From Peter.Robinson at t-online.de Tue Nov 4 04:45:06 2003 From: Peter.Robinson at t-online.de (peter robinson) Date: Tue, 4 Nov 2003 10:45:06 +0100 Subject: [EMBOSS] Problems understanding use of ajAZToBin Message-ID: <200311041045.06890.peter.robinson@t-online.de> Dear EMBOSS friends, I was wondering if someone could help me understand the following code. codex = ajAZToBin(bases[0]); /* a "C" */ codey = ajAZToBin(bases[1]); /* a "G" */ (...snip...) codea=codeb; codeb=ajAZToBin(seq[i+1]); if(codea && !(codea & (15-codex))) { ...do something. } I realize that ajAZToBin is a function that returns a binary OR'd representation of an IUB base where A=1, C=2, G=4 and T=8, so I imagine that that is where the 15 comes from in the above expression. If we then have 15-codex <=> 00001111 - 00000010 = 00001101 and assume that codea is 00000010 ("C"), then binary "AND"-ing it with 00001101 would result in false and the expression with ! would result in true. Why can't one say: if (codea && (codea & codex)) ?? Thanks Peter From d.gatherer at vir.gla.ac.uk Fri Nov 7 09:12:15 2003 From: d.gatherer at vir.gla.ac.uk (Derek Gatherer) Date: Fri, 07 Nov 2003 14:12:15 +0000 Subject: [EMBOSS] EMBOSS equivalents for GCG programs In-Reply-To: <5.2.1.1.1.20030930111106.00b14960@udcf.gla.ac.uk> Message-ID: <5.2.1.1.1.20031107135524.00af0808@udcf.gla.ac.uk> Hi The following is a description from the GCG manual of the GCG program Gap: Gap makes an alignment to find the maximum similarity between two sequences by the method of Needleman and Wunsch (J. Mol. Biol. 48; 443-453 (1970)) that is similar to finding the minimum difference according to the method of Sellers (SIAM J. of Applied Math 26; 787-793 (1974)). Smith, Waterman, and Fitch (J. Mol. Evol. 18; 38-46 (1981)) showed that the methods were precisely equivalent when the Needleman and Wunsch gap creation penalty is equal to the Sellers gap creation penalty - 0.5 and when the end gaps for Needleman and Wunsch are penalized in same way as all the other gaps. -ENDWeight allows you to penalize the end gaps introduced by Gap. I have to confess, I'm a bit baffled by this. Obviously, EMBOSS needle would do a NW alignment, but the gap opening penalty default in needle is 10 and the gap extension is 0.5. I'm not sure what is implied in Gap by "gap creation", or whether or not needle allows any end gap penalties. Does anybody have any particular recommendations about the appropriate needle parameters to use to emulate Gap's behaviour? I'm also looking for an equivalent of the GCG program Diverge, that calculates Ka/Ks values. I think there is no equivalent to this in EMBOSS, but I may have missed something? Cheers Derek From pmr at ebi.ac.uk Fri Nov 7 09:46:21 2003 From: pmr at ebi.ac.uk (Peter Rice) Date: Fri, 07 Nov 2003 14:46:21 +0000 Subject: [EMBOSS] EMBOSS equivalents for GCG programs In-Reply-To: <5.2.1.1.1.20031107135524.00af0808@udcf.gla.ac.uk> References: <5.2.1.1.1.20031107135524.00af0808@udcf.gla.ac.uk> Message-ID: <3FABB03D.9070609@ebi.ac.uk> Derek Gatherer wrote: > I have to confess, I'm a bit baffled by this. Obviously, EMBOSS needle > would do a NW alignment, but the gap opening penalty default in needle > is 10 and the gap extension is 0.5. I'm not sure what is implied in Gap > by "gap creation", or whether or not needle allows any end gap > penalties. Does anybody have any particular recommendations about the > appropriate needle parameters to use to emulate Gap's behaviour? In a Needleman-Wunsch global alignment, the entire length of each sequence is aligned. This can be thought of as an overlap between the two sequences (one can be completely within the otehr, or their ends can overlap). This leaves no penalty for the hanging ends of the overlap. In bioinformatics, it is usually reasonable to assume that the sequences are incomplete and there should be no penalty for failing to align the missing bases. In GCG's gap, "endweight" means that the hanging ends are treated as two more rather long gaps. This tends to force the ends of the sequences to be aligned (whether they should be or not) to reduce the number of gaps, and is usually not the option you want. it would not be too difficult to support endweights in needle (the difference is in setting up the gap penalties in the matrix at the start and end, the rest is the same). But ... is it useful? > I'm also looking for an equivalent of the GCG program Diverge, that > calculates Ka/Ks values. I think there is no equivalent to this in > EMBOSS, but I may have missed something? diverge is a strange best that was not too happy with large input data sets. GCG replaced it by "newdiverge" some time back with a different algorithm. EMBOSS supports phylip 3.5, which has distance methods, as an EMBASSY package. You may find what you need there, and phylip 3.6 will be stable soon and will appear as a new and more closely integrated EMBASSY package soon after. Again ... would phylip 3.6 in EMBOSS be useful? regards, Peter Rice From qtu at sibs.ac.cn Mon Nov 10 05:22:58 2003 From: qtu at sibs.ac.cn (Qiang Tu) Date: Mon, 10 Nov 2003 10:22:58 GMT Subject: [EMBOSS] about pepstats Message-ID: Hi, all, I want to calculate the molecular weight and isoelectric point of all sequences in genbank. Scripts are too slow and I want to use the programs in EMBOSS directly. There are two questions: 1. iep supports multi sequences in one file, but pepstats only output the result of the first sequence. Is that true? 2. how ca I make iep and pepstats output a simple result? I jus want the mw and pI. :-) Sorry for the trouble and thanks a lot! Qiang Tu From pmr at ebi.ac.uk Mon Nov 10 04:34:53 2003 From: pmr at ebi.ac.uk (Peter Rice) Date: Mon, 10 Nov 2003 09:34:53 +0000 Subject: [EMBOSS] about pepstats In-Reply-To: References: Message-ID: <3FAF5BBD.7010601@ebi.ac.uk> Qiang Tu wrote: > I want to calculate the molecular weight and isoelectric point of all sequences in genbank. Those are protein properties, so I assume you mean some other database? > Scripts are too slow and I want to use the programs in EMBOSS directly. > There are two questions: > > 1. iep supports multi sequences in one file, but pepstats only output the result of the first sequence. > Is that true? Yes - some programs in EMBOSS can work over all sequences in a database, or all sequences in a file or in a list of sequences. It depends on how useful such output is (for example, whether any EMBOSS user has asked for such an extension). It also depends on how easily a GUI or Web interface can cope with multiple outputs - they need to automatically match the outputs to each input sequence. > 2. how ca I make iep and pepstats output a simple result? I jus want the mw and pI. :-) That is something we are working on for a future release. Best to wait for a general solution. Meanwhile, you can use perl or some other scripts to extract the numbers you need from the output, and to run over all sequences. But, if you are programming - you could change the programs (we can help) to produce the output you want or to read sets of sequences. regards, Peter Rice From ableasby at hgmp.mrc.ac.uk Mon Nov 10 04:43:02 2003 From: ableasby at hgmp.mrc.ac.uk (Alan Bleasby) Date: Mon, 10 Nov 2003 09:43:02 GMT Subject: [EMBOSS] about pepstats Message-ID: <200311100943.hAA9h2fI015001@bromine.hgmp.mrc.ac.uk> Just to add that pepstats in the forthcoming release allows multiple sequences to be specified. You'll still have to parse the output for now though. Alan Bleasby HGMP From qtu at sibs.ac.cn Tue Nov 11 04:31:57 2003 From: qtu at sibs.ac.cn (Qiang Tu) Date: Tue, 11 Nov 2003 09:31:57 GMT Subject: [EMBOSS] about pepstats Message-ID: ---Original Message--- From: Peter Rice Subject: Re: [EMBOSS] about pepstats >Qiang Tu wrote: >> I want to calculate the molecular weight and isoelectric point of all sequences in genbank. > >Those are protein properties, so I assume you mean some other database? I am sorry I mean genbank's protein nr database. >> Scripts are too slow and I want to use the programs in EMBOSS directly. >> There are two questions: >> 1. iep supports multi sequences in one file, but pepstats only output the result of the first sequence. >> Is that true? > >Yes - some programs in EMBOSS can work over all sequences in a database, >or all sequences in a file or in a list of sequences. It depends on how >useful such output is (for example, whether any EMBOSS user has asked >for such an extension). > >It also depends on how easily a GUI or Web interface can cope with >multiple outputs - they need to automatically match the outputs to each >input sequence. I hope pepstats can deal with multiple sequences in one file, so I do not have to call the program by the script, which is slower than the program it self. :-) >> 2. how ca I make iep and pepstats output a simple result? I jus want the mw and pI. :-) > >That is something we are working on for a future release. Best to wait >for a general solution. > >Meanwhile, you can use perl or some other scripts to extract the numbers >you need from the output, and to run over all sequences. > >But, if you are programming - you could change the programs (we can >help) to produce the output you want or to read sets of sequences. Parsing output by perl is relatively fast, while calculation by script is much slower than pepstats. I read the source code, but it was difficult for me to understand. :-) Thank you for your help. Best regards, Qiang Tu From gbottu at ben.vub.ac.be Thu Nov 13 11:27:51 2003 From: gbottu at ben.vub.ac.be (Guy Bottu) Date: Thu, 13 Nov 2003 17:27:51 +0100 Subject: [EMBOSS] interference between databank and file names Message-ID: <20031113162751.GA25936@bigben.ulb.ac.be> from : BEN Dear colleagues, Today one of our users bumped on a problem. It is an old one, because it existed with GCG also. When you put a sequence in a file that happens to have the same name as an existing databank (from emboss.defaults), e.g. "sw", and you ask a program to operate on "sw" it will not take the sequence from the file but (depending on whether it's a sequence or a seqall) on the first or all sequences from SwissProt. What do you think about this ? Should the EMBOSS library routine that fetches the sequences look first in files and only then in databanks instead of the opposite, or give a warning message when there is a file/databank name interference ? Sincerely, Guy Bottu From fehertrans at interware.hu Sun Nov 16 00:17:30 2003 From: fehertrans at interware.hu (Feher Trans Bt.) Date: Sun, 16 Nov 2003 07:17:30 +0200 Subject: [EMBOSS] Dear Partner! Message-ID: <20031116060105.49BA87D2C7@mercury.hgmp.mrc.ac.uk> Dear Partner! Please apologize us for not contacting you for a long time. We recently performed a major structural transformation at the end of which we are on the Internet too. We consider that our present system is more efficient, because the employer can contact directly the applicant, all the information (resume, diplomas, passport copy, criminal and medical records, driving license copy) are online at his disposal, thus the administration is not slowing down the hiring process. Our website is available in six languages in order to ease up the collaboration. Please visit our website at: http://www.job-trans.info. Clicking on the flags on the header, you can choose the appropriate language. If you have any additional questions, please contact us, we are at your service. If there are major changes regarding your labor force request, since our last mail exchange, please send us an updated info, or contact directly the applicants from our database. In the hope of a future collaboration, Regards, Beatrix De Villa FEHER TRANS Ny?ry P?l u. 9/1 1056 Budapest Hungary Tel/Fax: +36 1 317 72 74 e-mail: fehertrans at interware.hu web: http://www.job-trans.info Ps: We apologize for any grammatical errors on our website, some parts of the site are still under development. Your ideas, comment are welcomed in the guest book. If you are interested in our advertising possibilities, please contact us at the above e-mail address. -------------- next part -------------- An HTML attachment was scrubbed... URL: http://lists.open-bio.org/pipermail/emboss/attachments/20031116/f1f2fcc5/attachment.html From d.gatherer at vir.gla.ac.uk Mon Nov 17 07:28:07 2003 From: d.gatherer at vir.gla.ac.uk (Derek Gatherer) Date: Mon, 17 Nov 2003 12:28:07 +0000 Subject: [EMBOSS] needle output In-Reply-To: <3FABB03D.9070609@ebi.ac.uk> References: <5.2.1.1.1.20031107135524.00af0808@udcf.gla.ac.uk> <5.2.1.1.1.20031107135524.00af0808@udcf.gla.ac.uk> Message-ID: <5.2.1.1.1.20031117122352.00aecc30@udcf.gla.ac.uk> Hi I am using needle like this needle file1 file2 -gapopen 10.0 -gapextend 0.5 -out outfile.needle -aformat fasta which gives me a nice FASTA-formatted file with both sequences. However, I would like each sequence to be output into a separate FASTA-formatted file. Is there a command line toggle that does this? cheers Derek From David.Bauer at SCHERING.DE Mon Nov 17 07:35:03 2003 From: David.Bauer at SCHERING.DE (David.Bauer at SCHERING.DE) Date: Mon, 17 Nov 2003 13:35:03 +0100 Subject: Antwort: [EMBOSS] needle output Message-ID: Hello, you could use seqretsplit to create separate fasta files. Cheers, David. Derek Gatherer An: emboss at embnet.org Gesendet von: Kopie: owner-emboss at hgm Thema: [EMBOSS] needle output p.mrc.ac.uk 17.11.03 13:28 Hi I am using needle like this needle file1 file2 -gapopen 10.0 -gapextend 0.5 -out outfile.needle -aformat fasta which gives me a nice FASTA-formatted file with both sequences. However, I would like each sequence to be output into a separate FASTA-formatted file. Is there a command line toggle that does this? cheers Derek From d.gatherer at vir.gla.ac.uk Mon Nov 17 08:41:27 2003 From: d.gatherer at vir.gla.ac.uk (Derek Gatherer) Date: Mon, 17 Nov 2003 13:41:27 +0000 Subject: [EMBOSS] needle output In-Reply-To: Message-ID: <5.2.1.1.1.20031117134040.00aad340@udcf.gla.ac.uk> That's what I need! thanks At 13:35 17/11/2003 +0100, David.Bauer at SCHERING.DE wrote: >Hello, > >you could use seqretsplit to create separate fasta files. > >Cheers, >David. > > > > > > Derek > Gatherer > > la.ac.uk> An: emboss at embnet.org > > Gesendet > von: Kopie: > owner-emboss at hgmp Thema: [EMBOSS] needle > output > .mrc.ac.uk > > > > > > 17.11.03 > 13:28 > > > > > > > > >Hi > >I am using needle like this > >needle file1 file2 -gapopen 10.0 -gapextend 0.5 -out outfile.needle >-aformat fasta > >which gives me a nice FASTA-formatted file with both sequences. However, I > >would like each sequence to be output into a separate FASTA-formatted >file. Is there a command line toggle that does this? > >cheers >Derek From tapo at novozymes.com Mon Nov 17 09:28:51 2003 From: tapo at novozymes.com (TAPO (Thomas Agersten Poulsen)) Date: Mon, 17 Nov 2003 15:28:51 +0100 Subject: [EMBOSS] PDBtosp Message-ID: <76F96CFE2AA2114C886B028A065A7FC4134193@exdkba020.novo.dk> Dear list, Does anybody know what has happened to the pdbtosp tool? It was there in EMBOSS-2.4.1, but not in EMBOSS-2.6.0 and not in the current release. Best regards Thomas Thomas A. Poulsen (TAPo) Novozymes A/S DK-2880 Bagsv?rd +45 44 42 27 23 From pmr at ebi.ac.uk Mon Nov 17 09:43:38 2003 From: pmr at ebi.ac.uk (Peter Rice) Date: Mon, 17 Nov 2003 14:43:38 +0000 Subject: [EMBOSS] PDBtosp In-Reply-To: <76F96CFE2AA2114C886B028A065A7FC4134193@exdkba020.novo.dk> References: <76F96CFE2AA2114C886B028A065A7FC4134193@exdkba020.novo.dk> Message-ID: <3FB8DE9A.9040307@ebi.ac.uk> TAPO (Thomas Agersten Poulsen) wrote: > Dear list, > > Does anybody know what has happened to the pdbtosp tool? It was there in EMBOSS-2.4.1, but not in EMBOSS-2.6.0 and not in the current release. The HGMP protein structure applications are now in the EMBASSY package "domainatrix" (they moved there in EMBOSS 2.5.0) domainatrix is available on the EMBOSS FTP server. The applications run exactly as EMBOSS applications. You install EMBOSS first, then install EMBASSY applications in the embassy directory. Details are in the FAQ file in the EMBOSS distribution. regards, Peter Rice From henrikki.almusa at helsinki.fi Wed Nov 19 03:31:13 2003 From: henrikki.almusa at helsinki.fi (Henrikki Almusa) Date: Wed, 19 Nov 2003 10:31:13 +0200 Subject: [EMBOSS] Jemboss problem Message-ID: <200311191031.13064.henrikki.almusa@helsinki.fi> Hello, I'm trying to use jemboss as standalone and seem to have a problem with results. My emboss version is 2.7.0. The program i used was 'needle'. After clicking show result, the window was empty and when i tried to save to local file i got error trace into console. Trace is attached as Jemboss_save_error.log. Also i'm runnnig the standalone through my own script (bash-shell not csh) so that might also be cause, attached as runJemboss.bash. Small change was added to allow running from other dirs than '$emboss_path/share/EMBOSS/jemboss'. Any help is appreciated. -- Henrikki Almusa -------------- next part -------------- A non-text attachment was scrubbed... Name: Jemboss_save_error.log Type: text/x-log Size: 2225 bytes Desc: not available Url : http://lists.open-bio.org/pipermail/emboss/attachments/20031119/69a7990c/attachment.bin -------------- next part -------------- A non-text attachment was scrubbed... Name: runJemboss.bash Type: application/x-shellscript Size: 822 bytes Desc: not available Url : http://lists.open-bio.org/pipermail/emboss/attachments/20031119/69a7990c/attachment-0001.bin From mdautova at watson.wustl.edu Thu Nov 20 10:59:21 2003 From: mdautova at watson.wustl.edu (Makedonka Dautova) Date: Thu, 20 Nov 2003 09:59:21 -0600 (CST) Subject: [EMBOSS] question on 'codcmp' Message-ID: <1139.10.0.7.188.1069343961.squirrel@watson.wustl.edu> Hi, I have a question regarding the output of codcmp (Codon usage table comparison) and was hopping that you can help me. After running the program we received the following output file: --------------------------------------------------------------------------- # CODCMP codon usage table comparison # anc_can.FULLSPECIES.cuspoutput vs anc_cey.FULLSPECIES.cuspoutput Sum Squared Difference = 0.036 Mean Squared Difference = 0.001 Root Mean Squared Difference = 0.024 Sum Difference = 1.038 Mean Difference = 0.016 Codons not appearing = 0 --------------------------------------------------------------------------- How do I interpret this? How do I know if the difference is statistically significant or not? Thank you in advance, Makedonka Mitreva. ************************************** Makedonka Dautova Mitreva, Ph.D. Project Leader, Parasitic Nematode ESTs Genome Sequencing Center, Department of Genetics, Washington University School of Medicine, Box 8501 4444 Forest Park Boulevard, St. Louis, MO 63108 mdautova at watson.wustl.edu Tel. + 314-286-1118 Fax. + 314-286-1810 http://nematode.net/ ************************************** From d.gatherer at vir.gla.ac.uk Thu Nov 20 12:01:36 2003 From: d.gatherer at vir.gla.ac.uk (Derek Gatherer) Date: Thu, 20 Nov 2003 17:01:36 +0000 Subject: [EMBOSS] question on 'codcmp' In-Reply-To: <1139.10.0.7.188.1069343961.squirrel@watson.wustl.edu> Message-ID: <5.2.1.1.1.20031120164050.00af95a0@udcf.gla.ac.uk> Hi This is a very interesting question. I don't think that there is any way to say if it is statistically significant just from looking at it, as it is essentially a descriptive statistic about the difference between two 64-mer (or is it 59-mer without stop, trp and met) vectors. If you have a whole lot of sequences and codcmp results for all the possible pairwise comparisons, then the resulting distance matrix can be used to build a phylogenetic tree based on codon usage. However, if you generate a series of random sequences, measure their codon usage and then do codcmp between each of your test sequences and all the random sequences, you could then use a z-test to see if the result between the two test sequences was outside of the top or bottom 5%. This would assume that the codcmp results were normally distributed, but you could test that too, either by plotting it or using an F-test. You could use shuffle to base your random sequences on the test sequences - so that would ensure the randomised background had the same nucleotide content. Cheers Derek At 09:59 20/11/2003 -0600, Makedonka Dautova wrote: >Hi, > >I have a question regarding the output of codcmp (Codon usage table >comparison) and was hopping that you can help me. > >After running the program we received the following output file: > >--------------------------------------------------------------------------- ># CODCMP codon usage table comparison ># anc_can.FULLSPECIES.cuspoutput vs anc_cey.FULLSPECIES.cuspoutput > >Sum Squared Difference = 0.036 >Mean Squared Difference = 0.001 >Root Mean Squared Difference = 0.024 >Sum Difference = 1.038 >Mean Difference = 0.016 >Codons not appearing = 0 >--------------------------------------------------------------------------- > >How do I interpret this? How do I know if the difference is statistically >significant or not? > >Thank you in advance, >Makedonka Mitreva. > >************************************** >Makedonka Dautova Mitreva, Ph.D. > >Project Leader, Parasitic Nematode ESTs >Genome Sequencing Center, >Department of Genetics, >Washington University School of Medicine, >Box 8501 >4444 Forest Park Boulevard, >St. Louis, MO 63108 > >mdautova at watson.wustl.edu >Tel. + 314-286-1118 >Fax. + 314-286-1810 > >http://nematode.net/ >************************************** From jison at hgmp.mrc.ac.uk Fri Nov 21 09:01:31 2003 From: jison at hgmp.mrc.ac.uk (Dr J.C. Ison) Date: Fri, 21 Nov 2003 14:01:31 +0000 Subject: [EMBOSS] Bioinformatics Software Development Course Message-ID: <3FBE1ABB.CC15EF08@hgmp.mrc.ac.uk> Hi Details on a forthcoming FREE programming course for bioinformatics using EMBOSS are below. Apologies for the spam if not interested. Cheers Jon Jon C. Ison, PhD Bioinformatics Applications Group UK MRC Human Genome Mapping Project Resource Centre Hinxton, Cambridge, CB10 1SB, UK E-mail : jison at hgmp.mrc.ac.uk BSDC 2004 Bioinformatics Software Development Course January 13-15, April 20-22, July 28-30, November 2-4 2004 Following from the highly successful BSDC 2003 courses, a new series of courses on 'Bioinformatics Software Development' using EMBOSS will be held in the training room at Hinxton Hall on January 13-15, April 20-22, July 28-30, November 2-4 2004 The course will give a good introduction to programming in EMBOSS. By the end of the course you will be experienced in all the steps in writing a basic bioinformatics application using the EMBOSS programming libraries. The course would suit competent programmers, probably with at least a couple of years of experience. A reasonable working knowledge of C is required, familiarity with pointers is helpful but not essential. The three dates are likely to get booked up very quickly so please email Karen Hampson (khampson at hgmp.mrc.ac.uk) to register as soon as possible. To read more about the course see http://www.hgmp.mrc.ac.uk/CCP11/CCP11courses/EMBOSS-Course/emboss_index.html To read more about EMBOSS see EMBOSS : http://www.hgmp.mrc.ac.uk/Software/EMBOSS/ From R-3-721447-18748808-2-9102-US2-3543AE22 at xmr3.com Fri Nov 21 10:26:12 2003 From: R-3-721447-18748808-2-9102-US2-3543AE22 at xmr3.com (International Scientific Communications, Inc.) Date: Fri, 21 Nov 2003 10:26:12 -0500 Subject: [EMBOSS] Laboratory Instrumentation News - November 2003 Message-ID: An HTML attachment was scrubbed... URL: http://lists.open-bio.org/pipermail/emboss/attachments/20031121/6206ab13/attachment.html From brettkaufman at videotron.ca Sat Nov 22 14:51:40 2003 From: brettkaufman at videotron.ca (Brett Kaufman) Date: Sat, 22 Nov 2003 14:51:40 -0500 Subject: [EMBOSS] Jemboss and emma Message-ID: <4A56B0DE-1D25-11D8-B9D7-000A95DA5C82@videotron.ca> I have been trying to get Jemboss to run emma. I find a number of issues that I haven't tracked down: 1) cannot open sequence files (.fasta). these same files can be read and emma executed via terminal. 2) can read pasted .fasta sequence, and the output of emma viewed in results, but no file can be saved. 3) as no file is "opened" by Jemboss, I cannot employ prettyplot to shade the alignment Other issues: 1) prettyplot cannot open a .msf file. Any .msf, even those generated by emma. I know that the input files are valid because they can be used in terminal, or embossRUNNER. I expect there to be a problem with my settings or Jemboss combile. I am including my jemboss.properties and runJemboss.csh files. Any insight would be greatly appreciated! -------------- next part -------------- A non-text attachment was scrubbed... Name: runJemboss.csh Type: application/octet-stream Size: 725 bytes Desc: not available Url : http://lists.open-bio.org/pipermail/emboss/attachments/20031122/9c1c78f7/attachment.obj -------------- next part -------------- A non-text attachment was scrubbed... Name: jemboss.properties Type: application/octet-stream Size: 428 bytes Desc: not available Url : http://lists.open-bio.org/pipermail/emboss/attachments/20031122/9c1c78f7/attachment-0001.obj -------------- next part -------------- Thanks in advance, -Brett From c.a.nieduszynski at abdn.ac.uk Wed Nov 26 05:10:43 2003 From: c.a.nieduszynski at abdn.ac.uk (Conrad Nieduszynski) Date: Wed, 26 Nov 2003 10:10:43 +0000 Subject: [EMBOSS] EMBOSS on Mac OS X Message-ID: Hi, I'm trying to run EMBOSS through a Mac OS X terminal on a G4. So far I've used Fink to install EMBOSS. I'd also like to install MEME and BLAST. Any advice would be much appreciated, but some specific questions are: - What is the best way to install local versions of BLAST and MEME? - I'm trying to convert a fasta sequence file into a database file that can be used by EMBOSS (although I'd really like it to also be available to MEME and BLAST) using the command: % dbifasta -idfor simple -file myfile.fasta -dir . -dbname mydb -auto however I received the following error (multiple times): Warning: ajStrFixI called with length 4096 for string with size 4096 The new database appears to there (from showdb), but the sequences are now accessible to infoseq. Does this error message mean anything to anyone? Thanks, Conrad Dr Conrad Nieduszynski DNA replication lab, Institute of Medical Sciences, Aberdeen University Aberdeen Dr Conrad Nieduszynski Cancer Research UK Chromosome Replication Group, Division of Gene Regulation and Expression, School of Life Sciences, University of Dundee, MSI/WTB Complex, Dow Street Dundee DD1 5EH Scotland, U.K. From sebastian.bassi at ar.advantaseeds.com Wed Nov 26 22:08:55 2003 From: sebastian.bassi at ar.advantaseeds.com (Bassi, Sebastian) Date: Thu, 27 Nov 2003 04:08:55 +0100 Subject: [EMBOSS] Question about DeltaS and DeltaH Message-ID: Hello, I'm trying to reproduce the DeltaS and deltaH results from dan.c in Python (in order to add tm as a function in BioPython). But I found some differences in dan's DeltaS calculation and my own calculations. I tried to follow EMBOSS code (dan.c, ajdan.c, Edna.melt) but I am not an C expert (just a newbie) so I can't follow all the code. I will tell you what I'm doing, maybe somebody could point me out my mistake. To get DeltaS (entropy) I'm adding all the ocurrences of all neighbor pair secuences: Take this sequence: ACCCTTCAGCAGTTCCACAC Here are all neighbors and their DeltaS values: AC = 22.4 CC = 19.9 CT = 21 TT = 22.2 TC = 22.2 CA = 22.7 AG = 21 GC = 24.4 CA = 22.7 AG = 21 GT = 22.4 TT = 22.2 TC = 22.2 CC = 19.9 CA = 22.7 AC = 22.4 CA = 22.7 AC = 22.4 Grant total = 396.4 According to DAN, the result should be: 416.3 It seems there is something I'm missing. Could you please give me a hint about this? Sebastian Bassi. Advanta Seeds. Balcarce Research Station. From terry_lamb_sw at megatime.de Thu Nov 27 03:28:44 2003 From: terry_lamb_sw at megatime.de (Terry Lamb) Date: Thu, 27 Nov 2003 08:28:44 +0000 Subject: [EMBOSS] =?ISO-8859-1?b?RG8geW91cnNlbGYgYSBmYXZvciEgTG9vayBhdCB0aGlz?= Message-ID: -------------- next part -------------- An HTML attachment was scrubbed... URL: http://lists.open-bio.org/pipermail/emboss/attachments/20031127/d65953e8/attachment.html From tmargus at ebc.ee Thu Nov 27 09:12:51 2003 From: tmargus at ebc.ee (=?iso-8859-13?Q?T=F5nu?=) Date: Thu, 27 Nov 2003 16:12:51 +0200 Subject: [EMBOSS] diffseq -rformat seqtable dont report deletions correctly Message-ID: Hi, When to use the table output format (-rformat seqtable), diffseq did not report deletions in one of a sequences correctly. It depend on what order you give an input. If deletion is in a second sequence (diffseq first.fa second.fa), then table output is correct. If deletion is in a first sequence (diffseq second.fa first.fa), then deletion (marked with dot) is replaced with a letter and from the tabel you can see nucleotide replacement. I tried EMBOSS v. 2.6 (LINUX) and winemboss0.5 (v2.7)and both behave similarly. Is it bug or is it feature? If it is bug, how to fix it? To illustrate situation look output. Test sequences are listed too. I DELETION IN THE SECOND SEQ CORRECT diffseq first.fa second.fa -rformat seqtable -wordsize 3 #======================================= Start End start end length name sequence first_feature second_feature Sequence 23 23 23 23 1 second a . . g 71 71 70 69 . second . . . c 470 470 469 469 1 second g . . a #--------------------------------------- II DELETION IN THE FIRST SEQ. DEL IS NOT SEEN first.fa pos 70C is replaced in this table wit second.fa 69T Only thing that refers to deletion in the table is smaller end pos (69) than start pos (70). diffseq second.fa first.fa -rformat seqtable -wordsize 3 #======================================= Start End start end length name sequence first_feature second_feature Sequence 23 23 23 23 1 first g . . a 70 69 71 71 1 first c . . t 469 469 470 470 1 first a . . g #--------------------------------------- test seqs are here > first AY45 acaattgaatgtctgcacagccgctttccacacagacatcataacaaaaaatttccacca aaccccccctccccccgcttctggccacagcacttaaacacatctctgccaaaccccaaa aacaaagaaccctaacaccagcctaaccagatttcaaattttatcttttggcggtatgca cttttaacagtcaccccccaactaacacattattttcccctcccactcccatactactaa tctcatcaatacaacccccgcccatcctacccagcacacacacaccgctgctaaccccat accccgaaccaaccaaaccccaaagacaccccccacagtttatgtagcttacctcctcaa agcaatacactgaaaatgtttagacgggctcacatcaccccataaacaaataggtttggt cctagcctttctattagctcttagtaagattacacatgcaagcatccccattccagtgag ttcaccctctaaatcaccacgatcaaaagggacaagcatcaagcacgcagcaatgcagct caaaacgcttagcctagccac > second acaattgaat gtctgcacagccactttccacacagacatcataacaaaaaatttccacca aaccccccctcccccgcttctggccacagcacttaaacacatctctgcca aaccccaaaaacaaagaaccctaacaccagcctaaccagatttcaaattt tatcttttggcggtatgcacttttaacagtcaccccccaactaacacatt attttcccctcccactcccatactactaatctcatcaatacaacccccgc ccatcctacccagcacacacacaccgctgctaaccccataccccgaacca accaaaccccaaagacaccccccacagtttatgtagcttacctcctcaaa gcaatacactgaaaatgtttagacgggctcacatcaccccataaacaaat aggtttggtcctagcctttctattagctcttagtaagattacacatgcaa gcatccccgttccagtgagttcaccctctaaatcaccacgatcaaaaggg acaagcatcaagcacgcagcaatgcagctcaaaacgcttagcctagccac T?nu Margus Estonian Biocentre Riia 23 Tartu Estonia E-mail tmargus at ebc.ee From ILMILIONE at hgmp.mrc.ac.uk Thu Nov 27 14:15:54 2003 From: ILMILIONE at hgmp.mrc.ac.uk (ILMILIONE at hgmp.mrc.ac.uk) Date: 27 Nov 2003 20:15:54 +0100 Subject: [EMBOSS] immagina di avere un MILIONE di euro Message-ID: <20031127191600.0F88C7D232@mercury.hgmp.mrc.ac.uk> <<<<<<<>>>>>>> HAI MAI PROVATO A GIOCARE E VINCERE 1 MILIONE DI EURO ? CON INTERNET? Questo potrebbe anche sembrarti uno dei tanti scherzi che si ricevono via e-mail ma Ti chiedo soltanto un paio di minuti del tuo tempo prezioso e un invito a leggere questa lettera: e ti prometto che quando l? avrai terminata la tua vita sara` gia` cambiata !!! Bene, prima di continuare nel nostro viaggio verso la tua vincita e il tuo successo, salva su disco questa pagina per averla a portata di mano anche se il tuo PC non ? connesso a Internet, poi copia quanto segue in Word o in Blocco Note e stampalo, cos? lo potrai leggere con pi? attenzione e, visto che stai leggendo voglio anche dirti che il tuo indirizzo e-mail l?ho reperito in Rete in maniera casuale, e voglio anche che tu sappia che questa sar? l'unica lettera che riceverai da me e quindi valuta molto bene il suo contenuto e poi ... ? sempre desiderabile giocare insieme ad altri e VINCERE!!! Quante volte hai tentato la fortuna al Totocalcio ??? Totogol ??? Enalotto, lotterie?.???? Hai fatto fortuna ??? NO ??? E probabilmente il tutto ti e` costato una gran bella cifra !!! NO?!? E se questa volta grazie a questa lettera CHE STAI LEGGENDO LA DEA BENDATA ti stesse veramente bussando nella Cassetta Postale? PERCHE' PREOCCUPARSI ?FINALMENTE E' ARRIVATO IL TUO MOMENTO,... SI, QUELLO DI VINCERE DAVVERO AL 100%, perche` e` stato provato che nessuno puo` perdere, nessuno !!! Non si puo` perdere ma solo vincere... per il semplice motivo che ci sono migliaia di nuovi giocatori ogni giorno che vi vogliono partecipare, e aspettano che i fortunati che sono in possesso di questa e-mail (quale sei tu ad esempio), la spediscano anche a loro. In questa e-mail ti sveliamo il segreto di come ACCUMULARE UNA FORTUNA in sole 6 settimane, grazie ad un sistema infallibile. SEI UNO DEI PRIMI FORTUNATI ITALIANI A RICEVERE QUESTA CHE CON IL PASSARE DEI GIORNI DIVENTERA' UN E-MAIL FAMOSISSIMA, DELLA QUALE TUTTI PARLERANNO, GARANTITO !!! E' STATA FINALMENTE TRADOTTA ANCHE IN ITALIANO, PER IL TUO SUCCESSO !!! UN SISTEMA CHE SOSTITUISCE COMPLETAMENTE TOTOCALCIO, TOTOGOL, LOTTO, ENALOTTO E BINGO VARI !!! BASTA GIOCARE E SPRECARE SOLDI INUTILMENTE !!! COMINCIA A VINCERE UNA VOLTA PER TUTTE 500.000? - 1 MILIONE ? IN 6 SETTIMANE !!! HAI MAI IMMAGINATO DI POTER ordinare la nuova, fiammante macchina che ti meriti, o recarti alla banca e pagare una volta per tutte quel mutuo sulla casa o appartamento !!! Oppure prenderti un paio di mesi di vacanza a sciare in Montagna o in Crociera in uno di quei posti esotici dei quali hai sempre sognato, e poi ritornare a casa e decidire cosa fare con piu` di un MILIONE DI ? ancora a disposizione !!! Potrebbe anche sembrarti uno scherzo ma potrebbe se segui il giocho diventare realt?!!! Sono d'accordo che i sogni possono aiutarti a vivere meglio ma non bastano. Questa e` PURA REALTA`, e succedera` anche a te nelle prossime 6 settimane, grazie all?incredibile sistema de ?ILMILIONE? !!! 6 SOLE SETTIMANE: questo e` quanto ci vuole per accumulare un minimo di 500.000? EURO, PARI A UN MILIARDO DI VECCHIE LIRE ITALIANE, ED ENTRARE NEL CLUB DEI NUOVI MILIARDARI DEL QUALE NE HANNO PARLATO ALL'ESTERO ULTIMAMENTE IN TV !!! Questa e` la testimonianza di Marco Fantini, l?Italiano che ha deciso di tradurre questa famosa e-mail oggi in circolazione: "Chi ti scrive e` un italiano, Marco Fantini, nato e cresciuto a Viareggio, una cittadina alle porte della Toscana, nel Centro Italia. Mi sono sposato e trasferito negli Stati Uniti nel 1993, dopo un corso estivo al Campus dell? Universita` del nord Colorado, e tuttora vivo con mia moglie e i miei due figli in una bellissima cittadina chiamata Fort Collins, sempre nel nord Colorado. La ragione per cui ti scrivo e` perche` ormai da 5 mesi la mia vita e quella della mia famiglia e` totalmente cambiata. Perche` ??? Ho vinto la bellezza di $712.455 dollari, equivalenti a 1.426.862.000 lire italiane, senza fare assolutamente nulla !!! Quello che e` successo a me succedera` a tutti quelli che decideranno di partecipare all? ormai famoso "?ILMILIONE?": E` GARANTITO !!! Perche` e` l?unico sistema al mondo col quale si puo` solo vincere. La sua testimonianza continua: "Questo sistema ? tutto meno ch? una piramide o il classico multilevel perch? qui il sistema ? orizzontale, sei tu il vertice e sei tu la piramide e se gli altri quattro che sono con te nella lista, fanno la loro parte il flusso si moltiplica esponenzialmente. Se hai dimestichezza con Internet e col pc hai maggior possibilit? di espandere e far fruttare i tuoi indirizzi facendo partecipare altri giocatori insieme a te al generatore di benessere e in ogni caso la Bont? del sistema ? nei Report che ne sono la parte essenziale per il tuo SUCCESSO!!! Grazie ad Internet e ad un programma imbattibile che ha gi? colto l?attenzione di alcune reti televisive straniere (oltre ai migliaia di servizi dedicati dalle televisioni americane) sveliamo il segreto di come e` possibile continuare a vincere la somma di 1 MILIONE DI EURO OGNI 6 settimane (UN MINIMO DI 13 MILIARDI ALL? ANNOdi Vecchie Lire !!!). Ecco come funziona. I partecipanti provengono da tutto il mondo, Australia, Canada, Inghilterra, Germania, Nuova Zelanda (paesi che in genere sono di madrelingua inglese, o lo parlano come seconda lingua), ma il 92% di essi sono agguerriti americani, entusiasmati dai telegiornali degli USA che cercano di dare una spiegazione a questa incredibile ondata di nuovi miliardari, che solo nel secondo semestre del 2001 ha contato piu` di 928.000 fortunati soltanto negli USA. La ragione di questo successo ? semplice: con il solo investimento di ? 25 euro si entra in un giro mondiale, INVIANDO E-MAIL GRATUITAMENTE E SENZA FARE SPAMMING (come definito nel report 3) a tutti quelli che vogliono partecipare e che sono in trepida attesa di farlo. Si, perch? la chiave ? proprio ricevere questa e-mail (che e` stata finalmente tradotta da un gentile italiano residente negli USA per il beneficio di tutti i giocatori italiani). Se non si riceve la e-mail non si accede al sistema e si ? tagliati fuori. Sei probabilmente uno dei primi italiani a ricevere questa e-mail, visto che e` stata tradotta soltanto un 3 settimane fa. Ci sono milioni di persone in tutta Italia e in tutto il mondo che sono ansiosi di ricevere questa e-mail da te. Una volta che inserisci il tuo nome, indirizzo e indirizzo e-mail e` fatta, sei nel sistema e ci resterai fino a quando deciderai che ne hai abbastanza di tutti quei soldi !!! I partecipanti al giorno d?oggi sono stimati attorno ai 25 milioni, e crescono di giorno in giorno. Poiche` bisogna aspettare il proprio turno prima di rientrare in un nuovo giro (dalla 5 alla 1 posizione) chi esce (con un guadagno stimato in media fra i 500 mila euro e 1 milione di euro) rientra di nuovo rispondendo ad un?altra e-mail che ha ricevuto nel frattempo. Il risultato: un sistema che non ha mai fine, tenuto in piedi dai soliti giocatori e in piu` da tutti quelli che si uniscono ogni giorno, incrementando il massiccio scambio di denaro. Un giro di centinaia di miliardi al giorno, spediti in piccole banconote da 5 euro ciascuna. Un programma che, GRAZIE AD INTERNET, non ha mai fine, poiche` i partecipanti entrano ed escono continuamente (non contando i nuovi partecipanti che si uniscono ogni giorno) investendo ogni volta la piccola somma di 25 euro, e intascando i miliardi spettanti ad ogni giro !!! Ovviamente si pu? uscire quando si vuole, non c?? nessun obbligo, ma perch? uscire quando si ? parte di un club di miliardari ??? Gli USA stimano che almeno 927.900 di quei 928.000 nuovi miliardari sono gi? rientrati, centuplicando il numero di miliardari nei prossimi 6 mesi !!! La differenza fra i vecchi sistemi multi livello e questo e` molto semplice: 1: l? investimento ? decisamente minimo, chiunque pu? permetterselo, giovane o vecchio, studente o impiegato, disoccupato o meno. Per iniziare si pu? anche partecipare in gruppi, se si vuole. 2: nessuna perdita di tempo nel convincere qualcuno a partecipare, poiche` grazie ai programmi dispedizione e raccolta delle email in modo anonimo completamente automatici ti permettono di arrivare all'attenzione di milioni di italiani pronti a giocare, e aspettano di ricevere questa e-mail da te. 3: la vincita ? rapida: 6 sole settimane per una somma minima che si aggira fra i 500.000 e 1 MILIONE di Euro ? !!! Un record, nessun altro sistema ? mai stato tanto veloce quanto ?IL MILIONE? !!! 4: non c?e` nessuna organizzazione dietro questo semplice ma efficace sistema. I soli giocatori tengono in piedi l?intero sistema (da loro "battezzato" ?ILMILIONE? ), che funziona alla perfezione da 2 anni a questa parte. Non c?? nessuna percentuale da pagare. I soldi vengono scambiati e spediti direttamente alle case dei singoli giocatori. Tutti gli altri sistemi esistenti hanno una sede fissa e si appropriano di una grossa percentuale dei soldi investiti, li maneggiano e poi decidono chi deve vincere, per cui nessuna vincita puo` essere assicurata. 5: ?IL MILIONE? ? l?unico sistema esistente al mondo che ti permette una vincita multipla: si vince ogni 6 settimane, fino a quando si decide di ritirarsi, perch? se ne ha abbastanza di tutto quel denaro. 6: L? opportunit? di ricevere informazioni gratis per incrementare e gestire le proprie vincite. Se decidete di partecipare, riceverete i 5 "reports" dai membri della vostra lista, che contengono informazioni utilissime, come scaricare GRATIS da Internet software elaborati e costosi (valore di mercato di 1000 EURO, completamente GRATIS !!!) PER GESTIRE, SCARICARE E SPEDIRE IN MODO ANONIMO E-MAIL a piu` di 10.000.000 di indirizzi (Avalanche, NetTron, DirectMail, ecc.), pi? tante altre utilissime informazioni sul come incrementare le vincite con il sistema, completamente GRATIS !!! Questo e` il segreto di ?IL MILIONE? , la vincita e` 100% assicurata !!! Tutto diventa possibile, si pu? solamente vincere!!! Chi si inserisce ha la certezza matematica di ricevere ALMENO 1 MILIONE DI EURO nel giro di 6 settimane, perche` ricevera` i soldi da coloro che hanno gia` vinto e desiderano rientrare e raddoppiare, triplicare, ecc. la loro vincita (CONTANDO anche sull'espansione del sistema e SULL?INGRESSO DI MIGLIAIA DI NUOVI PARTECIPANTI OGNI GIORNO). Un conduttore di una trasmissione Americana ha commentato cosi`: "Seriamente, non ho mai visto niente del genere sino ad oggi !!!". ?ILMILIONE? e` stato definito "IL GENERATORE DI BENESSERE DEL XXI SECOLO !!!". E tu ??? Sei pronto ad unirti al club di miliardari ??? Il principio ? quasi simile a quello utopico del "se ognuno dei 5 miliardi di persone oggi esistente sulla terra spedisse 1 EURO a te che stai leggendo, A TURNO la ricchezza si sposterebbe in continuazione e vivremmo tutti chi prima e chi dopo in un mondo di milionari". Il fatto e` che non si pu? costringere qualcuno a versare dei soldi ad un altro individuo. Ecco che il concetto di ?ILMILIONE? entra in gioco: ci vuole un club di giocatori intenzionati a scambiarsi ogni 6 settimane 5 EURO a testa, collezionando 1 MILONE DI EURO A TURNO. Questo e` il semplice segreto di un sistema che non ha eguali in tutto il mondo. ?ILMILIONE? e` un club di oneste persone comuni COME TE che hanno tutto l?interesse di tenere in piedi un sistema che genera benessere per tutti. I soldi contenuti nelle lettere vengono spediti direttamente alle case dei partecipanti, e non raccolti da "?anonimi enti" come in altri sistemi. Come su questa e-mail, che sara` la tua lista se decidi di partecipare, ci sono i nominativi di 5 persone comuni come te, provenienti da tutto il mondo. LE SEGUENTI SONO ISTRUZIONI FONDAMENTALI DI CUI HAI BISOGNO: POICH? IL CONTENUTO DI QUESTA E-MAIL ? TROPPO PREZIOSO, STAMPA UNA COPIA DI QUESTA E- MAIL ADESSO E SALVALA SU UN CD O FLOPPY DISK, NEL QUALCASO TU ABBIA PROBLEMI CON IL TUO COMPUTER. ===== COME ORDINARE I 5 "REPORTS" DALLA LISTA CHE SEGUE ===== Che cos?e` un "report" ??? Un report non e` altro che una serie di informazioni utilissime su come scaricare assolutamente gratis costosi software dall? Internet (che potranno risultare di grande aiuto nella gestione e spedizione ad alta velocita` di e-mail) gestire patrimoni senza pagare tasse, ecc., accuratamente tradotti in italiano. Per ogni report spedisci 5 euro che puoi trovare al piu` vicino ufficio postale o alla tua banca. Ci sono stati giocatori che, per ragioni sconosciute, hanno spedito i 5 euro nella valuta del loro paese. Poiche` il dollaro americano e` stato scelto e adottato sin dall?inizio del sistema, ed ha funzionato alla perfezione per ormai 2 anni, non possiamo garantire il fatto che, se spedirai banconote in diverse valute, saranno accettate. I giocatori del sistema, specialmente stranieri, che si aspettano di ricevere euro o dollari, non accetteranno altre valute, perche` non conoscono il cambio corrente, e probabilmente rispediranno indietro le tue lettere. Per qualsiasi ragione, non spedire MAI moneta, solo banconote, altrimenti dovrai pagare una tariffa postale maggiore, dovuta al peso. PER EVITARE che i soldi spediti vengano intercettati e rubati, da un p? di tempo a questa parte, si e` adottato il sistema di "incartare" la banconota in due fogli di carta formato A4, piegati in tre, come si piegherebbe una semplice lettera da infilare in una busta normale da lettera. Su uno dei due fogli, scrivi in stampatello (meglio se stampato al computer) a caratteri chiari e leggibili, il nome e il numero del report che stai ordinando, il tuo indirizzo e-mail, e il tuo nome e indirizzo postale. Quindi: per ogni report spedisci una banconota del valore di 5 dollari incartata fra 2 fogli di carta formato A4, il nome e numero di report richiesto, il tuo indirizzo e-mail, il tuo nome e indirizzo postale. Se non vuoi far apparire il tuo nome e indirizzo sulla lista (anonimato), puoi usare una casella postale come indirizzo, e il nome di una compagnia al posto del tuo nome e cognome (ad esempio: XYZ Servizi, Casella Postale 12345, Roma, Italy). Ricorda di scrivere il tuo indirizzo (mittente) sulla busta, nel caso in cui ci siano difficolta` postali. Quando ordini i report, devi ordinare tutti i 5 report, perch? hai bisogno di "spedirli" tramite e-mail alle persone che li richiederanno da te, dandoti 5 euro per ognuno di essi (anche se sono gia` in possesso di essi, nel caso di giocatori che rientrano, ma il sistema richiede la consegna di 5 euro in cambio dei report). Quando ricevi i 5 report in 5 differenti e- mail, salva ogni report su un floppy disk o CD, affinch? niente vada perso. Se li perdi, non puoi continuare nel sistema, poiche` non hai niente da "dare" agli altri giocatori. Il costo totale del tuo investimento e`: 5 x 5 EURO = 25 EURO, una sciocchezza paragonata a quello che riceverai !!! Nel giro di pochi giorni riceverai, come detto, le 5 e-mail con i 5 differenti report in italiano. Mentre aspetti per I 5 report ( numero 1, 2, 3, 4 e 5), prendi questa e-mail, che hai precedentemente salvato nel tuo computer, e fai quanto segue: 1. rimuovi il nome e l?indirizzo della persona accanto al report numero 5. Questa persona ha finito il suo turno e stara` contando il suo ?MILIONE?; 2. rimuovi il nome e l?indirizzo della persona accanto al report numero 4 e spostala (con copia/taglia e incolla) al numero 5; 3. rimuovi il nome e l?indirizzo della persona accanto al report numero 3 e spostala (con copia/taglia e incolla) al numero 4; 4. rimuovi il nome e l?indirizzo della persona accanto al report numero 2 e spostala (con copia/taglia e incolla) al numero 3; 5. rimuovi il nome e l?indirizzo della persona accanto al report numero 1 e spostala (con copia/taglia e incolla) al numero 2; 6. inserisci il tuo nome e indirizzo accanto al report numero 1. Fatto, ora sei ufficialmente nel sistema. Fai attenzione nel ricopiare tutti gli indirizzi: controlla sempre che tutti i nomi e gli indirizzi siano scritti in maniera corretta (specialmente nel caso di giocatori stranieri). Dopo cio`, salva la nuova e-mail nel tuo computer, e fai anche una copia e salvala su un floppy disk o CD. NON FARE ASSOLUTAMENTE ALTRE MODIFICHE. Il prossimo passo e` quello di spedire le e-mail a tutte le persone che le stanno ansiosamente aspettando. E' tutto molto semplice, quindi evita di preoccuparti di spiegare il sistema ad amici e conoscenti. Quello che devi fare e` spedire questa e-mail, cominciando dalla lista di amici presente nel tuo Microsoft Outlook Express, o software simile, dove tieni la lista di indirizzi e-mail dei tuoi amici. Tu puoi spedire quante e-mail vuoi: il minimo e` 5. 1: Ok, vediamo come funziona. Supponiamo che spedisci 20 e-mail a 20 persone. Pur essendo tutti in attesa di questa e-mail, soltanto 10 di loro trovano il tempo di ordinare il report numero 1 da te. 2: Quelle 10 persone spediscono a loro volta 20 e-mail a testa, per un totale di 200 e-mail. Di nuovo, pur essendo tutti in attesa di ricevere questa e-mail ed intascare i loro miliardi, soltanto la meta` di loro, 100 persone, ha il tempo di ordinare il report numero 2. 3: Quelle 100 persone spediscono a loro volta 20 e-mail a testa, per un totale di 2000 e-mail. Stessa storia, solo 1000 di loro trova il tempo di ordinare il report numero 3. 4: Quelle 1000 persone spediscono 20 e-mail ciascuno, per un totale di 20.000 e-mail. Solo 10.000 di loro ordina il report numero 4. 5: Quelle 10.000 persone spediscono 20 e-mail a testa, per un totale di 200.000 e-mail. Solo la meta` di loro ordina il report numero 5. Ora, un po? di matematica. Il totale della vincita in questo caso, dove non si ha il pieno potenziale di giocatori, poiche` si presume che soltanto la meta` della meta` della meta`, ecc. Partecipi, e` il seguente: Per il report numero 1: 10 richieste = 10 x 5 euro = 50 euro = 100.000 vecchie lire Per il report numero 2: 100 richieste = 100 x 5 euro = 500 euro = 1.000.000 vecchie lire Per il report numero 3: 1.000 richieste = 1.000 x 5 euro = 5.000 euro = 10.000.000 vecchie lire Per il report numero 4: 10.000 richieste = 10.000 x 5 euro = 50.000 euro = 100.000.000 vecchie lire Per il report numero 5: 100.000 richieste = 100.000 x 5 euro = 500.000 euro = 1.000.000.000 vecchie lire Totale: 50 + 500 + 5.000 + 50.000 + 500.000 = 555.550 euro pari a 1.111.100.000 vecchie di lire !!!! Questo ? il minimo che ognuno vincer? poich? ? stato ormai sperimentato e testato negli anni scorsi: ma se ognuno spedisce piu` di 20 e-mail, e cosi` gli altri partecipanti, la vincita avr? proporzioni stratosferiche che nemmeno potete immaginarvi, ma e` possibile allo stesso tempo, senza dubbio, succede tuttora E SPESSO di avere vincite da 12 zeri !!! Questo dipende da te, se hai il tempo e la voglia di spedire e-mail a persone che conosci (con i programmi dei report), o se trovi indirizzi e-mail su vari siti web gratuiti: non farai altro che incrementare il valore della tua vincita. Quando parliamo di una vincita di ?ILMILIONE? ogni 6 settimane, ci riferiamo ad una vincita media (dati forniti dalle varie trasmissioni televisive che hanno fatto ricerche fra I numerosi partecipanti e redatto delle statistiche) fra tutti I giocatori partecipanti. La media di e-mail spedite e` di 5.4 a persona. Ecco perch? possiamo parlare di una vincita "facile", poche` l?unica cosa da fare e` aprire la propria agenda di indirizzi e-mail di amici e conoscenti, e spedire la e-mail con il prorio nome vicino al report numero 1. Se ci pensate, ? proprio un gioco da ragazzi !!! Ma se volete ambire ad una vincita incredibile (ACCUMULARE UNA FORTUNA CHE SUPERA IL MILIONE) avete la possibilit? di farlo, E dipende tutto da voi. Vi sono giocatori nel sistema che arrivano a spedire anche 1 milione di e-mail nel giro di un paio di settimane in modo anonimo e senza fare spamming: vi lascio pensare qual?e` l?entita` della loro vincita !!!! Ti auguriamo un in bocca al lupo e buon divertimento come nuovo Milionario !!! ========== LA TUA LISTA DEI REPORT IN ITALIANO ========== ORDINA UNA COPIA PER OGNI REPORT: REPORT NUMERO 1 : "Advanced Email Searcher 1.1. Free" Ordina il report numero 1 da: Paola GANDIN Via XXIV Maggio, 25 34074 Monfalcone - Italy ______________________________________________________________________ REPORT NUMERO 2 : "LIBERO SCAMBIO DELLE RISORSE E LIBERA ESPRESSIONE, COME ESPANDERE I TUOI CONTATTI IN LIBERTA' " Ordina il report numero 2 da Marilisa MORASSI Via Salvo D'Acquisto, 7/4 34079 Staranzano - Italy ___________________________________________________________________________ ________________________ REPORT NUMERO 3 : ?COME INVIARE E-MAIL LIBERAMENTE E VIVERE FELICI senza Spam di Tomhak? Ordina il report numero 3 da: Vinicio DE BORTOLI Via F.lli Fontanot, 18 34074 Monfalcone - Italy ___________________________________________________________________________ __________________ REPORT NUMERO 4 : "Faq, PERCHE' ?ILMILIONE? funziona rimanendo un sistema Libero dalle lobby" Ordina il report numero 4 da: Associazione BASILICO c/o Zappal? Marilia v.dell'Angnolo 64 50122 - Firenze - Italy _____________________________________________________________ REPORT NUMERO 5 : ?Istruzioni Advanced Email Searcher 1.1 Free? Ordina il report numero 5 da: Anna GREGORUTTI c/o PACHAMAMA Via della Liberazione, 10 18035 Dolce Acqua - Italy _____________________________________________________________________ BUONA FORTUNA E RACCOGLI IL TUO ?ILMILIONE?! <<<<<<>>>>>> "L'amore rappresenta un ponte di energia tra lo spirito di due singoli. Non appena ? presente un tipo di amore incondizionato, e si accettano tutti gli altri della formazione come una parte necessaria del tutto, la Grande Ala non rappresenter? nessuno sforzo per te. Ma se proverai anche una piccola forma di risentimento verso un altro o verso te stesso, ti verr? a mancare lo Spirito di Stormo e vacillerai. I tuoi pensieri pi? profondi li sperimenterai come venti di vita mentre starai volando. Cerca sempre di pensare alla Grande Ala e ama ogni essere per la parte che svolge e troverai che il vento ti sollever? con una facilit? che ti lascer? attonito." Louis A. Tartaglia, "La grande Ala" -------------- next part -------------- An HTML attachment was scrubbed... URL: http://lists.open-bio.org/pipermail/emboss/attachments/20031127/2c935db4/attachment.html From sebastian.bassi at ar.advantaseeds.com Thu Nov 27 15:00:44 2003 From: sebastian.bassi at ar.advantaseeds.com (Bassi, Sebastian) Date: Thu, 27 Nov 2003 21:00:44 +0100 Subject: [EMBOSS] Question about DeltaS and DeltaH Message-ID: Hello Guy Bottu, Thank you very much! Now I traced the problem back to the code, and the problem was that the function I used (string.count) counts "non-overlapping" ocurrences. I will search for a replace of this function or maybe I will have to write my own. Thank you again! UPDATE: Thank to another member of the BioPython list, I finish this. He did the string count with overlapping support and I did the rest. Sebastian Bassi. Advanta Seeds. Balcarce Research Station. > -----Original Message----- > From: Guy Bottu [mailto:gbottu at ben.vub.ac.be] > Sent: Thursday, November 27, 2003 8:37 AM > To: Bassi, Sebastian > Subject: Re: [EMBOSS] Question about DeltaS and DeltaH > > > from : Belgian EMBnet Node > > Dear Sebastian, > > The reason is simply that you forgot a CC pair. > > Don't worry, it happens to all of us. I will never forget the > day when I > sent a bug report to Prof. Felsenstein, complaining that the PHYLIP > package did not run properly on my computer, while I had used a wrong > input file format... > > Regards, > Guy Bottu > > > > > Take this sequence: ACCCTTCAGCAGTTCCACAC > > > > Here are all neighbors and their DeltaS values: > > > > AC = 22.4 > > CC = 19.9 > CC = 19.9 > > CT = 21 > > TT = 22.2 > > TC = 22.2 > > CA = 22.7 > > AG = 21 > > GC = 24.4 > > CA = 22.7 > > AG = 21 > > GT = 22.4 > > TT = 22.2 > > TC = 22.2 > > CC = 19.9 > > CA = 22.7 > > AC = 22.4 > > CA = 22.7 > > AC = 22.4 > > Grant total = 396.4 > 416.3 > From simonstockes at yahoo.fr Sat Nov 29 09:29:12 2003 From: simonstockes at yahoo.fr (simon stockes) Date: Sat, 29 Nov 2003 15:29:12 +0100 Subject: [EMBOSS] Impossible t ofetch a sequence from srs internet site with "seqret" command Message-ID: <671411EC-2278-11D8-A28B-000393AF484C@yahoo.fr> Hi All, I'm trying to fetch a sequence from srs site with "seqret" command and got an error. This error was obtain from "seqret -debug qasrswww:HSCAD5 HSCAD5.fasta" commande line and the emboss.default part corresponding is : DB qasrswww [ type: "N" format: "embl" methodquery: "srswww" dbalias: "EMBL" fields: "sv des org key" url: "http://www.infobiogen.fr/srs71bin/cgi-bin/wgetz" comment: "Remote SRS web server" ] Config Mac OS 10.2.8, G3 ibook, /usr/local installation (with fink installation I got the same error). I suspect there is no proxy between me and the srs server. The seqret.dbg file (see below) says : it get the sequence file but there is a problem after .... Hope tracks, Simon. seqret.dbg ========= Debug file seqret.dbg buffered:No ajFileNewIn '/usr/local/emboss/share/EMBOSS/acd/seqret.acd' EOF ajFileGetsL file /usr/local/emboss/share/EMBOSS/acd/seqret.acd closing file '/usr/local/emboss/share/EMBOSS/acd/seqret.acd' ajFeatTabInNew 1b1320 ajSeqinClear called ajFeattabInClear called ++seqUsaProcess 'qasrswww:HSCAD5' 0..0(N) '' 0 USA to test: 'qasrswww:HSCAD5' format regexp: No list:No no format specified in USA ...input format not set dbname dbexp: Yes found dbname 'qasrswww' level: '' qry->QryString: 'HSCAD5' seqQueryFieldC usa 'sv' fields 'sv des org key' seqQueryField test 'sv' seqQueryField match 'sv' ajSeqQueryWild id 'HSCAD5' acc 'HSCAD5' sv 'HSCAD5' des '' org '' key '' wild (has) query Sv 'HSCAD5' database type: 'N' format 'embl' use access method 'srswww' Matched seqAccess[3] 'srswww' seqAccessSrswww EMBL:HSCAD5 seqHttpUrl http://www.infobiogen.fr/srs71bin/cgi-bin/wgetz searching with SRS url 'GET /srs71bin/cgi-bin/wgetz?-e+-ascii+[EMBL-id:HSCAD5]|[EMBL-acc:HSCAD5]' httpver getValueC '' httpver after qry '' host 'www.infobiogen.fr' port 80 get 'GET /srs71bin/cgi-bin/wgetz?-e+-ascii+[EMBL-id:HSCAD5]|[EMBL-acc:HSCAD5] HTTP/1.0 ' gethostbyname host 'www.infobiogen.fr' returns 'babbage.infobiogen.fr' errno 0 hp_addr 193.52.226.5 creating socket setup socket data connecting to socket 4 sin sizeof 16 connect status 0 errno 0 msg 'Successful system call (0 - Undefined error: 0)' inet_ntoa '193.52.226.5' sending: 'GET /srs71bin/cgi-bin/wgetz?-e+-ascii+[EMBL-id:HSCAD5]|[EMBL-acc:HSCAD5] HTTP/1.0 ' status: 82 send for GET errno 0 msg 'Successful system call (0 - Undefined error: 0)' sending: 'Host: www.infobiogen.fr:80 ' status: 27 send for host errno 0 msg 'Successful system call (0 - Undefined error: 0)' sending: ' ' status: 1 send for blankline errno 0 msg 'Successful system call (0 - Undefined error: 0)' fdopen errno 0 msg 'Successful system call (0 - Undefined error: 0)' EOF ajFileGetsL file End of file - data in buffer - return ajFalse First line [1] 'HTTP/1.1 200 OK ' fileBuffLineDel removing line [1], 'HTTP/1.1 200 OK ' len 16 first line gone, new start [1] 1b5e60, ' ' len 1 [1] fileBuffLineDel removing line [1], ' ' len 1 first line gone, new start [1] 1b5dd0, 'Date: Sat, 29 Nov 2003 09:46:49 GMT ' len 36 :[1] Date: Sat, 29 Nov 2003 09:46:49 GMT [1] fileBuffLineDel removing line [1], ' ' len 1 new next line [1] 1b5ea0, 'Server: Apache/1.3.27 (Unix) mod_perl/1.27 PHP/4.3.1 ' len 53 :[1] Server: Apache/1.3.27 (Unix) mod_perl/1.27 PHP/4.3.1 [1] fileBuffLineDel removing line [1], ' ' len 1 new next line [1] 1b6010, 'Connection: close ' len 18 :[1] Connection: close [1] fileBuffLineDel removing line [1], ' ' len 1 new next line [1] 1b60a0, 'Content-Type: text/plain ' len 25 :[1] Content-Type: text/plain [1] fileBuffLineDel removing line [1], ' ' len 1 new next line [1] 1b6130, ' ' len 1 [1] fileBuffLineDel removing line [1], ' ' len 1 new next line [1] 1b6170, ' ' len 1 [1] fileBuffLineDel removing line [1], ' ' len 1 new next line [1] 1b61b0, 'ID HSCAD5 standard; mRNA; HUM; 3170 BP. ' len 46 :[1] ID HSCAD5 standard; mRNA; HUM; 3170 BP. :[1] XX :[1] AC X59796; :[1] XX :[1] SV X59796.1 :[1] XX :[1] DT 12-FEB-1992 (Rel. 30, Created) :[1] DT 24-JAN-1995 (Rel. 42, Last updated, Version 6) :[1] XX :[1] DE H.sapiens mRNA for cadherin-5 :[1] XX :[1] KW cadherin. :[1] XX :[1] OS Homo sapiens (human) :[1] OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; :[1] OC Eutheria; Primates; Catarrhini; Hominidae; Homo. :[1] XX :[1] RN [1] :[1] RP 1-3169 :[1] RA Suzuki S.; :[1] RT ; :[1] RL Submitted (16-MAY-1991) to the EMBL/GenBank/DDBJ databases. :[1] RL S. Suzuki, Doheny Eye Institute, 1355 San Pablo St, Los Angeles, CA 90033, :[1] RL USA :[1] XX :[1] RN [2] :[1] RP 1-3169 :[1] RX MEDLINE; 91283540. :[1] RX PUBMED; 2059658. :[1] RA Suzuki S., Sano K., Tanihara H.; :[1] RT "Diversity of the cadherin family: evidence for eight new cadherins in :[1] RT nervous tissue"; :[1] RL Cell Regul. 2(4):261-270(1991). :[1] XX :[1] RN [3] :[1] RP 1-3170 :[1] RA Suzuki S.; :[1] RT ; :[1] RL Submitted (24-JAN-1995) to the EMBL/GenBank/DDBJ databases. :[1] RL S. Suzuki, Doheny Eye Institute, 1355 San Pablo St, Los Angeles, CA 90033, :[1] RL USA :[1] XX :[1] DR GOA; P33151. :[1] DR SWISS-PROT; P33151; CAD5_HUMAN. :[1] XX :[1] FH Key Location/Qualifiers :[1] FH :[1] FT source 1..3170 :[1] FT /db_xref="taxon:9606" :[1] FT /mol_type="mRNA" :[1] FT /organism="Homo sapiens" :[1] FT /dev_stage="fetus, 15-20 weeks" :[1] FT /tissue_type="brain" :[1] FT CDS 104..2446 :[1] FT /db_xref="GOA:P33151" :[1] FT /db_xref="SWISS-PROT:P33151" :[1] FT /product="cadherin-5" :[1] FT /protein_id="CAA42468.1" :[1] FT /translation="MMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDW :[1] FT IWNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERL :[1] FT DRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVG :[1] FT TSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIV :[1] FT VEARDAQGLRGDSGTATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDP :[1] FT DEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTI :[1] FT DLRYMSPPAGNRAQVIINITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARH :[1] FT SIGYSIRRTSDKGQFFRVTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESI :[1] FT VQVHIEVLDENDNAPEFAKPYQPKVCENAVHGQLVLQISAIDKDITPRNVKFKFILNTE :[1] FT NNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNE :[1] FT QGEFTFCEDMAAQVGVSIQAVVAILLCILTITVITLLIFLRRRLRKQARAHGKSVPEIH :[1] FT EQLVTYDEEGGGEMDTTSYDVSVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGA :[1] FT HGGPGEMAAMIEVKKDEADHDGDGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDY :[1] FT DFLNDWGPRFKMLAELYGSDPREELLY" :[1] XX :[1] SQ Sequence 3170 BP; 773 A; 962 C; 844 G; 588 T; 3 other; :[1] ctccactcac gctcagccct ggacggacag gcagtccaac ggaacagaaa catccctcag 60 :[1] cccacaggca cgatctgttc ctcctgggaa gatgcagagg ctcatgatgc tcctcgccac 120 :[1] atcgggcgcc tgcctgggcc tgctggcagt ggcagcagtg gcagcagcag gtgctaaccc 180 :[1] tgcccaacgg gacacccaca gcctgctgcc cacccaccgg cgccaaaaga gagattggat 240 :[1] ttggaaccag atgcacattg atgaagagaa aaacacctca cttccccatc atgtaggcaa 300 :[1] gatcaagtca agcgtgagtc gcaagaatgc caagtacctg ctcaaaggag aatatgtggg 360 :[1] caaggtcttc cgggtcgatg cagagacagg agacgtgttc gccattgaga ggctggaccg 420 :[1] ggagaatatc tcagagtacc acctcactgc tgtcattgtg gacaaggaca ctggcgaaaa 480 :[1] cctggagact ccttccagct tcaccatcaa agttcatgac gtgaacgaca actggcctgt 540 :[1] gttcacgcat cggttgttca atgcgtccgt gcctgagtcg tcggctgtgg ggacctcagt 600 :[1] catctctgtg acagcagtgg atgcagacga ccccactgtg ggagaccacg cctctgtcat 660 :[1] gtaccaaatc ctgaagggga aagagtattt tgccatcgat aattctggac gtattatcac 720 :[1] aataacgaaa agcttggacc gagagaagca ggccaggtat gagatcgtgg tggaagcgcg 780 :[1] agatgcccag ggcctccggg gggactcggg cacggccacc gtgctggtca ctctgcaaga 840 :[1] catcaatgac aacttcccct tcttcaccca gaccaagtac acatttgtcg tgcctgaaga 900 :[1] cacccgtgtg ggcacctctg tgggctctct gtttgttgag gacccagatg agccccagaa 960 :[1] ccggatgacc aagtacagca tcttgcgggg cgactaccag gacgctttca ccattgagac 1020 :[1] aaaccccgcc cacaacgagg gcatcatcaa gcccatgaag cctctggatt atgaatacat 1080 :[1] ccagcaatac agcttcatag tcgaggccac agaccccacc atcgacctcc gatacatgag 1140 :[1] ccctcccgcg ggaaacagag cccaggtcat tatcaacatc acagatgtgg acgagccccc 1200 :[1] cattttccag cagcctttct accacttcca gctgaaggaa aaccagaaga agcctctgat 1260 :[1] tggcacagtg ctggccatgg accctgatgc ggctaggcat agcattggat actccatccg 1320 :[1] caggaccagt gacaagggcc agttcttccg agtcacaaaa aagggggaca tttacaatga 1380 :[1] gaaagaactg gacagagaag tctacccctg gtataacctg actgtggagg ccaaagaact 1440 :[1] ggattccact ggaaccccca caggaaaaga atccattgtg caagtccaca ttgaagtttt 1500 :[1] ggatgagaat gacaatgccc cggagtttgc caagccctac cagcccaaag tgtgtgagaa 1560 :[1] cgctgtccat ggccagctgg tcctgcagat ctccgcaata gacaaggaca taacaccacg 1620 :[1] aaacgtgaag ttcaaattca tcttgaatac tgagaacaac tttaccctca cggataatca 1680 :[1] cgataacacg gccaacatca cagtcaagta tgggcagttt gaccgggagc ataccaaggt 1740 :[1] ccacttccta cccgtggtca tctcagacaa tgggatgcca agtcgcacgg gcaccagcac 1800 :[1] gctgaccgtg gccgtgtgca agtgcaacga gcagggcgag ttcaccttct gcgaggatat 1860 :[1] ggccgcccag gtgggcgtga gcatccaggc agtggtagcc atcttactct gcatcctcac 1920 :[1] catcacagtg atcaccctgc tcatcttcct gcggcggcgg ctccggaagc aggcccgcgc 1980 :[1] gcacggcaag agcgtgccgg agatccacga gcagctggtc acctacgacg aggagggcgg 2040 :[1] cggcgagatg gacaccacca gctacgatgt gtcggtgctc aactcggtgc gccgcggcgg 2100 :[1] ggccaagccc ccgcggcccg cgctggacgc ccggccttcc ctctatgcgc aggtgcagaa 2160 :[1] gccaccgagg cacgcgcctg gggcacacgg agggcccggg gagatggcag ccatgatcga 2220 :[1] ggtgaagaag gacgaggcgg accacgacgg cgacggcccc ccctacgaca cgctgcacat 2280 :[1] ctacggctac gagggctccg agtccatagc cgagtccctc agctccctgg gcaccgactc 2340 :[1] atccgactct gacgtggatt acgacttcct taacgactgg ggacccaggt ttaagatgct 2400 :[1] ggctgagctg tacggctcgg acccccggga ggagctgctg tattaggcgg ccgaggtcac 2460 :[1] tctgggcctg gggacccaaa ccccctgcag cccaggccag tcagactcca ggcaccacag 2520 :[1] cvncadctcc aaaaatggca gtgactcccc agcccagcac cccttcctcg tgggtcccag 2580 :[1] agacctcatc agccttggga tagcaaactc caggttcctg aaatatccag gaatatatgt 2640 :[1] cagtgatgac tattctcaaa tgctggcaaa tccaggctgg tgttctgtct gggctcagac 2700 :[1] atccacataa ccctgtcacc cacagaccgc cgtctaactc aaagacttcc tctggctccc 2760 :[1] caaggctgca aagcaaaaca gactgtgttt aactgctgca gggtcttttt ctagggtccc 2820 :[1] tgaacgccct ggtaaggctg gtgaggtcct ggtgcctatc tgcctggagg caaaggcctg 2880 :[1] gacagcttga cttgtggggc aggattctct gcagcccatt cccaagggag actgaccatc 2940 :[1] atgccctctc tcgggagccc tagccctgct ccaactccat actccactcc aagtgcccca 3000 :[1] ccactcccca acccctctcc aggcctgtca agagggagga aggggcccca tggcagctcc 3060 :[1] tgaccttggg tcctgaagtg acctcactgg cctgccatgc cagtaactgt gctgtactga 3120 :[1] gcactgaacc acattcaggg aaatggctta ttaaactttg aagcaactgt 3170 :[1] // ajRegFree 1b27a0 size regexp 4 ajRegFree 1b2890 size regexp 4 ajRegFree 1b2960 size regexp 4 ajRegFree 1b29e0 size regexp 4 ajRegFree 1b2a80 size regexp 4 ajRegFree 1afa60 size regexp 4 ajRegFree 1afb30 size regexp 4 ajRegFree 1afbc0 size regexp 4 ajRegFree 1afc50 size regexp 4 seqRead: seqin format 3 'embl' ajFeattableDel 0 seqRead: cleared seqRead: one format specified ajFileBuffNoBuff buffsize: 132 ++seqRead known format 3 ++seqReadFmt format 3 (embl) 'qasrswww:HSCAD5' feat No seqReadEmbl first line 'Date: Sat, 29 Nov 2003 09:46:49 GMT ' Format 3 (embl) failed, file buffer reset by seqReadFmt ++seqReadFmt failed - nothing read seqRead: (b2) seqReadFmt stat == FAIL *failed* ajFeattableDel 0 seqRead failed - try again with format 3 'embl' ++seqReadFmt format 3 (embl) 'qasrswww:HSCAD5' feat No seqReadEmbl first line 'Date: Sat, 29 Nov 2003 09:46:49 GMT ' Format 3 (embl) failed, file buffer reset by seqReadFmt ++seqReadFmt failed - nothing read seqRead: (b3) seqReadFmt stat == FAIL *failed* -------------- next part -------------- A non-text attachment was scrubbed... Name: not available Type: text/enriched Size: 12990 bytes Desc: not available Url : http://lists.open-bio.org/pipermail/emboss/attachments/20031129/734e4fd9/attachment.bin From ableasby at hgmp.mrc.ac.uk Sun Nov 30 12:04:55 2003 From: ableasby at hgmp.mrc.ac.uk (Alan Bleasby) Date: Sun, 30 Nov 2003 17:04:55 GMT Subject: [EMBOSS] EMBOSS 2.8.0 released Message-ID: <200311301704.hAUH4tei000865@bromine.hgmp.mrc.ac.uk> EMBOSS 2.8.0 is available for download from: http://www.uk.embnet.org/Software/EMBOSS ftp://ftp.uk.embnet.org/pub/EMBOSS Details of changes from 2.7.1 are, as usual, available in the ChangeLog file. Note that large file support is now the default compilation mode. The original indexing system is, however, still used in 2.8.0 so should not be used on individual database flat files >2Gb. We expect to release a new indexing system in 2.9.0 (in fact the code is distributed for this in 2.8.0 but is not yet integrated). GUI developers who did not pick up the pre-2.8.0 release should note that there have been significant changes to the ACD files in this release. COMPILATION: 1) Systems where gcc is not the system compiler (e.g. AIX,HP-UX,IRIX,Tru64, Solaris) We recommend using the default compiler for each platform. The configure scripts, being GNU, will preferentially use the gcc compiler by default. To use the system compiler type: setenv CC cc or the 'sh' equivalent before configuration. 2) Systems where gcc is the default compiler (e.g. Linux,MacOSX) No pre-configuration commands are required. EMBOSS should compile with gcc on systems even when it isn't the manufacturer supplied compiler for the platform however, using the recommended compiler will ensure that all compilation optimisations are applied. Use of the manufacturer's compiler also allows the --enable-64 switch to be used, should 64-bit pointers be necessary for any of your applications (and the architecture allows them). The --enable-64 flag is not necessary for normal EMBOSS operation and is therefore off by default. 3) IRIX systems You should: setenv CC cc as above. There is also a configuration switch for IRIX which you should use (--with-sgiabi=). This allows you to select 32/64-bit libraries and the MIPS level (3 or 4). The values accepted by the switch are: n32m3 n32m4 64m3 64m4 An example configuration line is: ./configure --with-sgiabi=n32m3 [etc] The --enable-64 flag is meaningless for IRIX as the use/non-use of 64-bit pointers is controlled by the --with-sgiabi switch. EMBASSY Note that, because of the ACD changes mentioned above, those sites who install the EMBASSY packages (also in ftp://ftp.uk.embnet.org/pub/EMBOSS/) will need to re-ftp and build them. SYSTEMS NOT DIRECTLY SUPPORTED BY THE CORE DEVELOPMENT TEAM Compilation of EMBOSS should still work. We patently have no way of testing this though. The compilation may not build in large file support for those platforms. Large file support is not strictly necessary for 2.8.0 but will be required when the new indexing system is released. We will be happy to hear from people, with experience of systems aspects of such platforms, and collaborate to make as many platforms as possible ready for the next release (email emboss-bug at embnet.org). Alan From Peter.Robinson at t-online.de Tue Nov 4 09:45:06 2003 From: Peter.Robinson at t-online.de (peter robinson) Date: Tue, 4 Nov 2003 10:45:06 +0100 Subject: [EMBOSS] Problems understanding use of ajAZToBin Message-ID: <200311041045.06890.peter.robinson@t-online.de> Dear EMBOSS friends, I was wondering if someone could help me understand the following code. codex = ajAZToBin(bases[0]); /* a "C" */ codey = ajAZToBin(bases[1]); /* a "G" */ (...snip...) codea=codeb; codeb=ajAZToBin(seq[i+1]); if(codea && !(codea & (15-codex))) { ...do something. } I realize that ajAZToBin is a function that returns a binary OR'd representation of an IUB base where A=1, C=2, G=4 and T=8, so I imagine that that is where the 15 comes from in the above expression. If we then have 15-codex <=> 00001111 - 00000010 = 00001101 and assume that codea is 00000010 ("C"), then binary "AND"-ing it with 00001101 would result in false and the expression with ! would result in true. Why can't one say: if (codea && (codea & codex)) ?? Thanks Peter From d.gatherer at vir.gla.ac.uk Fri Nov 7 14:12:15 2003 From: d.gatherer at vir.gla.ac.uk (Derek Gatherer) Date: Fri, 07 Nov 2003 14:12:15 +0000 Subject: [EMBOSS] EMBOSS equivalents for GCG programs In-Reply-To: <5.2.1.1.1.20030930111106.00b14960@udcf.gla.ac.uk> Message-ID: <5.2.1.1.1.20031107135524.00af0808@udcf.gla.ac.uk> Hi The following is a description from the GCG manual of the GCG program Gap: Gap makes an alignment to find the maximum similarity between two sequences by the method of Needleman and Wunsch (J. Mol. Biol. 48; 443-453 (1970)) that is similar to finding the minimum difference according to the method of Sellers (SIAM J. of Applied Math 26; 787-793 (1974)). Smith, Waterman, and Fitch (J. Mol. Evol. 18; 38-46 (1981)) showed that the methods were precisely equivalent when the Needleman and Wunsch gap creation penalty is equal to the Sellers gap creation penalty - 0.5 and when the end gaps for Needleman and Wunsch are penalized in same way as all the other gaps. -ENDWeight allows you to penalize the end gaps introduced by Gap. I have to confess, I'm a bit baffled by this. Obviously, EMBOSS needle would do a NW alignment, but the gap opening penalty default in needle is 10 and the gap extension is 0.5. I'm not sure what is implied in Gap by "gap creation", or whether or not needle allows any end gap penalties. Does anybody have any particular recommendations about the appropriate needle parameters to use to emulate Gap's behaviour? I'm also looking for an equivalent of the GCG program Diverge, that calculates Ka/Ks values. I think there is no equivalent to this in EMBOSS, but I may have missed something? Cheers Derek From pmr at ebi.ac.uk Fri Nov 7 14:46:21 2003 From: pmr at ebi.ac.uk (Peter Rice) Date: Fri, 07 Nov 2003 14:46:21 +0000 Subject: [EMBOSS] EMBOSS equivalents for GCG programs In-Reply-To: <5.2.1.1.1.20031107135524.00af0808@udcf.gla.ac.uk> References: <5.2.1.1.1.20031107135524.00af0808@udcf.gla.ac.uk> Message-ID: <3FABB03D.9070609@ebi.ac.uk> Derek Gatherer wrote: > I have to confess, I'm a bit baffled by this. Obviously, EMBOSS needle > would do a NW alignment, but the gap opening penalty default in needle > is 10 and the gap extension is 0.5. I'm not sure what is implied in Gap > by "gap creation", or whether or not needle allows any end gap > penalties. Does anybody have any particular recommendations about the > appropriate needle parameters to use to emulate Gap's behaviour? In a Needleman-Wunsch global alignment, the entire length of each sequence is aligned. This can be thought of as an overlap between the two sequences (one can be completely within the otehr, or their ends can overlap). This leaves no penalty for the hanging ends of the overlap. In bioinformatics, it is usually reasonable to assume that the sequences are incomplete and there should be no penalty for failing to align the missing bases. In GCG's gap, "endweight" means that the hanging ends are treated as two more rather long gaps. This tends to force the ends of the sequences to be aligned (whether they should be or not) to reduce the number of gaps, and is usually not the option you want. it would not be too difficult to support endweights in needle (the difference is in setting up the gap penalties in the matrix at the start and end, the rest is the same). But ... is it useful? > I'm also looking for an equivalent of the GCG program Diverge, that > calculates Ka/Ks values. I think there is no equivalent to this in > EMBOSS, but I may have missed something? diverge is a strange best that was not too happy with large input data sets. GCG replaced it by "newdiverge" some time back with a different algorithm. EMBOSS supports phylip 3.5, which has distance methods, as an EMBASSY package. You may find what you need there, and phylip 3.6 will be stable soon and will appear as a new and more closely integrated EMBASSY package soon after. Again ... would phylip 3.6 in EMBOSS be useful? regards, Peter Rice From qtu at sibs.ac.cn Mon Nov 10 10:22:58 2003 From: qtu at sibs.ac.cn (Qiang Tu) Date: Mon, 10 Nov 2003 10:22:58 GMT Subject: [EMBOSS] about pepstats Message-ID: Hi, all, I want to calculate the molecular weight and isoelectric point of all sequences in genbank. Scripts are too slow and I want to use the programs in EMBOSS directly. There are two questions: 1. iep supports multi sequences in one file, but pepstats only output the result of the first sequence. Is that true? 2. how ca I make iep and pepstats output a simple result? I jus want the mw and pI. :-) Sorry for the trouble and thanks a lot! Qiang Tu From pmr at ebi.ac.uk Mon Nov 10 09:34:53 2003 From: pmr at ebi.ac.uk (Peter Rice) Date: Mon, 10 Nov 2003 09:34:53 +0000 Subject: [EMBOSS] about pepstats In-Reply-To: References: Message-ID: <3FAF5BBD.7010601@ebi.ac.uk> Qiang Tu wrote: > I want to calculate the molecular weight and isoelectric point of all sequences in genbank. Those are protein properties, so I assume you mean some other database? > Scripts are too slow and I want to use the programs in EMBOSS directly. > There are two questions: > > 1. iep supports multi sequences in one file, but pepstats only output the result of the first sequence. > Is that true? Yes - some programs in EMBOSS can work over all sequences in a database, or all sequences in a file or in a list of sequences. It depends on how useful such output is (for example, whether any EMBOSS user has asked for such an extension). It also depends on how easily a GUI or Web interface can cope with multiple outputs - they need to automatically match the outputs to each input sequence. > 2. how ca I make iep and pepstats output a simple result? I jus want the mw and pI. :-) That is something we are working on for a future release. Best to wait for a general solution. Meanwhile, you can use perl or some other scripts to extract the numbers you need from the output, and to run over all sequences. But, if you are programming - you could change the programs (we can help) to produce the output you want or to read sets of sequences. regards, Peter Rice From ableasby at hgmp.mrc.ac.uk Mon Nov 10 09:43:02 2003 From: ableasby at hgmp.mrc.ac.uk (Alan Bleasby) Date: Mon, 10 Nov 2003 09:43:02 GMT Subject: [EMBOSS] about pepstats Message-ID: <200311100943.hAA9h2fI015001@bromine.hgmp.mrc.ac.uk> Just to add that pepstats in the forthcoming release allows multiple sequences to be specified. You'll still have to parse the output for now though. Alan Bleasby HGMP From qtu at sibs.ac.cn Tue Nov 11 09:31:57 2003 From: qtu at sibs.ac.cn (Qiang Tu) Date: Tue, 11 Nov 2003 09:31:57 GMT Subject: [EMBOSS] about pepstats Message-ID: ---Original Message--- From: Peter Rice Subject: Re: [EMBOSS] about pepstats >Qiang Tu wrote: >> I want to calculate the molecular weight and isoelectric point of all sequences in genbank. > >Those are protein properties, so I assume you mean some other database? I am sorry I mean genbank's protein nr database. >> Scripts are too slow and I want to use the programs in EMBOSS directly. >> There are two questions: >> 1. iep supports multi sequences in one file, but pepstats only output the result of the first sequence. >> Is that true? > >Yes - some programs in EMBOSS can work over all sequences in a database, >or all sequences in a file or in a list of sequences. It depends on how >useful such output is (for example, whether any EMBOSS user has asked >for such an extension). > >It also depends on how easily a GUI or Web interface can cope with >multiple outputs - they need to automatically match the outputs to each >input sequence. I hope pepstats can deal with multiple sequences in one file, so I do not have to call the program by the script, which is slower than the program it self. :-) >> 2. how ca I make iep and pepstats output a simple result? I jus want the mw and pI. :-) > >That is something we are working on for a future release. Best to wait >for a general solution. > >Meanwhile, you can use perl or some other scripts to extract the numbers >you need from the output, and to run over all sequences. > >But, if you are programming - you could change the programs (we can >help) to produce the output you want or to read sets of sequences. Parsing output by perl is relatively fast, while calculation by script is much slower than pepstats. I read the source code, but it was difficult for me to understand. :-) Thank you for your help. Best regards, Qiang Tu From gbottu at ben.vub.ac.be Thu Nov 13 16:27:51 2003 From: gbottu at ben.vub.ac.be (Guy Bottu) Date: Thu, 13 Nov 2003 17:27:51 +0100 Subject: [EMBOSS] interference between databank and file names Message-ID: <20031113162751.GA25936@bigben.ulb.ac.be> from : BEN Dear colleagues, Today one of our users bumped on a problem. It is an old one, because it existed with GCG also. When you put a sequence in a file that happens to have the same name as an existing databank (from emboss.defaults), e.g. "sw", and you ask a program to operate on "sw" it will not take the sequence from the file but (depending on whether it's a sequence or a seqall) on the first or all sequences from SwissProt. What do you think about this ? Should the EMBOSS library routine that fetches the sequences look first in files and only then in databanks instead of the opposite, or give a warning message when there is a file/databank name interference ? Sincerely, Guy Bottu From fehertrans at interware.hu Sun Nov 16 05:17:30 2003 From: fehertrans at interware.hu (Feher Trans Bt.) Date: Sun, 16 Nov 2003 07:17:30 +0200 Subject: [EMBOSS] Dear Partner! Message-ID: <20031116060105.49BA87D2C7@mercury.hgmp.mrc.ac.uk> Dear Partner! Please apologize us for not contacting you for a long time. We recently performed a major structural transformation at the end of which we are on the Internet too. We consider that our present system is more efficient, because the employer can contact directly the applicant, all the information (resume, diplomas, passport copy, criminal and medical records, driving license copy) are online at his disposal, thus the administration is not slowing down the hiring process. Our website is available in six languages in order to ease up the collaboration. Please visit our website at: http://www.job-trans.info. Clicking on the flags on the header, you can choose the appropriate language. If you have any additional questions, please contact us, we are at your service. If there are major changes regarding your labor force request, since our last mail exchange, please send us an updated info, or contact directly the applicants from our database. In the hope of a future collaboration, Regards, Beatrix De Villa FEHER TRANS Ny?ry P?l u. 9/1 1056 Budapest Hungary Tel/Fax: +36 1 317 72 74 e-mail: fehertrans at interware.hu web: http://www.job-trans.info Ps: We apologize for any grammatical errors on our website, some parts of the site are still under development. Your ideas, comment are welcomed in the guest book. If you are interested in our advertising possibilities, please contact us at the above e-mail address. -------------- next part -------------- An HTML attachment was scrubbed... URL: From d.gatherer at vir.gla.ac.uk Mon Nov 17 12:28:07 2003 From: d.gatherer at vir.gla.ac.uk (Derek Gatherer) Date: Mon, 17 Nov 2003 12:28:07 +0000 Subject: [EMBOSS] needle output In-Reply-To: <3FABB03D.9070609@ebi.ac.uk> References: <5.2.1.1.1.20031107135524.00af0808@udcf.gla.ac.uk> <5.2.1.1.1.20031107135524.00af0808@udcf.gla.ac.uk> Message-ID: <5.2.1.1.1.20031117122352.00aecc30@udcf.gla.ac.uk> Hi I am using needle like this needle file1 file2 -gapopen 10.0 -gapextend 0.5 -out outfile.needle -aformat fasta which gives me a nice FASTA-formatted file with both sequences. However, I would like each sequence to be output into a separate FASTA-formatted file. Is there a command line toggle that does this? cheers Derek From David.Bauer at SCHERING.DE Mon Nov 17 12:35:03 2003 From: David.Bauer at SCHERING.DE (David.Bauer at SCHERING.DE) Date: Mon, 17 Nov 2003 13:35:03 +0100 Subject: Antwort: [EMBOSS] needle output Message-ID: Hello, you could use seqretsplit to create separate fasta files. Cheers, David. Derek Gatherer An: emboss at embnet.org Gesendet von: Kopie: owner-emboss at hgm Thema: [EMBOSS] needle output p.mrc.ac.uk 17.11.03 13:28 Hi I am using needle like this needle file1 file2 -gapopen 10.0 -gapextend 0.5 -out outfile.needle -aformat fasta which gives me a nice FASTA-formatted file with both sequences. However, I would like each sequence to be output into a separate FASTA-formatted file. Is there a command line toggle that does this? cheers Derek From d.gatherer at vir.gla.ac.uk Mon Nov 17 13:41:27 2003 From: d.gatherer at vir.gla.ac.uk (Derek Gatherer) Date: Mon, 17 Nov 2003 13:41:27 +0000 Subject: [EMBOSS] needle output In-Reply-To: Message-ID: <5.2.1.1.1.20031117134040.00aad340@udcf.gla.ac.uk> That's what I need! thanks At 13:35 17/11/2003 +0100, David.Bauer at SCHERING.DE wrote: >Hello, > >you could use seqretsplit to create separate fasta files. > >Cheers, >David. > > > > > > Derek > Gatherer > > la.ac.uk> An: emboss at embnet.org > > Gesendet > von: Kopie: > owner-emboss at hgmp Thema: [EMBOSS] needle > output > .mrc.ac.uk > > > > > > 17.11.03 > 13:28 > > > > > > > > >Hi > >I am using needle like this > >needle file1 file2 -gapopen 10.0 -gapextend 0.5 -out outfile.needle >-aformat fasta > >which gives me a nice FASTA-formatted file with both sequences. However, I > >would like each sequence to be output into a separate FASTA-formatted >file. Is there a command line toggle that does this? > >cheers >Derek From tapo at novozymes.com Mon Nov 17 14:28:51 2003 From: tapo at novozymes.com (TAPO (Thomas Agersten Poulsen)) Date: Mon, 17 Nov 2003 15:28:51 +0100 Subject: [EMBOSS] PDBtosp Message-ID: <76F96CFE2AA2114C886B028A065A7FC4134193@exdkba020.novo.dk> Dear list, Does anybody know what has happened to the pdbtosp tool? It was there in EMBOSS-2.4.1, but not in EMBOSS-2.6.0 and not in the current release. Best regards Thomas Thomas A. Poulsen (TAPo) Novozymes A/S DK-2880 Bagsv?rd +45 44 42 27 23 From pmr at ebi.ac.uk Mon Nov 17 14:43:38 2003 From: pmr at ebi.ac.uk (Peter Rice) Date: Mon, 17 Nov 2003 14:43:38 +0000 Subject: [EMBOSS] PDBtosp In-Reply-To: <76F96CFE2AA2114C886B028A065A7FC4134193@exdkba020.novo.dk> References: <76F96CFE2AA2114C886B028A065A7FC4134193@exdkba020.novo.dk> Message-ID: <3FB8DE9A.9040307@ebi.ac.uk> TAPO (Thomas Agersten Poulsen) wrote: > Dear list, > > Does anybody know what has happened to the pdbtosp tool? It was there in EMBOSS-2.4.1, but not in EMBOSS-2.6.0 and not in the current release. The HGMP protein structure applications are now in the EMBASSY package "domainatrix" (they moved there in EMBOSS 2.5.0) domainatrix is available on the EMBOSS FTP server. The applications run exactly as EMBOSS applications. You install EMBOSS first, then install EMBASSY applications in the embassy directory. Details are in the FAQ file in the EMBOSS distribution. regards, Peter Rice From henrikki.almusa at helsinki.fi Wed Nov 19 08:31:13 2003 From: henrikki.almusa at helsinki.fi (Henrikki Almusa) Date: Wed, 19 Nov 2003 10:31:13 +0200 Subject: [EMBOSS] Jemboss problem Message-ID: <200311191031.13064.henrikki.almusa@helsinki.fi> Hello, I'm trying to use jemboss as standalone and seem to have a problem with results. My emboss version is 2.7.0. The program i used was 'needle'. After clicking show result, the window was empty and when i tried to save to local file i got error trace into console. Trace is attached as Jemboss_save_error.log. Also i'm runnnig the standalone through my own script (bash-shell not csh) so that might also be cause, attached as runJemboss.bash. Small change was added to allow running from other dirs than '$emboss_path/share/EMBOSS/jemboss'. Any help is appreciated. -- Henrikki Almusa -------------- next part -------------- A non-text attachment was scrubbed... Name: Jemboss_save_error.log Type: text/x-log Size: 2225 bytes Desc: not available URL: -------------- next part -------------- A non-text attachment was scrubbed... Name: runJemboss.bash Type: application/x-shellscript Size: 822 bytes Desc: not available URL: From mdautova at watson.wustl.edu Thu Nov 20 15:59:21 2003 From: mdautova at watson.wustl.edu (Makedonka Dautova) Date: Thu, 20 Nov 2003 09:59:21 -0600 (CST) Subject: [EMBOSS] question on 'codcmp' Message-ID: <1139.10.0.7.188.1069343961.squirrel@watson.wustl.edu> Hi, I have a question regarding the output of codcmp (Codon usage table comparison) and was hopping that you can help me. After running the program we received the following output file: --------------------------------------------------------------------------- # CODCMP codon usage table comparison # anc_can.FULLSPECIES.cuspoutput vs anc_cey.FULLSPECIES.cuspoutput Sum Squared Difference = 0.036 Mean Squared Difference = 0.001 Root Mean Squared Difference = 0.024 Sum Difference = 1.038 Mean Difference = 0.016 Codons not appearing = 0 --------------------------------------------------------------------------- How do I interpret this? How do I know if the difference is statistically significant or not? Thank you in advance, Makedonka Mitreva. ************************************** Makedonka Dautova Mitreva, Ph.D. Project Leader, Parasitic Nematode ESTs Genome Sequencing Center, Department of Genetics, Washington University School of Medicine, Box 8501 4444 Forest Park Boulevard, St. Louis, MO 63108 mdautova at watson.wustl.edu Tel. + 314-286-1118 Fax. + 314-286-1810 http://nematode.net/ ************************************** From d.gatherer at vir.gla.ac.uk Thu Nov 20 17:01:36 2003 From: d.gatherer at vir.gla.ac.uk (Derek Gatherer) Date: Thu, 20 Nov 2003 17:01:36 +0000 Subject: [EMBOSS] question on 'codcmp' In-Reply-To: <1139.10.0.7.188.1069343961.squirrel@watson.wustl.edu> Message-ID: <5.2.1.1.1.20031120164050.00af95a0@udcf.gla.ac.uk> Hi This is a very interesting question. I don't think that there is any way to say if it is statistically significant just from looking at it, as it is essentially a descriptive statistic about the difference between two 64-mer (or is it 59-mer without stop, trp and met) vectors. If you have a whole lot of sequences and codcmp results for all the possible pairwise comparisons, then the resulting distance matrix can be used to build a phylogenetic tree based on codon usage. However, if you generate a series of random sequences, measure their codon usage and then do codcmp between each of your test sequences and all the random sequences, you could then use a z-test to see if the result between the two test sequences was outside of the top or bottom 5%. This would assume that the codcmp results were normally distributed, but you could test that too, either by plotting it or using an F-test. You could use shuffle to base your random sequences on the test sequences - so that would ensure the randomised background had the same nucleotide content. Cheers Derek At 09:59 20/11/2003 -0600, Makedonka Dautova wrote: >Hi, > >I have a question regarding the output of codcmp (Codon usage table >comparison) and was hopping that you can help me. > >After running the program we received the following output file: > >--------------------------------------------------------------------------- ># CODCMP codon usage table comparison ># anc_can.FULLSPECIES.cuspoutput vs anc_cey.FULLSPECIES.cuspoutput > >Sum Squared Difference = 0.036 >Mean Squared Difference = 0.001 >Root Mean Squared Difference = 0.024 >Sum Difference = 1.038 >Mean Difference = 0.016 >Codons not appearing = 0 >--------------------------------------------------------------------------- > >How do I interpret this? How do I know if the difference is statistically >significant or not? > >Thank you in advance, >Makedonka Mitreva. > >************************************** >Makedonka Dautova Mitreva, Ph.D. > >Project Leader, Parasitic Nematode ESTs >Genome Sequencing Center, >Department of Genetics, >Washington University School of Medicine, >Box 8501 >4444 Forest Park Boulevard, >St. Louis, MO 63108 > >mdautova at watson.wustl.edu >Tel. + 314-286-1118 >Fax. + 314-286-1810 > >http://nematode.net/ >************************************** From jison at hgmp.mrc.ac.uk Fri Nov 21 14:01:31 2003 From: jison at hgmp.mrc.ac.uk (Dr J.C. Ison) Date: Fri, 21 Nov 2003 14:01:31 +0000 Subject: [EMBOSS] Bioinformatics Software Development Course Message-ID: <3FBE1ABB.CC15EF08@hgmp.mrc.ac.uk> Hi Details on a forthcoming FREE programming course for bioinformatics using EMBOSS are below. Apologies for the spam if not interested. Cheers Jon Jon C. Ison, PhD Bioinformatics Applications Group UK MRC Human Genome Mapping Project Resource Centre Hinxton, Cambridge, CB10 1SB, UK E-mail : jison at hgmp.mrc.ac.uk BSDC 2004 Bioinformatics Software Development Course January 13-15, April 20-22, July 28-30, November 2-4 2004 Following from the highly successful BSDC 2003 courses, a new series of courses on 'Bioinformatics Software Development' using EMBOSS will be held in the training room at Hinxton Hall on January 13-15, April 20-22, July 28-30, November 2-4 2004 The course will give a good introduction to programming in EMBOSS. By the end of the course you will be experienced in all the steps in writing a basic bioinformatics application using the EMBOSS programming libraries. The course would suit competent programmers, probably with at least a couple of years of experience. A reasonable working knowledge of C is required, familiarity with pointers is helpful but not essential. The three dates are likely to get booked up very quickly so please email Karen Hampson (khampson at hgmp.mrc.ac.uk) to register as soon as possible. To read more about the course see http://www.hgmp.mrc.ac.uk/CCP11/CCP11courses/EMBOSS-Course/emboss_index.html To read more about EMBOSS see EMBOSS : http://www.hgmp.mrc.ac.uk/Software/EMBOSS/ From R-3-721447-18748808-2-9102-US2-3543AE22 at xmr3.com Fri Nov 21 15:26:12 2003 From: R-3-721447-18748808-2-9102-US2-3543AE22 at xmr3.com (International Scientific Communications, Inc.) Date: Fri, 21 Nov 2003 10:26:12 -0500 Subject: [EMBOSS] Laboratory Instrumentation News - November 2003 Message-ID: An HTML attachment was scrubbed... URL: From brettkaufman at videotron.ca Sat Nov 22 19:51:40 2003 From: brettkaufman at videotron.ca (Brett Kaufman) Date: Sat, 22 Nov 2003 14:51:40 -0500 Subject: [EMBOSS] Jemboss and emma Message-ID: <4A56B0DE-1D25-11D8-B9D7-000A95DA5C82@videotron.ca> I have been trying to get Jemboss to run emma. I find a number of issues that I haven't tracked down: 1) cannot open sequence files (.fasta). these same files can be read and emma executed via terminal. 2) can read pasted .fasta sequence, and the output of emma viewed in results, but no file can be saved. 3) as no file is "opened" by Jemboss, I cannot employ prettyplot to shade the alignment Other issues: 1) prettyplot cannot open a .msf file. Any .msf, even those generated by emma. I know that the input files are valid because they can be used in terminal, or embossRUNNER. I expect there to be a problem with my settings or Jemboss combile. I am including my jemboss.properties and runJemboss.csh files. Any insight would be greatly appreciated! -------------- next part -------------- A non-text attachment was scrubbed... Name: runJemboss.csh Type: application/octet-stream Size: 725 bytes Desc: not available URL: -------------- next part -------------- A non-text attachment was scrubbed... Name: jemboss.properties Type: application/octet-stream Size: 428 bytes Desc: not available URL: -------------- next part -------------- Thanks in advance, -Brett From c.a.nieduszynski at abdn.ac.uk Wed Nov 26 10:10:43 2003 From: c.a.nieduszynski at abdn.ac.uk (Conrad Nieduszynski) Date: Wed, 26 Nov 2003 10:10:43 +0000 Subject: [EMBOSS] EMBOSS on Mac OS X Message-ID: Hi, I'm trying to run EMBOSS through a Mac OS X terminal on a G4. So far I've used Fink to install EMBOSS. I'd also like to install MEME and BLAST. Any advice would be much appreciated, but some specific questions are: - What is the best way to install local versions of BLAST and MEME? - I'm trying to convert a fasta sequence file into a database file that can be used by EMBOSS (although I'd really like it to also be available to MEME and BLAST) using the command: % dbifasta -idfor simple -file myfile.fasta -dir . -dbname mydb -auto however I received the following error (multiple times): Warning: ajStrFixI called with length 4096 for string with size 4096 The new database appears to there (from showdb), but the sequences are now accessible to infoseq. Does this error message mean anything to anyone? Thanks, Conrad Dr Conrad Nieduszynski DNA replication lab, Institute of Medical Sciences, Aberdeen University Aberdeen Dr Conrad Nieduszynski Cancer Research UK Chromosome Replication Group, Division of Gene Regulation and Expression, School of Life Sciences, University of Dundee, MSI/WTB Complex, Dow Street Dundee DD1 5EH Scotland, U.K. From sebastian.bassi at ar.advantaseeds.com Thu Nov 27 03:08:55 2003 From: sebastian.bassi at ar.advantaseeds.com (Bassi, Sebastian) Date: Thu, 27 Nov 2003 04:08:55 +0100 Subject: [EMBOSS] Question about DeltaS and DeltaH Message-ID: Hello, I'm trying to reproduce the DeltaS and deltaH results from dan.c in Python (in order to add tm as a function in BioPython). But I found some differences in dan's DeltaS calculation and my own calculations. I tried to follow EMBOSS code (dan.c, ajdan.c, Edna.melt) but I am not an C expert (just a newbie) so I can't follow all the code. I will tell you what I'm doing, maybe somebody could point me out my mistake. To get DeltaS (entropy) I'm adding all the ocurrences of all neighbor pair secuences: Take this sequence: ACCCTTCAGCAGTTCCACAC Here are all neighbors and their DeltaS values: AC = 22.4 CC = 19.9 CT = 21 TT = 22.2 TC = 22.2 CA = 22.7 AG = 21 GC = 24.4 CA = 22.7 AG = 21 GT = 22.4 TT = 22.2 TC = 22.2 CC = 19.9 CA = 22.7 AC = 22.4 CA = 22.7 AC = 22.4 Grant total = 396.4 According to DAN, the result should be: 416.3 It seems there is something I'm missing. Could you please give me a hint about this? Sebastian Bassi. Advanta Seeds. Balcarce Research Station. From terry_lamb_sw at megatime.de Thu Nov 27 08:28:44 2003 From: terry_lamb_sw at megatime.de (Terry Lamb) Date: Thu, 27 Nov 2003 08:28:44 +0000 Subject: [EMBOSS] =?ISO-8859-1?b?RG8geW91cnNlbGYgYSBmYXZvciEgTG9vayBhdCB0aGlz?= Message-ID: -------------- next part -------------- An HTML attachment was scrubbed... URL: From tmargus at ebc.ee Thu Nov 27 14:12:51 2003 From: tmargus at ebc.ee (=?iso-8859-13?Q?T=F5nu?=) Date: Thu, 27 Nov 2003 16:12:51 +0200 Subject: [EMBOSS] diffseq -rformat seqtable dont report deletions correctly Message-ID: Hi, When to use the table output format (-rformat seqtable), diffseq did not report deletions in one of a sequences correctly. It depend on what order you give an input. If deletion is in a second sequence (diffseq first.fa second.fa), then table output is correct. If deletion is in a first sequence (diffseq second.fa first.fa), then deletion (marked with dot) is replaced with a letter and from the tabel you can see nucleotide replacement. I tried EMBOSS v. 2.6 (LINUX) and winemboss0.5 (v2.7)and both behave similarly. Is it bug or is it feature? If it is bug, how to fix it? To illustrate situation look output. Test sequences are listed too. I DELETION IN THE SECOND SEQ CORRECT diffseq first.fa second.fa -rformat seqtable -wordsize 3 #======================================= Start End start end length name sequence first_feature second_feature Sequence 23 23 23 23 1 second a . . g 71 71 70 69 . second . . . c 470 470 469 469 1 second g . . a #--------------------------------------- II DELETION IN THE FIRST SEQ. DEL IS NOT SEEN first.fa pos 70C is replaced in this table wit second.fa 69T Only thing that refers to deletion in the table is smaller end pos (69) than start pos (70). diffseq second.fa first.fa -rformat seqtable -wordsize 3 #======================================= Start End start end length name sequence first_feature second_feature Sequence 23 23 23 23 1 first g . . a 70 69 71 71 1 first c . . t 469 469 470 470 1 first a . . g #--------------------------------------- test seqs are here > first AY45 acaattgaatgtctgcacagccgctttccacacagacatcataacaaaaaatttccacca aaccccccctccccccgcttctggccacagcacttaaacacatctctgccaaaccccaaa aacaaagaaccctaacaccagcctaaccagatttcaaattttatcttttggcggtatgca cttttaacagtcaccccccaactaacacattattttcccctcccactcccatactactaa tctcatcaatacaacccccgcccatcctacccagcacacacacaccgctgctaaccccat accccgaaccaaccaaaccccaaagacaccccccacagtttatgtagcttacctcctcaa agcaatacactgaaaatgtttagacgggctcacatcaccccataaacaaataggtttggt cctagcctttctattagctcttagtaagattacacatgcaagcatccccattccagtgag ttcaccctctaaatcaccacgatcaaaagggacaagcatcaagcacgcagcaatgcagct caaaacgcttagcctagccac > second acaattgaat gtctgcacagccactttccacacagacatcataacaaaaaatttccacca aaccccccctcccccgcttctggccacagcacttaaacacatctctgcca aaccccaaaaacaaagaaccctaacaccagcctaaccagatttcaaattt tatcttttggcggtatgcacttttaacagtcaccccccaactaacacatt attttcccctcccactcccatactactaatctcatcaatacaacccccgc ccatcctacccagcacacacacaccgctgctaaccccataccccgaacca accaaaccccaaagacaccccccacagtttatgtagcttacctcctcaaa gcaatacactgaaaatgtttagacgggctcacatcaccccataaacaaat aggtttggtcctagcctttctattagctcttagtaagattacacatgcaa gcatccccgttccagtgagttcaccctctaaatcaccacgatcaaaaggg acaagcatcaagcacgcagcaatgcagctcaaaacgcttagcctagccac T?nu Margus Estonian Biocentre Riia 23 Tartu Estonia E-mail tmargus at ebc.ee From ILMILIONE at hgmp.mrc.ac.uk Thu Nov 27 19:15:54 2003 From: ILMILIONE at hgmp.mrc.ac.uk (ILMILIONE at hgmp.mrc.ac.uk) Date: 27 Nov 2003 20:15:54 +0100 Subject: [EMBOSS] immagina di avere un MILIONE di euro Message-ID: <20031127191600.0F88C7D232@mercury.hgmp.mrc.ac.uk> <<<<<<<>>>>>>> HAI MAI PROVATO A GIOCARE E VINCERE 1 MILIONE DI EURO ? CON INTERNET? Questo potrebbe anche sembrarti uno dei tanti scherzi che si ricevono via e-mail ma Ti chiedo soltanto un paio di minuti del tuo tempo prezioso e un invito a leggere questa lettera: e ti prometto che quando l? avrai terminata la tua vita sara` gia` cambiata !!! Bene, prima di continuare nel nostro viaggio verso la tua vincita e il tuo successo, salva su disco questa pagina per averla a portata di mano anche se il tuo PC non ? connesso a Internet, poi copia quanto segue in Word o in Blocco Note e stampalo, cos? lo potrai leggere con pi? attenzione e, visto che stai leggendo voglio anche dirti che il tuo indirizzo e-mail l?ho reperito in Rete in maniera casuale, e voglio anche che tu sappia che questa sar? l'unica lettera che riceverai da me e quindi valuta molto bene il suo contenuto e poi ... ? sempre desiderabile giocare insieme ad altri e VINCERE!!! Quante volte hai tentato la fortuna al Totocalcio ??? Totogol ??? Enalotto, lotterie?.???? Hai fatto fortuna ??? NO ??? E probabilmente il tutto ti e` costato una gran bella cifra !!! NO?!? E se questa volta grazie a questa lettera CHE STAI LEGGENDO LA DEA BENDATA ti stesse veramente bussando nella Cassetta Postale? PERCHE' PREOCCUPARSI ?FINALMENTE E' ARRIVATO IL TUO MOMENTO,... SI, QUELLO DI VINCERE DAVVERO AL 100%, perche` e` stato provato che nessuno puo` perdere, nessuno !!! Non si puo` perdere ma solo vincere... per il semplice motivo che ci sono migliaia di nuovi giocatori ogni giorno che vi vogliono partecipare, e aspettano che i fortunati che sono in possesso di questa e-mail (quale sei tu ad esempio), la spediscano anche a loro. In questa e-mail ti sveliamo il segreto di come ACCUMULARE UNA FORTUNA in sole 6 settimane, grazie ad un sistema infallibile. SEI UNO DEI PRIMI FORTUNATI ITALIANI A RICEVERE QUESTA CHE CON IL PASSARE DEI GIORNI DIVENTERA' UN E-MAIL FAMOSISSIMA, DELLA QUALE TUTTI PARLERANNO, GARANTITO !!! E' STATA FINALMENTE TRADOTTA ANCHE IN ITALIANO, PER IL TUO SUCCESSO !!! UN SISTEMA CHE SOSTITUISCE COMPLETAMENTE TOTOCALCIO, TOTOGOL, LOTTO, ENALOTTO E BINGO VARI !!! BASTA GIOCARE E SPRECARE SOLDI INUTILMENTE !!! COMINCIA A VINCERE UNA VOLTA PER TUTTE 500.000? - 1 MILIONE ? IN 6 SETTIMANE !!! HAI MAI IMMAGINATO DI POTER ordinare la nuova, fiammante macchina che ti meriti, o recarti alla banca e pagare una volta per tutte quel mutuo sulla casa o appartamento !!! Oppure prenderti un paio di mesi di vacanza a sciare in Montagna o in Crociera in uno di quei posti esotici dei quali hai sempre sognato, e poi ritornare a casa e decidire cosa fare con piu` di un MILIONE DI ? ancora a disposizione !!! Potrebbe anche sembrarti uno scherzo ma potrebbe se segui il giocho diventare realt?!!! Sono d'accordo che i sogni possono aiutarti a vivere meglio ma non bastano. Questa e` PURA REALTA`, e succedera` anche a te nelle prossime 6 settimane, grazie all?incredibile sistema de ?ILMILIONE? !!! 6 SOLE SETTIMANE: questo e` quanto ci vuole per accumulare un minimo di 500.000? EURO, PARI A UN MILIARDO DI VECCHIE LIRE ITALIANE, ED ENTRARE NEL CLUB DEI NUOVI MILIARDARI DEL QUALE NE HANNO PARLATO ALL'ESTERO ULTIMAMENTE IN TV !!! Questa e` la testimonianza di Marco Fantini, l?Italiano che ha deciso di tradurre questa famosa e-mail oggi in circolazione: "Chi ti scrive e` un italiano, Marco Fantini, nato e cresciuto a Viareggio, una cittadina alle porte della Toscana, nel Centro Italia. Mi sono sposato e trasferito negli Stati Uniti nel 1993, dopo un corso estivo al Campus dell? Universita` del nord Colorado, e tuttora vivo con mia moglie e i miei due figli in una bellissima cittadina chiamata Fort Collins, sempre nel nord Colorado. La ragione per cui ti scrivo e` perche` ormai da 5 mesi la mia vita e quella della mia famiglia e` totalmente cambiata. Perche` ??? Ho vinto la bellezza di $712.455 dollari, equivalenti a 1.426.862.000 lire italiane, senza fare assolutamente nulla !!! Quello che e` successo a me succedera` a tutti quelli che decideranno di partecipare all? ormai famoso "?ILMILIONE?": E` GARANTITO !!! Perche` e` l?unico sistema al mondo col quale si puo` solo vincere. La sua testimonianza continua: "Questo sistema ? tutto meno ch? una piramide o il classico multilevel perch? qui il sistema ? orizzontale, sei tu il vertice e sei tu la piramide e se gli altri quattro che sono con te nella lista, fanno la loro parte il flusso si moltiplica esponenzialmente. Se hai dimestichezza con Internet e col pc hai maggior possibilit? di espandere e far fruttare i tuoi indirizzi facendo partecipare altri giocatori insieme a te al generatore di benessere e in ogni caso la Bont? del sistema ? nei Report che ne sono la parte essenziale per il tuo SUCCESSO!!! Grazie ad Internet e ad un programma imbattibile che ha gi? colto l?attenzione di alcune reti televisive straniere (oltre ai migliaia di servizi dedicati dalle televisioni americane) sveliamo il segreto di come e` possibile continuare a vincere la somma di 1 MILIONE DI EURO OGNI 6 settimane (UN MINIMO DI 13 MILIARDI ALL? ANNOdi Vecchie Lire !!!). Ecco come funziona. I partecipanti provengono da tutto il mondo, Australia, Canada, Inghilterra, Germania, Nuova Zelanda (paesi che in genere sono di madrelingua inglese, o lo parlano come seconda lingua), ma il 92% di essi sono agguerriti americani, entusiasmati dai telegiornali degli USA che cercano di dare una spiegazione a questa incredibile ondata di nuovi miliardari, che solo nel secondo semestre del 2001 ha contato piu` di 928.000 fortunati soltanto negli USA. La ragione di questo successo ? semplice: con il solo investimento di ? 25 euro si entra in un giro mondiale, INVIANDO E-MAIL GRATUITAMENTE E SENZA FARE SPAMMING (come definito nel report 3) a tutti quelli che vogliono partecipare e che sono in trepida attesa di farlo. Si, perch? la chiave ? proprio ricevere questa e-mail (che e` stata finalmente tradotta da un gentile italiano residente negli USA per il beneficio di tutti i giocatori italiani). Se non si riceve la e-mail non si accede al sistema e si ? tagliati fuori. Sei probabilmente uno dei primi italiani a ricevere questa e-mail, visto che e` stata tradotta soltanto un 3 settimane fa. Ci sono milioni di persone in tutta Italia e in tutto il mondo che sono ansiosi di ricevere questa e-mail da te. Una volta che inserisci il tuo nome, indirizzo e indirizzo e-mail e` fatta, sei nel sistema e ci resterai fino a quando deciderai che ne hai abbastanza di tutti quei soldi !!! I partecipanti al giorno d?oggi sono stimati attorno ai 25 milioni, e crescono di giorno in giorno. Poiche` bisogna aspettare il proprio turno prima di rientrare in un nuovo giro (dalla 5 alla 1 posizione) chi esce (con un guadagno stimato in media fra i 500 mila euro e 1 milione di euro) rientra di nuovo rispondendo ad un?altra e-mail che ha ricevuto nel frattempo. Il risultato: un sistema che non ha mai fine, tenuto in piedi dai soliti giocatori e in piu` da tutti quelli che si uniscono ogni giorno, incrementando il massiccio scambio di denaro. Un giro di centinaia di miliardi al giorno, spediti in piccole banconote da 5 euro ciascuna. Un programma che, GRAZIE AD INTERNET, non ha mai fine, poiche` i partecipanti entrano ed escono continuamente (non contando i nuovi partecipanti che si uniscono ogni giorno) investendo ogni volta la piccola somma di 25 euro, e intascando i miliardi spettanti ad ogni giro !!! Ovviamente si pu? uscire quando si vuole, non c?? nessun obbligo, ma perch? uscire quando si ? parte di un club di miliardari ??? Gli USA stimano che almeno 927.900 di quei 928.000 nuovi miliardari sono gi? rientrati, centuplicando il numero di miliardari nei prossimi 6 mesi !!! La differenza fra i vecchi sistemi multi livello e questo e` molto semplice: 1: l? investimento ? decisamente minimo, chiunque pu? permetterselo, giovane o vecchio, studente o impiegato, disoccupato o meno. Per iniziare si pu? anche partecipare in gruppi, se si vuole. 2: nessuna perdita di tempo nel convincere qualcuno a partecipare, poiche` grazie ai programmi dispedizione e raccolta delle email in modo anonimo completamente automatici ti permettono di arrivare all'attenzione di milioni di italiani pronti a giocare, e aspettano di ricevere questa e-mail da te. 3: la vincita ? rapida: 6 sole settimane per una somma minima che si aggira fra i 500.000 e 1 MILIONE di Euro ? !!! Un record, nessun altro sistema ? mai stato tanto veloce quanto ?IL MILIONE? !!! 4: non c?e` nessuna organizzazione dietro questo semplice ma efficace sistema. I soli giocatori tengono in piedi l?intero sistema (da loro "battezzato" ?ILMILIONE? ), che funziona alla perfezione da 2 anni a questa parte. Non c?? nessuna percentuale da pagare. I soldi vengono scambiati e spediti direttamente alle case dei singoli giocatori. Tutti gli altri sistemi esistenti hanno una sede fissa e si appropriano di una grossa percentuale dei soldi investiti, li maneggiano e poi decidono chi deve vincere, per cui nessuna vincita puo` essere assicurata. 5: ?IL MILIONE? ? l?unico sistema esistente al mondo che ti permette una vincita multipla: si vince ogni 6 settimane, fino a quando si decide di ritirarsi, perch? se ne ha abbastanza di tutto quel denaro. 6: L? opportunit? di ricevere informazioni gratis per incrementare e gestire le proprie vincite. Se decidete di partecipare, riceverete i 5 "reports" dai membri della vostra lista, che contengono informazioni utilissime, come scaricare GRATIS da Internet software elaborati e costosi (valore di mercato di 1000 EURO, completamente GRATIS !!!) PER GESTIRE, SCARICARE E SPEDIRE IN MODO ANONIMO E-MAIL a piu` di 10.000.000 di indirizzi (Avalanche, NetTron, DirectMail, ecc.), pi? tante altre utilissime informazioni sul come incrementare le vincite con il sistema, completamente GRATIS !!! Questo e` il segreto di ?IL MILIONE? , la vincita e` 100% assicurata !!! Tutto diventa possibile, si pu? solamente vincere!!! Chi si inserisce ha la certezza matematica di ricevere ALMENO 1 MILIONE DI EURO nel giro di 6 settimane, perche` ricevera` i soldi da coloro che hanno gia` vinto e desiderano rientrare e raddoppiare, triplicare, ecc. la loro vincita (CONTANDO anche sull'espansione del sistema e SULL?INGRESSO DI MIGLIAIA DI NUOVI PARTECIPANTI OGNI GIORNO). Un conduttore di una trasmissione Americana ha commentato cosi`: "Seriamente, non ho mai visto niente del genere sino ad oggi !!!". ?ILMILIONE? e` stato definito "IL GENERATORE DI BENESSERE DEL XXI SECOLO !!!". E tu ??? Sei pronto ad unirti al club di miliardari ??? Il principio ? quasi simile a quello utopico del "se ognuno dei 5 miliardi di persone oggi esistente sulla terra spedisse 1 EURO a te che stai leggendo, A TURNO la ricchezza si sposterebbe in continuazione e vivremmo tutti chi prima e chi dopo in un mondo di milionari". Il fatto e` che non si pu? costringere qualcuno a versare dei soldi ad un altro individuo. Ecco che il concetto di ?ILMILIONE? entra in gioco: ci vuole un club di giocatori intenzionati a scambiarsi ogni 6 settimane 5 EURO a testa, collezionando 1 MILONE DI EURO A TURNO. Questo e` il semplice segreto di un sistema che non ha eguali in tutto il mondo. ?ILMILIONE? e` un club di oneste persone comuni COME TE che hanno tutto l?interesse di tenere in piedi un sistema che genera benessere per tutti. I soldi contenuti nelle lettere vengono spediti direttamente alle case dei partecipanti, e non raccolti da "?anonimi enti" come in altri sistemi. Come su questa e-mail, che sara` la tua lista se decidi di partecipare, ci sono i nominativi di 5 persone comuni come te, provenienti da tutto il mondo. LE SEGUENTI SONO ISTRUZIONI FONDAMENTALI DI CUI HAI BISOGNO: POICH? IL CONTENUTO DI QUESTA E-MAIL ? TROPPO PREZIOSO, STAMPA UNA COPIA DI QUESTA E- MAIL ADESSO E SALVALA SU UN CD O FLOPPY DISK, NEL QUALCASO TU ABBIA PROBLEMI CON IL TUO COMPUTER. ===== COME ORDINARE I 5 "REPORTS" DALLA LISTA CHE SEGUE ===== Che cos?e` un "report" ??? Un report non e` altro che una serie di informazioni utilissime su come scaricare assolutamente gratis costosi software dall? Internet (che potranno risultare di grande aiuto nella gestione e spedizione ad alta velocita` di e-mail) gestire patrimoni senza pagare tasse, ecc., accuratamente tradotti in italiano. Per ogni report spedisci 5 euro che puoi trovare al piu` vicino ufficio postale o alla tua banca. Ci sono stati giocatori che, per ragioni sconosciute, hanno spedito i 5 euro nella valuta del loro paese. Poiche` il dollaro americano e` stato scelto e adottato sin dall?inizio del sistema, ed ha funzionato alla perfezione per ormai 2 anni, non possiamo garantire il fatto che, se spedirai banconote in diverse valute, saranno accettate. I giocatori del sistema, specialmente stranieri, che si aspettano di ricevere euro o dollari, non accetteranno altre valute, perche` non conoscono il cambio corrente, e probabilmente rispediranno indietro le tue lettere. Per qualsiasi ragione, non spedire MAI moneta, solo banconote, altrimenti dovrai pagare una tariffa postale maggiore, dovuta al peso. PER EVITARE che i soldi spediti vengano intercettati e rubati, da un p? di tempo a questa parte, si e` adottato il sistema di "incartare" la banconota in due fogli di carta formato A4, piegati in tre, come si piegherebbe una semplice lettera da infilare in una busta normale da lettera. Su uno dei due fogli, scrivi in stampatello (meglio se stampato al computer) a caratteri chiari e leggibili, il nome e il numero del report che stai ordinando, il tuo indirizzo e-mail, e il tuo nome e indirizzo postale. Quindi: per ogni report spedisci una banconota del valore di 5 dollari incartata fra 2 fogli di carta formato A4, il nome e numero di report richiesto, il tuo indirizzo e-mail, il tuo nome e indirizzo postale. Se non vuoi far apparire il tuo nome e indirizzo sulla lista (anonimato), puoi usare una casella postale come indirizzo, e il nome di una compagnia al posto del tuo nome e cognome (ad esempio: XYZ Servizi, Casella Postale 12345, Roma, Italy). Ricorda di scrivere il tuo indirizzo (mittente) sulla busta, nel caso in cui ci siano difficolta` postali. Quando ordini i report, devi ordinare tutti i 5 report, perch? hai bisogno di "spedirli" tramite e-mail alle persone che li richiederanno da te, dandoti 5 euro per ognuno di essi (anche se sono gia` in possesso di essi, nel caso di giocatori che rientrano, ma il sistema richiede la consegna di 5 euro in cambio dei report). Quando ricevi i 5 report in 5 differenti e- mail, salva ogni report su un floppy disk o CD, affinch? niente vada perso. Se li perdi, non puoi continuare nel sistema, poiche` non hai niente da "dare" agli altri giocatori. Il costo totale del tuo investimento e`: 5 x 5 EURO = 25 EURO, una sciocchezza paragonata a quello che riceverai !!! Nel giro di pochi giorni riceverai, come detto, le 5 e-mail con i 5 differenti report in italiano. Mentre aspetti per I 5 report ( numero 1, 2, 3, 4 e 5), prendi questa e-mail, che hai precedentemente salvato nel tuo computer, e fai quanto segue: 1. rimuovi il nome e l?indirizzo della persona accanto al report numero 5. Questa persona ha finito il suo turno e stara` contando il suo ?MILIONE?; 2. rimuovi il nome e l?indirizzo della persona accanto al report numero 4 e spostala (con copia/taglia e incolla) al numero 5; 3. rimuovi il nome e l?indirizzo della persona accanto al report numero 3 e spostala (con copia/taglia e incolla) al numero 4; 4. rimuovi il nome e l?indirizzo della persona accanto al report numero 2 e spostala (con copia/taglia e incolla) al numero 3; 5. rimuovi il nome e l?indirizzo della persona accanto al report numero 1 e spostala (con copia/taglia e incolla) al numero 2; 6. inserisci il tuo nome e indirizzo accanto al report numero 1. Fatto, ora sei ufficialmente nel sistema. Fai attenzione nel ricopiare tutti gli indirizzi: controlla sempre che tutti i nomi e gli indirizzi siano scritti in maniera corretta (specialmente nel caso di giocatori stranieri). Dopo cio`, salva la nuova e-mail nel tuo computer, e fai anche una copia e salvala su un floppy disk o CD. NON FARE ASSOLUTAMENTE ALTRE MODIFICHE. Il prossimo passo e` quello di spedire le e-mail a tutte le persone che le stanno ansiosamente aspettando. E' tutto molto semplice, quindi evita di preoccuparti di spiegare il sistema ad amici e conoscenti. Quello che devi fare e` spedire questa e-mail, cominciando dalla lista di amici presente nel tuo Microsoft Outlook Express, o software simile, dove tieni la lista di indirizzi e-mail dei tuoi amici. Tu puoi spedire quante e-mail vuoi: il minimo e` 5. 1: Ok, vediamo come funziona. Supponiamo che spedisci 20 e-mail a 20 persone. Pur essendo tutti in attesa di questa e-mail, soltanto 10 di loro trovano il tempo di ordinare il report numero 1 da te. 2: Quelle 10 persone spediscono a loro volta 20 e-mail a testa, per un totale di 200 e-mail. Di nuovo, pur essendo tutti in attesa di ricevere questa e-mail ed intascare i loro miliardi, soltanto la meta` di loro, 100 persone, ha il tempo di ordinare il report numero 2. 3: Quelle 100 persone spediscono a loro volta 20 e-mail a testa, per un totale di 2000 e-mail. Stessa storia, solo 1000 di loro trova il tempo di ordinare il report numero 3. 4: Quelle 1000 persone spediscono 20 e-mail ciascuno, per un totale di 20.000 e-mail. Solo 10.000 di loro ordina il report numero 4. 5: Quelle 10.000 persone spediscono 20 e-mail a testa, per un totale di 200.000 e-mail. Solo la meta` di loro ordina il report numero 5. Ora, un po? di matematica. Il totale della vincita in questo caso, dove non si ha il pieno potenziale di giocatori, poiche` si presume che soltanto la meta` della meta` della meta`, ecc. Partecipi, e` il seguente: Per il report numero 1: 10 richieste = 10 x 5 euro = 50 euro = 100.000 vecchie lire Per il report numero 2: 100 richieste = 100 x 5 euro = 500 euro = 1.000.000 vecchie lire Per il report numero 3: 1.000 richieste = 1.000 x 5 euro = 5.000 euro = 10.000.000 vecchie lire Per il report numero 4: 10.000 richieste = 10.000 x 5 euro = 50.000 euro = 100.000.000 vecchie lire Per il report numero 5: 100.000 richieste = 100.000 x 5 euro = 500.000 euro = 1.000.000.000 vecchie lire Totale: 50 + 500 + 5.000 + 50.000 + 500.000 = 555.550 euro pari a 1.111.100.000 vecchie di lire !!!! Questo ? il minimo che ognuno vincer? poich? ? stato ormai sperimentato e testato negli anni scorsi: ma se ognuno spedisce piu` di 20 e-mail, e cosi` gli altri partecipanti, la vincita avr? proporzioni stratosferiche che nemmeno potete immaginarvi, ma e` possibile allo stesso tempo, senza dubbio, succede tuttora E SPESSO di avere vincite da 12 zeri !!! Questo dipende da te, se hai il tempo e la voglia di spedire e-mail a persone che conosci (con i programmi dei report), o se trovi indirizzi e-mail su vari siti web gratuiti: non farai altro che incrementare il valore della tua vincita. Quando parliamo di una vincita di ?ILMILIONE? ogni 6 settimane, ci riferiamo ad una vincita media (dati forniti dalle varie trasmissioni televisive che hanno fatto ricerche fra I numerosi partecipanti e redatto delle statistiche) fra tutti I giocatori partecipanti. La media di e-mail spedite e` di 5.4 a persona. Ecco perch? possiamo parlare di una vincita "facile", poche` l?unica cosa da fare e` aprire la propria agenda di indirizzi e-mail di amici e conoscenti, e spedire la e-mail con il prorio nome vicino al report numero 1. Se ci pensate, ? proprio un gioco da ragazzi !!! Ma se volete ambire ad una vincita incredibile (ACCUMULARE UNA FORTUNA CHE SUPERA IL MILIONE) avete la possibilit? di farlo, E dipende tutto da voi. Vi sono giocatori nel sistema che arrivano a spedire anche 1 milione di e-mail nel giro di un paio di settimane in modo anonimo e senza fare spamming: vi lascio pensare qual?e` l?entita` della loro vincita !!!! Ti auguriamo un in bocca al lupo e buon divertimento come nuovo Milionario !!! ========== LA TUA LISTA DEI REPORT IN ITALIANO ========== ORDINA UNA COPIA PER OGNI REPORT: REPORT NUMERO 1 : "Advanced Email Searcher 1.1. Free" Ordina il report numero 1 da: Paola GANDIN Via XXIV Maggio, 25 34074 Monfalcone - Italy ______________________________________________________________________ REPORT NUMERO 2 : "LIBERO SCAMBIO DELLE RISORSE E LIBERA ESPRESSIONE, COME ESPANDERE I TUOI CONTATTI IN LIBERTA' " Ordina il report numero 2 da Marilisa MORASSI Via Salvo D'Acquisto, 7/4 34079 Staranzano - Italy ___________________________________________________________________________ ________________________ REPORT NUMERO 3 : ?COME INVIARE E-MAIL LIBERAMENTE E VIVERE FELICI senza Spam di Tomhak? Ordina il report numero 3 da: Vinicio DE BORTOLI Via F.lli Fontanot, 18 34074 Monfalcone - Italy ___________________________________________________________________________ __________________ REPORT NUMERO 4 : "Faq, PERCHE' ?ILMILIONE? funziona rimanendo un sistema Libero dalle lobby" Ordina il report numero 4 da: Associazione BASILICO c/o Zappal? Marilia v.dell'Angnolo 64 50122 - Firenze - Italy _____________________________________________________________ REPORT NUMERO 5 : ?Istruzioni Advanced Email Searcher 1.1 Free? Ordina il report numero 5 da: Anna GREGORUTTI c/o PACHAMAMA Via della Liberazione, 10 18035 Dolce Acqua - Italy _____________________________________________________________________ BUONA FORTUNA E RACCOGLI IL TUO ?ILMILIONE?! <<<<<<>>>>>> "L'amore rappresenta un ponte di energia tra lo spirito di due singoli. Non appena ? presente un tipo di amore incondizionato, e si accettano tutti gli altri della formazione come una parte necessaria del tutto, la Grande Ala non rappresenter? nessuno sforzo per te. Ma se proverai anche una piccola forma di risentimento verso un altro o verso te stesso, ti verr? a mancare lo Spirito di Stormo e vacillerai. I tuoi pensieri pi? profondi li sperimenterai come venti di vita mentre starai volando. Cerca sempre di pensare alla Grande Ala e ama ogni essere per la parte che svolge e troverai che il vento ti sollever? con una facilit? che ti lascer? attonito." Louis A. Tartaglia, "La grande Ala" -------------- next part -------------- An HTML attachment was scrubbed... URL: From sebastian.bassi at ar.advantaseeds.com Thu Nov 27 20:00:44 2003 From: sebastian.bassi at ar.advantaseeds.com (Bassi, Sebastian) Date: Thu, 27 Nov 2003 21:00:44 +0100 Subject: [EMBOSS] Question about DeltaS and DeltaH Message-ID: Hello Guy Bottu, Thank you very much! Now I traced the problem back to the code, and the problem was that the function I used (string.count) counts "non-overlapping" ocurrences. I will search for a replace of this function or maybe I will have to write my own. Thank you again! UPDATE: Thank to another member of the BioPython list, I finish this. He did the string count with overlapping support and I did the rest. Sebastian Bassi. Advanta Seeds. Balcarce Research Station. > -----Original Message----- > From: Guy Bottu [mailto:gbottu at ben.vub.ac.be] > Sent: Thursday, November 27, 2003 8:37 AM > To: Bassi, Sebastian > Subject: Re: [EMBOSS] Question about DeltaS and DeltaH > > > from : Belgian EMBnet Node > > Dear Sebastian, > > The reason is simply that you forgot a CC pair. > > Don't worry, it happens to all of us. I will never forget the > day when I > sent a bug report to Prof. Felsenstein, complaining that the PHYLIP > package did not run properly on my computer, while I had used a wrong > input file format... > > Regards, > Guy Bottu > > > > > Take this sequence: ACCCTTCAGCAGTTCCACAC > > > > Here are all neighbors and their DeltaS values: > > > > AC = 22.4 > > CC = 19.9 > CC = 19.9 > > CT = 21 > > TT = 22.2 > > TC = 22.2 > > CA = 22.7 > > AG = 21 > > GC = 24.4 > > CA = 22.7 > > AG = 21 > > GT = 22.4 > > TT = 22.2 > > TC = 22.2 > > CC = 19.9 > > CA = 22.7 > > AC = 22.4 > > CA = 22.7 > > AC = 22.4 > > Grant total = 396.4 > 416.3 > From simonstockes at yahoo.fr Sat Nov 29 14:29:12 2003 From: simonstockes at yahoo.fr (simon stockes) Date: Sat, 29 Nov 2003 15:29:12 +0100 Subject: [EMBOSS] Impossible t ofetch a sequence from srs internet site with "seqret" command Message-ID: <671411EC-2278-11D8-A28B-000393AF484C@yahoo.fr> Hi All, I'm trying to fetch a sequence from srs site with "seqret" command and got an error. This error was obtain from "seqret -debug qasrswww:HSCAD5 HSCAD5.fasta" commande line and the emboss.default part corresponding is : DB qasrswww [ type: "N" format: "embl" methodquery: "srswww" dbalias: "EMBL" fields: "sv des org key" url: "http://www.infobiogen.fr/srs71bin/cgi-bin/wgetz" comment: "Remote SRS web server" ] Config Mac OS 10.2.8, G3 ibook, /usr/local installation (with fink installation I got the same error). I suspect there is no proxy between me and the srs server. The seqret.dbg file (see below) says : it get the sequence file but there is a problem after .... Hope tracks, Simon. seqret.dbg ========= Debug file seqret.dbg buffered:No ajFileNewIn '/usr/local/emboss/share/EMBOSS/acd/seqret.acd' EOF ajFileGetsL file /usr/local/emboss/share/EMBOSS/acd/seqret.acd closing file '/usr/local/emboss/share/EMBOSS/acd/seqret.acd' ajFeatTabInNew 1b1320 ajSeqinClear called ajFeattabInClear called ++seqUsaProcess 'qasrswww:HSCAD5' 0..0(N) '' 0 USA to test: 'qasrswww:HSCAD5' format regexp: No list:No no format specified in USA ...input format not set dbname dbexp: Yes found dbname 'qasrswww' level: '' qry->QryString: 'HSCAD5' seqQueryFieldC usa 'sv' fields 'sv des org key' seqQueryField test 'sv' seqQueryField match 'sv' ajSeqQueryWild id 'HSCAD5' acc 'HSCAD5' sv 'HSCAD5' des '' org '' key '' wild (has) query Sv 'HSCAD5' database type: 'N' format 'embl' use access method 'srswww' Matched seqAccess[3] 'srswww' seqAccessSrswww EMBL:HSCAD5 seqHttpUrl http://www.infobiogen.fr/srs71bin/cgi-bin/wgetz searching with SRS url 'GET /srs71bin/cgi-bin/wgetz?-e+-ascii+[EMBL-id:HSCAD5]|[EMBL-acc:HSCAD5]' httpver getValueC '' httpver after qry '' host 'www.infobiogen.fr' port 80 get 'GET /srs71bin/cgi-bin/wgetz?-e+-ascii+[EMBL-id:HSCAD5]|[EMBL-acc:HSCAD5] HTTP/1.0 ' gethostbyname host 'www.infobiogen.fr' returns 'babbage.infobiogen.fr' errno 0 hp_addr 193.52.226.5 creating socket setup socket data connecting to socket 4 sin sizeof 16 connect status 0 errno 0 msg 'Successful system call (0 - Undefined error: 0)' inet_ntoa '193.52.226.5' sending: 'GET /srs71bin/cgi-bin/wgetz?-e+-ascii+[EMBL-id:HSCAD5]|[EMBL-acc:HSCAD5] HTTP/1.0 ' status: 82 send for GET errno 0 msg 'Successful system call (0 - Undefined error: 0)' sending: 'Host: www.infobiogen.fr:80 ' status: 27 send for host errno 0 msg 'Successful system call (0 - Undefined error: 0)' sending: ' ' status: 1 send for blankline errno 0 msg 'Successful system call (0 - Undefined error: 0)' fdopen errno 0 msg 'Successful system call (0 - Undefined error: 0)' EOF ajFileGetsL file End of file - data in buffer - return ajFalse First line [1] 'HTTP/1.1 200 OK ' fileBuffLineDel removing line [1], 'HTTP/1.1 200 OK ' len 16 first line gone, new start [1] 1b5e60, ' ' len 1 [1] fileBuffLineDel removing line [1], ' ' len 1 first line gone, new start [1] 1b5dd0, 'Date: Sat, 29 Nov 2003 09:46:49 GMT ' len 36 :[1] Date: Sat, 29 Nov 2003 09:46:49 GMT [1] fileBuffLineDel removing line [1], ' ' len 1 new next line [1] 1b5ea0, 'Server: Apache/1.3.27 (Unix) mod_perl/1.27 PHP/4.3.1 ' len 53 :[1] Server: Apache/1.3.27 (Unix) mod_perl/1.27 PHP/4.3.1 [1] fileBuffLineDel removing line [1], ' ' len 1 new next line [1] 1b6010, 'Connection: close ' len 18 :[1] Connection: close [1] fileBuffLineDel removing line [1], ' ' len 1 new next line [1] 1b60a0, 'Content-Type: text/plain ' len 25 :[1] Content-Type: text/plain [1] fileBuffLineDel removing line [1], ' ' len 1 new next line [1] 1b6130, ' ' len 1 [1] fileBuffLineDel removing line [1], ' ' len 1 new next line [1] 1b6170, ' ' len 1 [1] fileBuffLineDel removing line [1], ' ' len 1 new next line [1] 1b61b0, 'ID HSCAD5 standard; mRNA; HUM; 3170 BP. ' len 46 :[1] ID HSCAD5 standard; mRNA; HUM; 3170 BP. :[1] XX :[1] AC X59796; :[1] XX :[1] SV X59796.1 :[1] XX :[1] DT 12-FEB-1992 (Rel. 30, Created) :[1] DT 24-JAN-1995 (Rel. 42, Last updated, Version 6) :[1] XX :[1] DE H.sapiens mRNA for cadherin-5 :[1] XX :[1] KW cadherin. :[1] XX :[1] OS Homo sapiens (human) :[1] OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; :[1] OC Eutheria; Primates; Catarrhini; Hominidae; Homo. :[1] XX :[1] RN [1] :[1] RP 1-3169 :[1] RA Suzuki S.; :[1] RT ; :[1] RL Submitted (16-MAY-1991) to the EMBL/GenBank/DDBJ databases. :[1] RL S. Suzuki, Doheny Eye Institute, 1355 San Pablo St, Los Angeles, CA 90033, :[1] RL USA :[1] XX :[1] RN [2] :[1] RP 1-3169 :[1] RX MEDLINE; 91283540. :[1] RX PUBMED; 2059658. :[1] RA Suzuki S., Sano K., Tanihara H.; :[1] RT "Diversity of the cadherin family: evidence for eight new cadherins in :[1] RT nervous tissue"; :[1] RL Cell Regul. 2(4):261-270(1991). :[1] XX :[1] RN [3] :[1] RP 1-3170 :[1] RA Suzuki S.; :[1] RT ; :[1] RL Submitted (24-JAN-1995) to the EMBL/GenBank/DDBJ databases. :[1] RL S. Suzuki, Doheny Eye Institute, 1355 San Pablo St, Los Angeles, CA 90033, :[1] RL USA :[1] XX :[1] DR GOA; P33151. :[1] DR SWISS-PROT; P33151; CAD5_HUMAN. :[1] XX :[1] FH Key Location/Qualifiers :[1] FH :[1] FT source 1..3170 :[1] FT /db_xref="taxon:9606" :[1] FT /mol_type="mRNA" :[1] FT /organism="Homo sapiens" :[1] FT /dev_stage="fetus, 15-20 weeks" :[1] FT /tissue_type="brain" :[1] FT CDS 104..2446 :[1] FT /db_xref="GOA:P33151" :[1] FT /db_xref="SWISS-PROT:P33151" :[1] FT /product="cadherin-5" :[1] FT /protein_id="CAA42468.1" :[1] FT /translation="MMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDW :[1] FT IWNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERL :[1] FT DRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVG :[1] FT TSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIV :[1] FT VEARDAQGLRGDSGTATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDP :[1] FT DEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTI :[1] FT DLRYMSPPAGNRAQVIINITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARH :[1] FT SIGYSIRRTSDKGQFFRVTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESI :[1] FT VQVHIEVLDENDNAPEFAKPYQPKVCENAVHGQLVLQISAIDKDITPRNVKFKFILNTE :[1] FT NNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNE :[1] FT QGEFTFCEDMAAQVGVSIQAVVAILLCILTITVITLLIFLRRRLRKQARAHGKSVPEIH :[1] FT EQLVTYDEEGGGEMDTTSYDVSVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGA :[1] FT HGGPGEMAAMIEVKKDEADHDGDGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDY :[1] FT DFLNDWGPRFKMLAELYGSDPREELLY" :[1] XX :[1] SQ Sequence 3170 BP; 773 A; 962 C; 844 G; 588 T; 3 other; :[1] ctccactcac gctcagccct ggacggacag gcagtccaac ggaacagaaa catccctcag 60 :[1] cccacaggca cgatctgttc ctcctgggaa gatgcagagg ctcatgatgc tcctcgccac 120 :[1] atcgggcgcc tgcctgggcc tgctggcagt ggcagcagtg gcagcagcag gtgctaaccc 180 :[1] tgcccaacgg gacacccaca gcctgctgcc cacccaccgg cgccaaaaga gagattggat 240 :[1] ttggaaccag atgcacattg atgaagagaa aaacacctca cttccccatc atgtaggcaa 300 :[1] gatcaagtca agcgtgagtc gcaagaatgc caagtacctg ctcaaaggag aatatgtggg 360 :[1] caaggtcttc cgggtcgatg cagagacagg agacgtgttc gccattgaga ggctggaccg 420 :[1] ggagaatatc tcagagtacc acctcactgc tgtcattgtg gacaaggaca ctggcgaaaa 480 :[1] cctggagact ccttccagct tcaccatcaa agttcatgac gtgaacgaca actggcctgt 540 :[1] gttcacgcat cggttgttca atgcgtccgt gcctgagtcg tcggctgtgg ggacctcagt 600 :[1] catctctgtg acagcagtgg atgcagacga ccccactgtg ggagaccacg cctctgtcat 660 :[1] gtaccaaatc ctgaagggga aagagtattt tgccatcgat aattctggac gtattatcac 720 :[1] aataacgaaa agcttggacc gagagaagca ggccaggtat gagatcgtgg tggaagcgcg 780 :[1] agatgcccag ggcctccggg gggactcggg cacggccacc gtgctggtca ctctgcaaga 840 :[1] catcaatgac aacttcccct tcttcaccca gaccaagtac acatttgtcg tgcctgaaga 900 :[1] cacccgtgtg ggcacctctg tgggctctct gtttgttgag gacccagatg agccccagaa 960 :[1] ccggatgacc aagtacagca tcttgcgggg cgactaccag gacgctttca ccattgagac 1020 :[1] aaaccccgcc cacaacgagg gcatcatcaa gcccatgaag cctctggatt atgaatacat 1080 :[1] ccagcaatac agcttcatag tcgaggccac agaccccacc atcgacctcc gatacatgag 1140 :[1] ccctcccgcg ggaaacagag cccaggtcat tatcaacatc acagatgtgg acgagccccc 1200 :[1] cattttccag cagcctttct accacttcca gctgaaggaa aaccagaaga agcctctgat 1260 :[1] tggcacagtg ctggccatgg accctgatgc ggctaggcat agcattggat actccatccg 1320 :[1] caggaccagt gacaagggcc agttcttccg agtcacaaaa aagggggaca tttacaatga 1380 :[1] gaaagaactg gacagagaag tctacccctg gtataacctg actgtggagg ccaaagaact 1440 :[1] ggattccact ggaaccccca caggaaaaga atccattgtg caagtccaca ttgaagtttt 1500 :[1] ggatgagaat gacaatgccc cggagtttgc caagccctac cagcccaaag tgtgtgagaa 1560 :[1] cgctgtccat ggccagctgg tcctgcagat ctccgcaata gacaaggaca taacaccacg 1620 :[1] aaacgtgaag ttcaaattca tcttgaatac tgagaacaac tttaccctca cggataatca 1680 :[1] cgataacacg gccaacatca cagtcaagta tgggcagttt gaccgggagc ataccaaggt 1740 :[1] ccacttccta cccgtggtca tctcagacaa tgggatgcca agtcgcacgg gcaccagcac 1800 :[1] gctgaccgtg gccgtgtgca agtgcaacga gcagggcgag ttcaccttct gcgaggatat 1860 :[1] ggccgcccag gtgggcgtga gcatccaggc agtggtagcc atcttactct gcatcctcac 1920 :[1] catcacagtg atcaccctgc tcatcttcct gcggcggcgg ctccggaagc aggcccgcgc 1980 :[1] gcacggcaag agcgtgccgg agatccacga gcagctggtc acctacgacg aggagggcgg 2040 :[1] cggcgagatg gacaccacca gctacgatgt gtcggtgctc aactcggtgc gccgcggcgg 2100 :[1] ggccaagccc ccgcggcccg cgctggacgc ccggccttcc ctctatgcgc aggtgcagaa 2160 :[1] gccaccgagg cacgcgcctg gggcacacgg agggcccggg gagatggcag ccatgatcga 2220 :[1] ggtgaagaag gacgaggcgg accacgacgg cgacggcccc ccctacgaca cgctgcacat 2280 :[1] ctacggctac gagggctccg agtccatagc cgagtccctc agctccctgg gcaccgactc 2340 :[1] atccgactct gacgtggatt acgacttcct taacgactgg ggacccaggt ttaagatgct 2400 :[1] ggctgagctg tacggctcgg acccccggga ggagctgctg tattaggcgg ccgaggtcac 2460 :[1] tctgggcctg gggacccaaa ccccctgcag cccaggccag tcagactcca ggcaccacag 2520 :[1] cvncadctcc aaaaatggca gtgactcccc agcccagcac cccttcctcg tgggtcccag 2580 :[1] agacctcatc agccttggga tagcaaactc caggttcctg aaatatccag gaatatatgt 2640 :[1] cagtgatgac tattctcaaa tgctggcaaa tccaggctgg tgttctgtct gggctcagac 2700 :[1] atccacataa ccctgtcacc cacagaccgc cgtctaactc aaagacttcc tctggctccc 2760 :[1] caaggctgca aagcaaaaca gactgtgttt aactgctgca gggtcttttt ctagggtccc 2820 :[1] tgaacgccct ggtaaggctg gtgaggtcct ggtgcctatc tgcctggagg caaaggcctg 2880 :[1] gacagcttga cttgtggggc aggattctct gcagcccatt cccaagggag actgaccatc 2940 :[1] atgccctctc tcgggagccc tagccctgct ccaactccat actccactcc aagtgcccca 3000 :[1] ccactcccca acccctctcc aggcctgtca agagggagga aggggcccca tggcagctcc 3060 :[1] tgaccttggg tcctgaagtg acctcactgg cctgccatgc cagtaactgt gctgtactga 3120 :[1] gcactgaacc acattcaggg aaatggctta ttaaactttg aagcaactgt 3170 :[1] // ajRegFree 1b27a0 size regexp 4 ajRegFree 1b2890 size regexp 4 ajRegFree 1b2960 size regexp 4 ajRegFree 1b29e0 size regexp 4 ajRegFree 1b2a80 size regexp 4 ajRegFree 1afa60 size regexp 4 ajRegFree 1afb30 size regexp 4 ajRegFree 1afbc0 size regexp 4 ajRegFree 1afc50 size regexp 4 seqRead: seqin format 3 'embl' ajFeattableDel 0 seqRead: cleared seqRead: one format specified ajFileBuffNoBuff buffsize: 132 ++seqRead known format 3 ++seqReadFmt format 3 (embl) 'qasrswww:HSCAD5' feat No seqReadEmbl first line 'Date: Sat, 29 Nov 2003 09:46:49 GMT ' Format 3 (embl) failed, file buffer reset by seqReadFmt ++seqReadFmt failed - nothing read seqRead: (b2) seqReadFmt stat == FAIL *failed* ajFeattableDel 0 seqRead failed - try again with format 3 'embl' ++seqReadFmt format 3 (embl) 'qasrswww:HSCAD5' feat No seqReadEmbl first line 'Date: Sat, 29 Nov 2003 09:46:49 GMT ' Format 3 (embl) failed, file buffer reset by seqReadFmt ++seqReadFmt failed - nothing read seqRead: (b3) seqReadFmt stat == FAIL *failed* -------------- next part -------------- A non-text attachment was scrubbed... Name: not available Type: text/enriched Size: 12990 bytes Desc: not available URL: From ableasby at hgmp.mrc.ac.uk Sun Nov 30 17:04:55 2003 From: ableasby at hgmp.mrc.ac.uk (Alan Bleasby) Date: Sun, 30 Nov 2003 17:04:55 GMT Subject: [EMBOSS] EMBOSS 2.8.0 released Message-ID: <200311301704.hAUH4tei000865@bromine.hgmp.mrc.ac.uk> EMBOSS 2.8.0 is available for download from: http://www.uk.embnet.org/Software/EMBOSS ftp://ftp.uk.embnet.org/pub/EMBOSS Details of changes from 2.7.1 are, as usual, available in the ChangeLog file. Note that large file support is now the default compilation mode. The original indexing system is, however, still used in 2.8.0 so should not be used on individual database flat files >2Gb. We expect to release a new indexing system in 2.9.0 (in fact the code is distributed for this in 2.8.0 but is not yet integrated). GUI developers who did not pick up the pre-2.8.0 release should note that there have been significant changes to the ACD files in this release. COMPILATION: 1) Systems where gcc is not the system compiler (e.g. AIX,HP-UX,IRIX,Tru64, Solaris) We recommend using the default compiler for each platform. The configure scripts, being GNU, will preferentially use the gcc compiler by default. To use the system compiler type: setenv CC cc or the 'sh' equivalent before configuration. 2) Systems where gcc is the default compiler (e.g. Linux,MacOSX) No pre-configuration commands are required. EMBOSS should compile with gcc on systems even when it isn't the manufacturer supplied compiler for the platform however, using the recommended compiler will ensure that all compilation optimisations are applied. Use of the manufacturer's compiler also allows the --enable-64 switch to be used, should 64-bit pointers be necessary for any of your applications (and the architecture allows them). The --enable-64 flag is not necessary for normal EMBOSS operation and is therefore off by default. 3) IRIX systems You should: setenv CC cc as above. There is also a configuration switch for IRIX which you should use (--with-sgiabi=). This allows you to select 32/64-bit libraries and the MIPS level (3 or 4). The values accepted by the switch are: n32m3 n32m4 64m3 64m4 An example configuration line is: ./configure --with-sgiabi=n32m3 [etc] The --enable-64 flag is meaningless for IRIX as the use/non-use of 64-bit pointers is controlled by the --with-sgiabi switch. EMBASSY Note that, because of the ACD changes mentioned above, those sites who install the EMBASSY packages (also in ftp://ftp.uk.embnet.org/pub/EMBOSS/) will need to re-ftp and build them. SYSTEMS NOT DIRECTLY SUPPORTED BY THE CORE DEVELOPMENT TEAM Compilation of EMBOSS should still work. We patently have no way of testing this though. The compilation may not build in large file support for those platforms. Large file support is not strictly necessary for 2.8.0 but will be required when the new indexing system is released. We will be happy to hear from people, with experience of systems aspects of such platforms, and collaborate to make as many platforms as possible ready for the next release (email emboss-bug at embnet.org). Alan