[BioRuby] bio blast

George Githinji georgkam at gmail.com
Wed Jan 30 07:01:46 EST 2008


Hello ,
Am running this code on ruby 1.8.6, bioruby 1.2.1 on a windows xp platform,

require 'bio'

#seq_to_blast =
"DIADIIRGKDLYLGDQERKQHLEKRLETMFEKIQKNNNNKLSNLSTKEVREYWWALNRDQVWKAITCDAGAADEYFKKSGKLEFEFTGGQCGRDGENVPTYLDYVPQFFR"
#program = "blastp"
db = "f:/var_blast_datasets/Kenyan_field_var_PR.txt"

factory = Bio::Blast.new("blastp","#{db}","-m  0", "local")
result = factory.query
('DIADIIRGKDLYLGDQERKQHLEKRLETMFEKIQKNNNNKLSNLSTKEVREYWWALNRDQVWKAITCDAGAADEYFKKSGKLEFEFTGGQCGRDGENVPTYLDYVPQFFR')

 result.each do |hit|
      puts hit.bit_score        # bit score (*)
      puts hit.query_seq        # query sequence (TRANSLATOR'S NOTE:
sequence of homologous region of query sequence)
      puts hit.midline          # middle line string of alignment of
homologous region (*)
      puts hit.target_seq       # hit sequence (TRANSLATOR'S NOTE: sequence
of homologous region of query sequence)

      puts hit.evalue           # E-value
      puts hit.identity         # % identity
      puts hit.overlap          # length of overlapping region
      puts hit.query_id         # identifier of query sequence
      puts hit.query_def        # definition(comment line) of query sequence
      puts hit.query_len        # length of query sequence
      puts hit.target_id        # identifier of hit sequence
      puts hit.target_def       # definition(comment line) of hit sequence
      puts hit.target_len       # length of hit sequence
      puts hit.query_start      # start position of homologous region in
query sequence
      puts hit.query_end        # end position of homologous region in query
sequence
      puts hit.target_start     # start position of homologous region in
hit(target) sequence
      puts hit.target_end       # end position of homologous region in
hit(target) sequence
      puts hit.lap_at           # array of above four numbers
    end

But instead i get this error:

C:/ruby-1.8.6/ruby/lib/ruby/gems/1.8/gems/bio-1.2.1/lib/bio/appl/blast/format8.rb:70:in
`tab_parse_hsp': undefined method `strip' for nil:NilClass (NoMethodError)

        from C:/ruby-1.8.6/ruby/lib/ruby/gems/1.8/gems/bio-1.2.1/lib/bio/appl/blast/format8.rb:32:in
`tab_parse'

        from C:/ruby-1.8.6/ruby/lib/ruby/gems/1.8/gems/bio-1.2.1/lib/bio/appl/blast/format8.rb:30:in
`each'

        from C:/ruby-1.8.6/ruby/lib/ruby/gems/1.8/gems/bio-1.2.1/lib/bio/appl/blast/format8.rb:30:in
`tab_parse'

        from C:/ruby-1.8.6/ruby/lib/ruby/gems/1.8/gems/bio-1.2.1/lib/bio/appl/blast/report.rb:71:in
`auto_parse'

        from C:/ruby-1.8.6/ruby/lib/ruby/gems/1.8/gems/bio-1.2.1/lib/bio/appl/blast/report.rb:89:in
`initialize'

        from C:/ruby-1.8.6/ruby/lib/ruby/gems/1.8/gems/bio-1.2.1/lib/bio/appl/blast.rb:232:in
`new'

        from C:/ruby-1.8.6/ruby/lib/ruby/gems/1.8/gems/bio-1.2.1/lib/bio/appl/blast.rb:232:in
`parse_result'

        from C:/ruby-1.8.6/ruby/lib/ruby/gems/1.8/gems/bio-1.2.1/lib/bio/appl/blast.rb:246:in
`exec_local'

        from C:/ruby-1.8.6/ruby/lib/ruby/gems/1.8/gems/bio-1.2.1/lib/bio/appl/blast.rb:212:in
`send'

        from C:/ruby-1.8.6/ruby/lib/ruby/gems/1.8/gems/bio-1.2.1/lib/bio/appl/blast.rb:212:in
`query'

        from F:/Netbeans_folder/vargene/lib/bio_blast.rb:8

Where could i be messing up?

Thank you.


More information about the BioRuby mailing list