >> http://lists.open-bio.org/pipermail/emboss/2009-March/003538.html >> >> Basically edit the plpliot/plDevs.h file as described and then >> configure using the --without-x switch. > > I have tried this in FreeBSD and we're stuck in a dead-end situation. > Commenting out that line and using --without-x works. But now, when we > compile emboss without using '--without-x' ... everything builds fine > but then we don't have x11 (vga) output in graphic programs (plotorf). > > Now there is now way to get emboss with X11 graphical output anymore! > > Fernan > >> This has been fixed for the next release. >> >> THT >> >> Alan >> >> >> >>> Hi, >>> >>> We have stumbled upon a dead end situation in an attempt to build >>> EMBOSS >>> 6.01 >>> without X support (SUSE 10 64-bit platform). >>> >>> Appreciation goes for any advice, >>> >>> geca, >>> bas >>> >>> >>> _______________________________________________ >>> EMBOSS mailing list >>> EMBOSS at lists.open-bio.org >>> http://lists.open-bio.org/mailman/listinfo/emboss >>> >> >> >> _______________________________________________ >> EMBOSS mailing list >> EMBOSS at lists.open-bio.org >> http://lists.open-bio.org/mailman/listinfo/emboss >> >> > > > > -- > fernan >