From ngoto at dev.open-bio.org Mon Jun 2 05:33:50 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Mon, 02 Jun 2008 09:33:50 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio reference.rb,1.26,1.27 Message-ID: <200806020933.m529Xoou025921@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio In directory dev.open-bio.org:/tmp/cvs-serv25887 Modified Files: reference.rb Log Message: reverted to 1.24, because of potential security problem about "eval" in bibtex method. Index: reference.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/reference.rb,v retrieving revision 1.26 retrieving revision 1.27 diff -C2 -d -r1.26 -r1.27 *** reference.rb 31 May 2008 09:36:55 -0000 1.26 --- reference.rb 2 Jun 2008 09:33:48 -0000 1.27 *************** *** 71,74 **** --- 71,77 ---- attr_reader :abstract + # An URL String. + attr_reader :url + # MeSH terms in an Array. attr_reader :mesh *************** *** 77,83 **** attr_reader :affiliations - # An URL String. - attr_reader :url - # Create a new Bio::Reference object from a Hash of values. # Data is extracted from the values for keys: --- 80,83 ---- *************** *** 232,236 **** lines << "%P #{@pages}" unless @pages.empty? lines << "%M #{@pubmed}" unless @pubmed.to_s.empty? ! lines << "%U #{url}" unless url.empty? lines << "%X #{@abstract}" unless @abstract.empty? @mesh.each do |term| --- 232,241 ---- lines << "%P #{@pages}" unless @pages.empty? lines << "%M #{@pubmed}" unless @pubmed.to_s.empty? ! if @pubmed ! cgi = "http://www.ncbi.nlm.nih.gov/entrez/query.fcgi" ! opts = "cmd=Retrieve&db=PubMed&dopt=Citation&list_uids" ! @url = "#{cgi}?#{opts}=#{@pubmed}" ! end ! lines << "%U #{@url}" unless @url.empty? lines << "%X #{@abstract}" unless @abstract.empty? @mesh.each do |term| *************** *** 294,321 **** # *Arguments*: # * (optional) _section_: BiBTeX section as String - # * (optional) _keywords_: Array of additional keywords, e.g. ['abstract'] # *Returns*:: String ! def bibtex(section = nil, add_keywords = []) section = "article" unless section authors = authors_join(' and ', ' and ') pages = @pages.sub('-', '--') ! keywords = "author title journal year volume number pages url".split(/ /) ! bib = "@#{section}{PMID:#{@pubmed},\n" ! (keywords+add_keywords).each do | kw | ! if kw == 'author' ! ref = authors ! elsif kw == 'title' ! # strip final dot from title ! ref = @title.sub(/\.$/,'') ! elsif kw == 'number' ! ref = @issue ! elsif kw == 'url' ! ref = url ! else ! ref = eval('@'+kw) ! end ! bib += " #{kw.ljust(12)} = {#{ref}},\n" if ref != '' ! end ! bib+"}\n" end --- 299,318 ---- # *Arguments*: # * (optional) _section_: BiBTeX section as String # *Returns*:: String ! def bibtex(section = nil) section = "article" unless section authors = authors_join(' and ', ' and ') pages = @pages.sub('-', '--') ! return <<-"END".gsub(/\t/, '') ! @#{section}{PMID:#{@pubmed}, ! author = {#{authors}}, ! title = {#{@title}}, ! journal = {#{@journal}}, ! year = {#{@year}}, ! volume = {#{@volume}}, ! number = {#{@issue}}, ! pages = {#{pages}}, ! } ! END end *************** *** 503,518 **** end - # Returns a valid URL for pubmed records - # - # *Returns*:: String - def url - return @url if @url and @url != '' - if @pubmed != '' - cgi = "http://www.ncbi.nlm.nih.gov/entrez/query.fcgi" - opts = "cmd=Retrieve&db=PubMed&dopt=Citation&list_uids" - return "#{cgi}?#{opts}=#{@pubmed}" - end - '' - end private --- 500,503 ---- *************** *** 542,546 **** end - end --- 527,530 ---- From ngoto at dev.open-bio.org Mon Jun 2 05:47:11 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Mon, 02 Jun 2008 09:47:11 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio reference.rb,1.27,1.28 Message-ID: <200806020947.m529lBCN026079@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio In directory dev.open-bio.org:/tmp/cvs-serv26058/lib/bio Modified Files: reference.rb Log Message: * New method Bio::Reference#pubmed_url added (renamed the url method in revision 1.25). * Bio::Reference#endnote is changed not to overwrite url if url is already given by user. Index: reference.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/reference.rb,v retrieving revision 1.27 retrieving revision 1.28 diff -C2 -d -r1.27 -r1.28 *** reference.rb 2 Jun 2008 09:33:48 -0000 1.27 --- reference.rb 2 Jun 2008 09:47:08 -0000 1.28 *************** *** 232,241 **** lines << "%P #{@pages}" unless @pages.empty? lines << "%M #{@pubmed}" unless @pubmed.to_s.empty? ! if @pubmed ! cgi = "http://www.ncbi.nlm.nih.gov/entrez/query.fcgi" ! opts = "cmd=Retrieve&db=PubMed&dopt=Citation&list_uids" ! @url = "#{cgi}?#{opts}=#{@pubmed}" ! end ! lines << "%U #{@url}" unless @url.empty? lines << "%X #{@abstract}" unless @abstract.empty? @mesh.each do |term| --- 232,237 ---- lines << "%P #{@pages}" unless @pages.empty? lines << "%M #{@pubmed}" unless @pubmed.to_s.empty? ! url = @url.empty? ? pubmed_url : @url ! lines << "%U #{url}" unless url.empty? lines << "%X #{@abstract}" unless @abstract.empty? @mesh.each do |term| *************** *** 500,503 **** --- 496,510 ---- end + # Returns a valid URL for pubmed records + # + # *Returns*:: String + def pubmed_url + unless @pubmed.to_s.empty? + cgi = "http://www.ncbi.nlm.nih.gov/entrez/query.fcgi" + opts = "cmd=Retrieve&db=PubMed&dopt=Citation&list_uids" + return "#{cgi}?#{opts}=#{@pubmed}" + end + '' + end private From ngoto at dev.open-bio.org Wed Jun 4 10:56:40 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Wed, 04 Jun 2008 14:56:40 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio reference.rb,1.28,1.29 Message-ID: <200806041456.m54Eue8E001532@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio In directory dev.open-bio.org:/tmp/cvs-serv1512/lib/bio Modified Files: reference.rb Log Message: improvement of Bio::Reference#bibtex method Index: reference.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/reference.rb,v retrieving revision 1.28 retrieving revision 1.29 diff -C2 -d -r1.28 -r1.29 *** reference.rb 2 Jun 2008 09:47:08 -0000 1.28 --- reference.rb 4 Jun 2008 14:56:37 -0000 1.29 *************** *** 167,184 **** # *Arguments*: # * (optional) _style_: String with style identifier ! # * (optional) _option_: Option for styles accepting one # *Returns*:: String ! def format(style = nil, option = nil) case style when 'endnote' return endnote when 'bibitem' ! return bibitem(option) when 'bibtex' ! return bibtex(option) when 'rd' ! return rd(option) when /^nature$/i ! return nature(option) when /^science$/i return science --- 167,184 ---- # *Arguments*: # * (optional) _style_: String with style identifier ! # * (optional) _options_: Options for styles accepting one # *Returns*:: String ! def format(style = nil, *options) case style when 'endnote' return endnote when 'bibitem' ! return bibitem(*options) when 'bibtex' ! return bibtex(*options) when 'rd' ! return rd(*options) when /^nature$/i ! return nature(*options) when /^science$/i return science *************** *** 295,314 **** # *Arguments*: # * (optional) _section_: BiBTeX section as String # *Returns*:: String ! def bibtex(section = nil) section = "article" unless section authors = authors_join(' and ', ' and ') ! pages = @pages.sub('-', '--') ! return <<-"END".gsub(/\t/, '') ! @#{section}{PMID:#{@pubmed}, ! author = {#{authors}}, ! title = {#{@title}}, ! journal = {#{@journal}}, ! year = {#{@year}}, ! volume = {#{@volume}}, ! number = {#{@issue}}, ! pages = {#{pages}}, ! } ! END end --- 295,340 ---- # *Arguments*: # * (optional) _section_: BiBTeX section as String + # * (optional) _label_: Label string cited by LaTeX documents. + # Default is "PMID:#{pubmed}". + # * (optional) _keywords_: Hash of additional keywords, + # e.g. { 'abstract' => 'This is abstract.' }. + # You can also override default keywords. + # To disable default keywords, specify false as + # value, e.g. { 'url' => false, 'year' => false }. # *Returns*:: String ! def bibtex(section = nil, label = nil, keywords = {}) section = "article" unless section authors = authors_join(' and ', ' and ') ! thepages = pages.to_s.empty? ? nil : pages.sub(/\-/, '--') ! unless label then ! label = "PMID:#{pubmed}" ! end ! theurl = if !(url.to_s.empty?) then ! url ! elsif pmurl = pubmed_url and !(pmurl.to_s.empty?) then ! pmurl ! else ! nil ! end ! hash = { ! 'author' => authors.empty? ? nil : authors, ! 'title' => title.to_s.empty? ? nil : title, ! 'number' => issue.to_s.empty? ? nil : issue, ! 'pages' => thepages, ! 'url' => theurl ! } ! keys = %w( author title journal year volume number pages url ) ! keys.each do |k| ! hash[k] = self.__send__(k.intern) unless hash.has_key?(k) ! end ! hash.merge!(keywords) { |k, v1, v2| v2.nil? ? v1 : v2 } ! bib = [ "@#{section}{#{label}," ] ! keys.concat((hash.keys - keys).sort) ! keys.each do |kw| ! ref = hash[kw] ! bib.push " #{kw.ljust(12)} = {#{ref}}," if ref ! end ! bib.push "}\n" ! return bib.join("\n") end From ngoto at dev.open-bio.org Wed Jun 4 10:58:10 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Wed, 04 Jun 2008 14:58:10 +0000 Subject: [BioRuby-cvs] bioruby/test/unit/bio test_reference.rb,1.4,1.5 Message-ID: <200806041458.m54EwAo2001581@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/test/unit/bio In directory dev.open-bio.org:/tmp/cvs-serv1561/test/unit/bio Modified Files: test_reference.rb Log Message: test changed due to the improvement of Bio::Reference#bibtex Index: test_reference.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/test/unit/bio/test_reference.rb,v retrieving revision 1.4 retrieving revision 1.5 diff -C2 -d -r1.4 -r1.5 *** test_reference.rb 31 May 2008 09:36:56 -0000 1.4 --- test_reference.rb 4 Jun 2008 14:58:08 -0000 1.5 *************** *** 103,112 **** def test_format_bibtex ! str = "@article{PMID:12345678,\n author = {Hoge, J.P. and Fuga, F.B.},\n title = {Title of the study},\n journal = {Theor. J. Hoge},\n year = {2001},\n volume = {12},\n number = {3},\n pages = {123-145},\n url = {http://example.com},\n}\n" ! assert_equal(str, @obj.format('bibtex')) assert_equal(str, @obj.bibtex) end def test_format_rd str = "== Title of the study.\n\n* Hoge, J.P. and Fuga, F.B.\n\n* Theor. J. Hoge 2001 12:123-145 [PMID:12345678]\n\nHoge fuga. hoge fuga." --- 103,147 ---- def test_format_bibtex ! str =<<__END__ ! @article{PMID:12345678, ! author = {Hoge, J.P. and Fuga, F.B.}, ! title = {Title of the study.}, ! journal = {Theor. J. Hoge}, ! year = {2001}, ! volume = {12}, ! number = {3}, ! pages = {123--145}, ! url = {http://example.com}, ! } ! __END__ assert_equal(str, @obj.format('bibtex')) assert_equal(str, @obj.bibtex) end + def test_format_bibtex_with_arguments + str =<<__END__ + @inproceedings{YourArticle, + author = {Hoge, J.P. and Fuga, F.B.}, + title = {Title of the study.}, + year = {2001}, + volume = {12}, + number = {3}, + pages = {123--145}, + booktitle = {Theor. J. Hoge}, + month = {December}, + } + __END__ + assert_equal(str, @obj.format('bibtex', 'inproceedings', 'YourArticle', + { 'journal' => false, + 'url' => false, + 'booktitle' => @obj.journal, + 'month' => 'December'})) + assert_equal(str, @obj.bibtex('inproceedings', 'YourArticle', + { 'journal' => false, + 'url' => false, + 'booktitle' => @obj.journal, + 'month' => 'December'})) + end + def test_format_rd str = "== Title of the study.\n\n* Hoge, J.P. and Fuga, F.B.\n\n* Theor. J. Hoge 2001 12:123-145 [PMID:12345678]\n\nHoge fuga. hoge fuga." From ngoto at dev.open-bio.org Fri Jun 13 07:20:26 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Fri, 13 Jun 2008 11:20:26 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio reference.rb,1.29,1.30 Message-ID: <200806131120.m5DBKQLQ004888@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio In directory dev.open-bio.org:/tmp/cvs-serv4830/lib/bio Modified Files: reference.rb Log Message: modified RDoc for Bio::Reference#bibitem Index: reference.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/reference.rb,v retrieving revision 1.29 retrieving revision 1.30 diff -C2 -d -r1.29 -r1.30 *** reference.rb 4 Jun 2008 14:56:37 -0000 1.29 --- reference.rb 13 Jun 2008 11:20:23 -0000 1.30 *************** *** 252,255 **** --- 252,257 ---- # {\em Theor. J. Hoge}, 12(3):123--145, 2001. # --- + # *Arguments*: + # * (optional) _item_: label string (default: "PMID:#{pubmed}"). # *Returns*:: String def bibitem(item = nil) From ngoto at dev.open-bio.org Fri Jun 13 07:37:27 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Fri, 13 Jun 2008 11:37:27 +0000 Subject: [BioRuby-cvs] bioruby/test/unit/bio/util/restriction_enzyme/double_stranded test_aligned_strands.rb, 1.3, 1.4 Message-ID: <200806131137.m5DBbRnA005201@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/test/unit/bio/util/restriction_enzyme/double_stranded In directory dev.open-bio.org:/tmp/cvs-serv5181/test/unit/bio/util/restriction_enzyme/double_stranded Modified Files: test_aligned_strands.rb Log Message: "require 'bio/sequence'" is needed to run the tests in this file. Index: test_aligned_strands.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/test/unit/bio/util/restriction_enzyme/double_stranded/test_aligned_strands.rb,v retrieving revision 1.3 retrieving revision 1.4 diff -C2 -d -r1.3 -r1.4 *** test_aligned_strands.rb 5 Apr 2007 23:35:44 -0000 1.3 --- test_aligned_strands.rb 13 Jun 2008 11:37:25 -0000 1.4 *************** *** 14,17 **** --- 14,18 ---- require 'test/unit' + require 'bio/sequence' require 'bio/util/restriction_enzyme/double_stranded/aligned_strands' require 'bio/util/restriction_enzyme/double_stranded' From ngoto at dev.open-bio.org Fri Jun 13 07:39:41 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Fri, 13 Jun 2008 11:39:41 +0000 Subject: [BioRuby-cvs] bioruby/test/unit/bio/util/restriction_enzyme/double_stranded test_aligned_strands.rb, 1.3, 1.3.2.1 Message-ID: <200806131139.m5DBdfXW005450@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/test/unit/bio/util/restriction_enzyme/double_stranded In directory dev.open-bio.org:/tmp/cvs-serv5209/test/unit/bio/util/restriction_enzyme/double_stranded Modified Files: Tag: BRANCH-biohackathon2008 test_aligned_strands.rb Log Message: merged change from rev. 1.3 to 1.4 in the CVS trunk Index: test_aligned_strands.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/test/unit/bio/util/restriction_enzyme/double_stranded/test_aligned_strands.rb,v retrieving revision 1.3 retrieving revision 1.3.2.1 diff -C2 -d -r1.3 -r1.3.2.1 *** test_aligned_strands.rb 5 Apr 2007 23:35:44 -0000 1.3 --- test_aligned_strands.rb 13 Jun 2008 11:39:39 -0000 1.3.2.1 *************** *** 14,17 **** --- 14,18 ---- require 'test/unit' + require 'bio/sequence' require 'bio/util/restriction_enzyme/double_stranded/aligned_strands' require 'bio/util/restriction_enzyme/double_stranded' From ngoto at dev.open-bio.org Tue Jun 17 08:23:52 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Tue, 17 Jun 2008 12:23:52 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio reference.rb,1.24.2.6,1.24.2.7 Message-ID: <200806171223.m5HCNqfC020085@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio In directory dev.open-bio.org:/tmp/cvs-serv20065/lib/bio Modified Files: Tag: BRANCH-biohackathon2008 reference.rb Log Message: merged changes in trunk (revision 1.30) Index: reference.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/reference.rb,v retrieving revision 1.24.2.6 retrieving revision 1.24.2.7 diff -C2 -d -r1.24.2.6 -r1.24.2.7 *** reference.rb 23 Apr 2008 18:52:18 -0000 1.24.2.6 --- reference.rb 17 Jun 2008 12:23:49 -0000 1.24.2.7 *************** *** 180,186 **** # *Arguments*: # * (optional) _style_: String with style identifier ! # * (optional) _option_: Option for styles accepting one # *Returns*:: String ! def format(style = nil, option = nil) case style when 'embl' --- 180,186 ---- # *Arguments*: # * (optional) _style_: String with style identifier ! # * (optional) _options_: Options for styles accepting one # *Returns*:: String ! def format(style = nil, *options) case style when 'embl' *************** *** 189,199 **** return endnote when 'bibitem' ! return bibitem(option) when 'bibtex' ! return bibtex(option) when 'rd' ! return rd(option) when /^nature$/i ! return nature(option) when /^science$/i return science --- 189,199 ---- return endnote when 'bibitem' ! return bibitem(*options) when 'bibtex' ! return bibtex(*options) when 'rd' ! return rd(*options) when /^nature$/i ! return nature(*options) when /^science$/i return science *************** *** 247,256 **** lines << "%P #{@pages}" unless @pages.empty? lines << "%M #{@pubmed}" unless @pubmed.to_s.empty? ! if @pubmed ! cgi = "http://www.ncbi.nlm.nih.gov/entrez/query.fcgi" ! opts = "cmd=Retrieve&db=PubMed&dopt=Citation&list_uids" ! @url = "#{cgi}?#{opts}=#{@pubmed}" ! end ! lines << "%U #{@url}" unless @url.empty? lines << "%X #{@abstract}" unless @abstract.empty? @mesh.each do |term| --- 247,252 ---- lines << "%P #{@pages}" unless @pages.empty? lines << "%M #{@pubmed}" unless @pubmed.to_s.empty? ! u = @url.empty? ? pubmed_url : @url ! lines << "%U #{u}" unless u.empty? lines << "%X #{@abstract}" unless @abstract.empty? @mesh.each do |term| *************** *** 289,292 **** --- 285,290 ---- # {\em Theor. J. Hoge}, 12(3):123--145, 2001. # --- + # *Arguments*: + # * (optional) _item_: label string (default: "PMID:#{pubmed}"). # *Returns*:: String def bibitem(item = nil) *************** *** 332,351 **** # *Arguments*: # * (optional) _section_: BiBTeX section as String # *Returns*:: String ! def bibtex(section = nil) section = "article" unless section authors = authors_join(' and ', ' and ') ! pages = @pages.sub('-', '--') ! return <<-"END".gsub(/\t/, '') ! @#{section}{PMID:#{@pubmed}, ! author = {#{authors}}, ! title = {#{@title}}, ! journal = {#{@journal}}, ! year = {#{@year}}, ! volume = {#{@volume}}, ! number = {#{@issue}}, ! pages = {#{pages}}, ! } ! END end --- 330,375 ---- # *Arguments*: # * (optional) _section_: BiBTeX section as String + # * (optional) _label_: Label string cited by LaTeX documents. + # Default is "PMID:#{pubmed}". + # * (optional) _keywords_: Hash of additional keywords, + # e.g. { 'abstract' => 'This is abstract.' }. + # You can also override default keywords. + # To disable default keywords, specify false as + # value, e.g. { 'url' => false, 'year' => false }. # *Returns*:: String ! def bibtex(section = nil, label = nil, keywords = {}) section = "article" unless section authors = authors_join(' and ', ' and ') ! thepages = pages.to_s.empty? ? nil : pages.sub(/\-/, '--') ! unless label then ! label = "PMID:#{pubmed}" ! end ! theurl = if !(url.to_s.empty?) then ! url ! elsif pmurl = pubmed_url and !(pmurl.to_s.empty?) then ! pmurl ! else ! nil ! end ! hash = { ! 'author' => authors.empty? ? nil : authors, ! 'title' => title.to_s.empty? ? nil : title, ! 'number' => issue.to_s.empty? ? nil : issue, ! 'pages' => thepages, ! 'url' => theurl ! } ! keys = %w( author title journal year volume number pages url ) ! keys.each do |k| ! hash[k] = self.__send__(k.intern) unless hash.has_key?(k) ! end ! hash.merge!(keywords) { |k, v1, v2| v2.nil? ? v1 : v2 } ! bib = [ "@#{section}{#{label}," ] ! keys.concat((hash.keys - keys).sort) ! keys.each do |kw| ! ref = hash[kw] ! bib.push " #{kw.ljust(12)} = {#{ref}}," if ref ! end ! bib.push "}\n" ! return bib.join("\n") end *************** *** 533,536 **** --- 557,571 ---- end + # Returns a valid URL for pubmed records + # + # *Returns*:: String + def pubmed_url + unless @pubmed.to_s.empty? + cgi = "http://www.ncbi.nlm.nih.gov/entrez/query.fcgi" + opts = "cmd=Retrieve&db=PubMed&dopt=Citation&list_uids" + return "#{cgi}?#{opts}=#{@pubmed}" + end + '' + end private From ngoto at dev.open-bio.org Tue Jun 17 08:24:44 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Tue, 17 Jun 2008 12:24:44 +0000 Subject: [BioRuby-cvs] bioruby/test/unit/bio test_reference.rb, 1.3.2.1, 1.3.2.2 Message-ID: <200806171224.m5HCOiAk020113@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/test/unit/bio In directory dev.open-bio.org:/tmp/cvs-serv20093/test/unit/bio Modified Files: Tag: BRANCH-biohackathon2008 test_reference.rb Log Message: merged changes from trunk (revision 1.5) Index: test_reference.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/test/unit/bio/test_reference.rb,v retrieving revision 1.3.2.1 retrieving revision 1.3.2.2 diff -C2 -d -r1.3.2.1 -r1.3.2.2 *** test_reference.rb 8 May 2008 05:38:01 -0000 1.3.2.1 --- test_reference.rb 17 Jun 2008 12:24:41 -0000 1.3.2.2 *************** *** 92,96 **** def test_format_endnote ! str = "%0 Journal Article\n%A Hoge, J.P.\n%A Fuga, F.B.\n%D 2001\n%T Title of the study.\n%J Theor. J. Hoge\n%V 12\n%N 3\n%P 123-145\n%M 12345678\n%U http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=12345678\n%X Hoge fuga. hoge fuga.\n%K Hoge\n%+ Tokyo" assert_equal(str, @obj.format('endnote')) assert_equal(str, @obj.endnote) --- 92,96 ---- def test_format_endnote ! str = "%0 Journal Article\n%A Hoge, J.P.\n%A Fuga, F.B.\n%D 2001\n%T Title of the study.\n%J Theor. J. Hoge\n%V 12\n%N 3\n%P 123-145\n%M 12345678\n%U http://example.com\n%X Hoge fuga. hoge fuga.\n%K Hoge\n%+ Tokyo" assert_equal(str, @obj.format('endnote')) assert_equal(str, @obj.endnote) *************** *** 104,122 **** def test_format_bibtex ! str =< false, + 'url' => false, + 'booktitle' => @obj.journal, + 'month' => 'December'})) + assert_equal(str, @obj.bibtex('inproceedings', 'YourArticle', + { 'journal' => false, + 'url' => false, + 'booktitle' => @obj.journal, + 'month' => 'December'})) + end + def test_format_rd str = "== Title of the study.\n\n* Hoge, J.P. and Fuga, F.B.\n\n* Theor. J. Hoge 2001 12:123-145 [PMID:12345678]\n\nHoge fuga. hoge fuga." From ngoto at dev.open-bio.org Tue Jun 17 11:25:24 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Tue, 17 Jun 2008 15:25:24 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio sequence.rb,0.58.2.11,0.58.2.12 Message-ID: <200806171525.m5HFPOpk020858@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio In directory dev.open-bio.org:/tmp/cvs-serv20823/lib/bio Modified Files: Tag: BRANCH-biohackathon2008 sequence.rb Log Message: * Some attributes are added: strandedness (strand information), release_created, release_modified (release information), entry_version (version of the entry numbered by database administrator), organelle (organelle information), other_seqids (sequence IDs other than accessions), and id_namespace (namespace of accessions). Most of them are added because corresponding tags are defined in the INSDSeq XML v1.4 ( http://www.insdc.org/files/documents/INSD_V1.4.dtd ). The "id_namespace" will be used to output NCBI style fasta format. * The "taxonomy" attribute is changed to be an alias of the "classification" attribute. * The "date" attribute is removed. * RDoc documents of attributes are updated. Index: sequence.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/sequence.rb,v retrieving revision 0.58.2.11 retrieving revision 0.58.2.12 diff -C2 -d -r0.58.2.11 -r0.58.2.12 *** sequence.rb 24 Apr 2008 14:28:25 -0000 0.58.2.11 --- sequence.rb 17 Jun 2008 15:25:22 -0000 0.58.2.12 *************** *** 118,149 **** end ! # The sequence identifier. For example, for a sequence ! # of Genbank origin, this is the accession number. attr_accessor :entry_id ! # A String with a description of the sequence attr_accessor :definition ! # An Array of Bio::Feature objects attr_accessor :features ! # An Array of Bio::Reference objects attr_accessor :references ! # A comment String attr_accessor :comments ! # Date from sequence source. Often date of deposition. ! attr_accessor :date ! ! # An Array of Strings attr_accessor :keywords ! # An Array of Strings; links to other database entries. attr_accessor :dblinks ! ! # A taxonomy String ! attr_accessor :taxonomy ! # Bio::Sequence::NA/AA attr_accessor :moltype --- 118,145 ---- end ! # The sequence identifier (String). For example, for a sequence ! # of Genbank origin, this is the locus name. ! # For a sequence of EMBL origin, this is the primary accession number. attr_accessor :entry_id ! # A String with a description of the sequence (String) attr_accessor :definition ! # Features (An Array of Bio::Feature objects) attr_accessor :features ! # References (An Array of Bio::Reference objects) attr_accessor :references ! # Comments (String or an Array of String) attr_accessor :comments ! # Keywords (An Array of String) attr_accessor :keywords ! # Links to other database entries. ! # (An Array of Bio::Sequence::DBLink objects) attr_accessor :dblinks ! # Bio::Sequence::NA/AA attr_accessor :moltype *************** *** 157,166 **** #+++ ! # Version number of the sequence (String). attr_accessor :sequence_version ! # Topology (String). "circular" or "linear". attr_accessor :topology # molecular type (String). "DNA" or "RNA" for nucleotide sequence. attr_accessor :molecule_type --- 153,170 ---- #+++ ! # Version number of the sequence (String or Integer). ! # Unlike entry_version, sequence_version will be changed ! # when the submitter of the sequence updates the entry. ! # Normally, the same entry taken from different databases (EMBL, GenBank, ! # and DDBJ) may have the same sequence_version. attr_accessor :sequence_version ! # Topology (String). "circular", "linear", or nil. attr_accessor :topology + # Strandedness (String). "single" (single-stranded), + # "double" (double-stranded), "mixed" (mixed-stranded), or nil. + attr_accessor :strandedness + # molecular type (String). "DNA" or "RNA" for nucleotide sequence. attr_accessor :molecule_type *************** *** 180,189 **** attr_accessor :secondary_accessions ! # Created date of the sequence entry (String) attr_accessor :date_created ! # Last modified date of the sequence entry (String) attr_accessor :date_modified # Organism species (String). For example, "Escherichia coli". attr_accessor :species --- 184,208 ---- attr_accessor :secondary_accessions ! # Created date of the sequence entry (Date, DateTime, Time, or String) attr_accessor :date_created ! # Last modified date of the sequence entry (Date, DateTime, Time, or String) attr_accessor :date_modified + # Release information when created (String) + attr_accessor :release_created + + # Release information when last-modified (String) + attr_accessor :release_modified + + # Version of the entry (String or Integer). + # Unlike sequence_version, entry_version is a database + # maintainer's internal version number. + # The version number will be changed when the database maintainer + # modifies the entry. + # The same enrty in EMBL, GenBank, and DDBJ may have different + # entry_version. + attr_accessor :entry_version + # Organism species (String). For example, "Escherichia coli". attr_accessor :species *************** *** 192,195 **** --- 211,231 ---- # (Array of String) attr_accessor :classification + alias taxonomy classification + + # (not well supported) Organelle information (String). + attr_accessor :organelle + + # Namespace of the sequence IDs described in entry_id, primary_accession, + # and secondary_accessions methods (String). + # For example, 'EMBL', 'GenBank', 'DDBJ', 'RefSeq'. + attr_accessor :id_namespace + + # Sequence identifiers which are not described in entry_id, + # primary_accession,and secondary_accessions methods + # (Array of Bio::Sequence::DBLink objects). + # For example, NCBI GI number can be stored. + # Note that only identifiers of the entry itself should be stored. + # For database cross references, dblinks should be used. + attr_accessor :other_seqids # Guess the type of sequence, Amino Acid or Nucleic Acid, and create a From ngoto at dev.open-bio.org Tue Jun 17 11:44:24 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Tue, 17 Jun 2008 15:44:24 +0000 Subject: [BioRuby-cvs] bioruby/test/unit/bio/sequence test_dblink.rb, NONE, 1.1.2.1 Message-ID: <200806171544.m5HFiOIl021028@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/test/unit/bio/sequence In directory dev.open-bio.org:/tmp/cvs-serv21001/test/unit/bio/sequence Added Files: Tag: BRANCH-biohackathon2008 test_dblink.rb Log Message: New class Bio::Sequence::DBLink are added to store IDs and database names together in an object. --- NEW FILE: test_dblink.rb --- # # test/unit/bio/sequence/test_dblink.rb - Unit test for Bio::Sequencce::DBLink # # Copyright:: Copyright (C) 2008 Naohisa Goto # License:: The Ruby License # # $Id: test_dblink.rb,v 1.1.2.1 2008/06/17 15:44:22 ngoto Exp $ # require 'pathname' libpath = Pathname.new(File.join(File.dirname(__FILE__), ['..'] * 4, 'lib')).cleanpath.to_s $:.unshift(libpath) unless $:.include?(libpath) require 'test/unit' require 'bio/sequence' require 'bio/sequence/dblink' module Bio class TestSequenceDBLink < Test::Unit::TestCase def setup @xref = Bio::Sequence::DBLink.new('EMBL', 'Z14088', 'CAA78466.1', '-', 'mRNA') end def test_database assert_equal('EMBL', @xref.database) end def test_id assert_equal('Z14088', @xref.id) end def test_secondary_ids assert_equal([ 'CAA78466.1', '-', 'mRNA' ], @xref.secondary_ids) end end #class class TestSequenceDBLinkClassMethods < Test::Unit::TestCase def test_parse_embl_DR_line str = 'DR EPD; EP07077; HS_HBG1.' xref = Bio::Sequence::DBLink.parse_embl_DR_line(str) assert_equal('EPD', xref.database) assert_equal('EP07077', xref.id) assert_equal([ 'HS_HBG1' ], xref.secondary_ids) end def test_parse_uniprot_DR_line str = 'DR EMBL; Z14088; CAA78466.1; -; mRNA.' xref = Bio::Sequence::DBLink.parse_uniprot_DR_line(str) assert_equal('EMBL', xref.database) assert_equal('Z14088', xref.id) assert_equal([ 'CAA78466.1', '-', 'mRNA' ], xref.secondary_ids) end end #class end #module Bio From ngoto at dev.open-bio.org Tue Jun 17 11:44:24 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Tue, 17 Jun 2008 15:44:24 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio/sequence dblink.rb,NONE,1.1.2.1 Message-ID: <200806171544.m5HFiOF6021023@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio/sequence In directory dev.open-bio.org:/tmp/cvs-serv21001/lib/bio/sequence Added Files: Tag: BRANCH-biohackathon2008 dblink.rb Log Message: New class Bio::Sequence::DBLink are added to store IDs and database names together in an object. --- NEW FILE: dblink.rb --- # # = bio/sequence/dblink.rb - sequence ID with database name # # Copyright:: Copyright (C) 2008 # Naohisa Goto # License:: The Ruby License # # $Id: dblink.rb,v 1.1.2.1 2008/06/17 15:44:22 ngoto Exp $ # require 'bio/sequence' # Bio::Sequence::DBLink stores IDs with the database name. # Its main purpose is to store database cross-reference information # for a sequence entry. class Bio::Sequence::DBLink # creates a new DBLink object def initialize(database, primary_id, *secondary_ids) @database = database @id = primary_id @secondary_ids = secondary_ids end # Database name, or namespace identifier (String). attr_reader :database # Primary identifier (String) attr_reader :id # Secondary identifiers (Array of String) attr_reader :secondary_ids #-- # class methods #++ # Parses DR line in EMBL entry, and returns a DBLink object. def self.parse_embl_DR_line(str) str = str.sub(/\.\s*\z/, '') str.sub!(/\ADR /, '') self.new(*(str.split(/\s*\;\s*/, 3))) end # Parses DR line in UniProt entry, and returns a DBLink object. def self.parse_uniprot_DR_line(str) str = str.sub(/\.\s*\z/, '') str.sub!(/\ADR /, '') self.new(*(str.split(/\s*\;\s*/))) end end #class Bio::Sequence::DBLink From ngoto at dev.open-bio.org Tue Jun 17 11:50:07 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Tue, 17 Jun 2008 15:50:07 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio/sequence format.rb,1.4.2.7,1.4.2.8 Message-ID: <200806171550.m5HFo7Jm021095@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio/sequence In directory dev.open-bio.org:/tmp/cvs-serv21057/lib/bio/sequence Modified Files: Tag: BRANCH-biohackathon2008 format.rb Log Message: * In the wrap method, changed to recognize "\n" in given string. * Some helper methods are added to help formatting date string. Index: format.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/sequence/format.rb,v retrieving revision 1.4.2.7 retrieving revision 1.4.2.8 diff -C2 -d -r1.4.2.7 -r1.4.2.8 *** format.rb 4 Mar 2008 11:10:28 -0000 1.4.2.7 --- format.rb 17 Jun 2008 15:50:05 -0000 1.4.2.8 *************** *** 285,305 **** def wrap_and_split_lines(str, width) result = [] ! left = str.dup ! while left and left.length > width ! line = nil ! width.downto(1) do |i| ! if left[i..i] == ' ' or /[\,\;]/ =~ left[(i-1)..(i-1)] then ! line = left[0..(i-1)].sub(/ +\z/, '') ! left = left[i..-1].sub(/\A +/, '') ! break end end ! if line.nil? then ! line = left[0..(width-1)] ! left = left[width..-1] ! end ! result << line end - result << left if left and !(left.to_s.empty?) return result end --- 285,309 ---- def wrap_and_split_lines(str, width) result = [] ! lefts = str.chomp.split(/(?:\r\n|\r|\n)/) ! lefts.each do |left| ! left.rstrip! ! while left and left.length > width ! line = nil ! width.downto(1) do |i| ! if left[i..i] == ' ' or /[\,\;]/ =~ left[(i-1)..(i-1)] then ! line = left[0..(i-1)].sub(/ +\z/, '') ! left = left[i..-1].sub(/\A +/, '') ! break ! end end + if line.nil? then + line = left[0..(width-1)] + left = left[width..-1] + end + result << line + left = nil if left.to_s.empty? end ! result << left if left end return result end *************** *** 320,323 **** --- 324,352 ---- end + #-- + # internal use only + MonthStr = [ nil, + 'JAN', 'FEB', 'MAR', 'APR', 'MAY', 'JUN', + 'JUL', 'AUG', 'SEP', 'OCT', 'NOV', 'DEC' + ].collect { |x| x.freeze }.freeze + #++ + + # formats a date from Date, DateTime, or Time object, or String. + def format_date(d) + begin + yy = d.year + mm = d.month + dd = d.day + rescue NoMethodError, NameError, ArgumentError, TypeError + return sprintf("%-11s", d) + end + sprintf("%02d-%-3s-%04d", dd, MonthStr[mm], yy) + end + + # null date + def null_date + Date.new(0, 1, 1) + end + end #module INSDFeatureHelper From ngoto at dev.open-bio.org Tue Jun 17 11:53:23 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Tue, 17 Jun 2008 15:53:23 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio/db/genbank common.rb, 1.11.2.4, 1.11.2.5 Message-ID: <200806171553.m5HFrNlb021165@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio/db/genbank In directory dev.open-bio.org:/tmp/cvs-serv21145/lib/bio/db/genbank Modified Files: Tag: BRANCH-biohackathon2008 common.rb Log Message: Bio::GenBank#comment (and Bio::GenPept#comment) is changed not to remove newlines inside the comment. Index: common.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/db/genbank/common.rb,v retrieving revision 1.11.2.4 retrieving revision 1.11.2.5 diff -C2 -d -r1.11.2.4 -r1.11.2.5 *** common.rb 7 May 2008 12:25:42 -0000 1.11.2.4 --- common.rb 17 Jun 2008 15:53:21 -0000 1.11.2.5 *************** *** 196,200 **** # COMMENT -- Returns contents of the COMMENT record as a String. def comment ! field_fetch('COMMENT') end --- 196,203 ---- # COMMENT -- Returns contents of the COMMENT record as a String. def comment ! str = get('COMMENT').to_s.sub(/\ACOMMENT /, '') ! str.gsub!(/^ {12}/, '') ! str.chomp! ! str end From ngoto at dev.open-bio.org Tue Jun 17 11:56:20 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Tue, 17 Jun 2008 15:56:20 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio/db/genbank genbank.rb, 0.40.2.3, 0.40.2.4 Message-ID: <200806171556.m5HFuKdb021193@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio/db/genbank In directory dev.open-bio.org:/tmp/cvs-serv21173/lib/bio/db/genbank Modified Files: Tag: BRANCH-biohackathon2008 genbank.rb Log Message: * Bio::GenBank#to_biosequence is changed to imporve support of sequence output and data exchange. * Bio::GenBank#date_created is added. It returns Date object. Index: genbank.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/db/genbank/genbank.rb,v retrieving revision 0.40.2.3 retrieving revision 0.40.2.4 diff -C2 -d -r0.40.2.3 -r0.40.2.4 *** genbank.rb 4 Mar 2008 09:22:35 -0000 0.40.2.3 --- genbank.rb 17 Jun 2008 15:56:18 -0000 0.40.2.4 *************** *** 8,13 **** --- 8,16 ---- # + require 'date' require 'bio/db' require 'bio/db/genbank/common' + require 'bio/sequence' + require 'bio/sequence/dblink' module Bio *************** *** 122,129 **** --- 125,142 ---- alias nalen length + # (obsolete???) length of the sequence def seq_len seq.length end + # modified date. Returns Date object, String or nil. + def date_modified + begin + Date.parse(self.date) + rescue ArgumentError, TypeError, NoMethodError, NameError + self.date + end + end + # converts Bio::GenBank to Bio::Sequence # --- *************** *** 132,135 **** --- 145,156 ---- def to_biosequence sequence = Bio::Sequence.new(seq) + + sequence.id_namespace = + if /\_/ =~ self.accession.to_s then + 'RefSeq' + else + 'GenBank' + end + sequence.entry_id = self.entry_id *************** *** 137,147 **** sequence.secondary_accessions = self.accessions - [ self.accession ] sequence.molecule_type = self.natype sequence.division = self.division sequence.topology = self.circular sequence.sequence_version = self.version #sequence.date_created = nil #???? ! sequence.date_modified = self.date sequence.definition = self.definition --- 158,177 ---- sequence.secondary_accessions = self.accessions - [ self.accession ] + if /GI\:(.+)/ =~ self.gi.to_s then + sequence.other_seqids = [ Bio::Sequence::DBLink.new('GI', $1) ] + end + sequence.molecule_type = self.natype sequence.division = self.division sequence.topology = self.circular + sequence.strandedness = case self.strand.to_s.downcase; + when 'ss-'; 'single'; + when 'ds-'; 'double'; + when 'ms-'; 'mixed'; + else nil; end sequence.sequence_version = self.version #sequence.date_created = nil #???? ! sequence.date_modified = date_modified sequence.definition = self.definition *************** *** 149,153 **** sequence.species = self.organism sequence.classification = self.taxonomy.to_s.sub(/\.\z/, '').split(/\s*\;\s*/) ! #sequence.organnella = nil # not used sequence.comments = self.comment sequence.references = self.references --- 179,183 ---- sequence.species = self.organism sequence.classification = self.taxonomy.to_s.sub(/\.\z/, '').split(/\s*\;\s*/) ! #sequence.organelle = nil # yet unsupported sequence.comments = self.comment sequence.references = self.references From ngoto at dev.open-bio.org Tue Jun 17 11:59:26 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Tue, 17 Jun 2008 15:59:26 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio/db/genbank format_genbank.rb, 1.1.2.4, 1.1.2.5 Message-ID: <200806171559.m5HFxQa4021221@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio/db/genbank In directory dev.open-bio.org:/tmp/cvs-serv21201/lib/bio/db/genbank Modified Files: Tag: BRANCH-biohackathon2008 format_genbank.rb Log Message: * Added support for COMMENT. * Added support for GI number output. * Many improvements are added. Index: format_genbank.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/db/genbank/Attic/format_genbank.rb,v retrieving revision 1.1.2.4 retrieving revision 1.1.2.5 diff -C2 -d -r1.1.2.4 -r1.1.2.5 *** format_genbank.rb 28 May 2008 13:26:33 -0000 1.1.2.4 --- format_genbank.rb 17 Jun 2008 15:59:24 -0000 1.1.2.5 *************** *** 101,104 **** --- 101,115 ---- end + # formats comments lines as GenBank + def comments_format_genbank(cmnts) + return '' if !cmnts or cmnts.empty? + cmnts = [ cmnts ] unless cmnts.kind_of?(Array) + a = [] + cmnts.each do |str| + a.push "COMMENT #{ genbank_wrap(str) }\n" + end + a.join('') + end + # formats sequence lines as GenBank def seq_format_genbank(str) *************** *** 113,122 **** end # Erb template of GenBank format for Bio::Sequence erb_template <<'__END_OF_TEMPLATE__' ! LOCUS <%= sprintf("%-16s", entry_id) %> <%= sprintf("%11d", length) %> bp <%= sprintf("%3s", '') %><%= sprintf("%-6s", molecule_type) %> <%= sprintf("%-8s", topology) %><%= sprintf("%4s", division) %> <%= sprintf("%-11s", date_modified) %> DEFINITION <%= genbank_wrap_dot(definition.to_s) %> ACCESSION <%= genbank_wrap(([ primary_accession ] + (secondary_accessions or [])).join(" ")) %> ! VERSION <%= primary_accession %>.<%= sequence_version %><% unless true or gi_number.to_s.empty? %>GI:<%= gi_number %><% end %> KEYWORDS <%= genbank_wrap_dot((keywords or []).join('; ')) %> SOURCE <%= genbank_wrap(species) %> --- 124,168 ---- end + # formats date + def date_format_genbank + date_modified || date_created || null_date + end + + # moleculue type + def mol_type_genbank + if /(DNA|(t|r|m|u|sn|sno)?RNA)/i =~ molecule_type.to_s then + $1.sub(/[DR]NA/) { |x| x.upcase } + else + 'NA' + end + end + + # NCBI GI number + def ncbi_gi_number + ids = other_seqids + if ids and r = ids.find { |x| x.database == 'GI' } then + r.id + else + nil + end + end + + # strandedness + def strandedness_genbank + return nil unless strandedness + case strandedness + when 'single'; 'ss-'; + when 'double'; 'ds-'; + when 'mixed'; 'ms-'; + else; nil + end + end + # Erb template of GenBank format for Bio::Sequence erb_template <<'__END_OF_TEMPLATE__' ! LOCUS <%= sprintf("%-16s", entry_id) %> <%= sprintf("%11d", length) %> bp <%= sprintf("%3s", strandedness_genbank) %><%= sprintf("%-6s", mol_type_genbank) %> <%= sprintf("%-8s", topology) %><%= sprintf("%4s", division) %> <%= date_format_genbank %> DEFINITION <%= genbank_wrap_dot(definition.to_s) %> ACCESSION <%= genbank_wrap(([ primary_accession ] + (secondary_accessions or [])).join(" ")) %> ! VERSION <%= primary_accession %>.<%= sequence_version %><% if gi = ncbi_gi_number then %> GI:<%= gi %><% end %> KEYWORDS <%= genbank_wrap_dot((keywords or []).join('; ')) %> SOURCE <%= genbank_wrap(species) %> *************** *** 129,132 **** --- 175,179 ---- %><%= reference_format_genbank(ref, n) %><% end + %><%= comments_format_genbank(comments) %>FEATURES Location/Qualifiers <%= format_features_genbank(features || []) From ngoto at dev.open-bio.org Tue Jun 17 12:04:38 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Tue, 17 Jun 2008 16:04:38 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio/db/embl embl.rb,1.29.2.6,1.29.2.7 Message-ID: <200806171604.m5HG4cnr021274@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio/db/embl In directory dev.open-bio.org:/tmp/cvs-serv21250/lib/bio/db/embl Modified Files: Tag: BRANCH-biohackathon2008 embl.rb Log Message: * Bio::EMBL#cc is changed to cut heading "CC ". * Bio::EMBL#to_biosequence to improve support for sequence output and data exchange. * To get parse result of DT lines more easily, Bio::EMBL#date_modified, date_created, release_modified, release_created, and entry_version methods are added. Index: embl.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/db/embl/embl.rb,v retrieving revision 1.29.2.6 retrieving revision 1.29.2.7 diff -C2 -d -r1.29.2.6 -r1.29.2.7 *** embl.rb 28 May 2008 13:09:03 -0000 1.29.2.6 --- embl.rb 17 Jun 2008 16:04:36 -0000 1.29.2.7 *************** *** 32,39 **** --- 32,42 ---- # + require 'date' require 'bio/db' require 'bio/db/embl/common' require 'bio/compat/features' require 'bio/compat/references' + require 'bio/sequence' + require 'bio/sequence/dblink' module Bio *************** *** 323,329 **** # CC Line; comments of notes (>=0) def cc ! get('CC') end ! ## --- 326,332 ---- # CC Line; comments of notes (>=0) def cc ! get('CC').to_s.gsub(/^CC /, '') end ! alias comment cc ## *************** *** 376,379 **** --- 379,436 ---- #++ + # modified date. Returns Date object, String or nil. + def date_modified + parse_date(self.dt['updated']) + end + + # created date. Returns Date object, String or nil. + def date_created + parse_date(self.dt['created']) + end + + # release number when last updated + def release_modified + parse_release_version(self.dt['updated'])[0] + end + + # release number when created + def release_created + parse_release_version(self.dt['created'])[0] + end + + # entry version number numbered by EMBL + def entry_version + parse_release_version(self.dt['updated'])[1] + end + + # parse date string. Returns Date object. + def parse_date(str) + begin + Date.parse(str) + rescue ArgumentError, TypeError, NoMethodError, NameError + str + end + end + private :parse_date + + # extracts release and version numbers from DT line + def parse_release_version(str) + return [ nil, nil ] unless str + a = str.split(/[\(\,\)]/) + dstr = a.shift + rel = nil + ver = nil + a.each do |x| + case x + when /Rel\.\s*(.+)/ + rel = $1.strip + when /Version\s*(.+)/ + ver = $1.strip + end + end + [ rel, ver ] + end + private :parse_release_version + # converts the entry to Bio::Sequence object # --- *************** *** 382,385 **** --- 439,444 ---- def to_biosequence bio_seq = Bio::Sequence.new(self.seq) + + bio_seq.id_namespace = 'EMBL' bio_seq.entry_id = self.entry_id bio_seq.primary_accession = self.accessions[0] *************** *** 389,394 **** bio_seq.definition = self.description bio_seq.topology = self.topology ! bio_seq.date_created = self.dt['created'] ! bio_seq.date_modified = self.dt['updated'] bio_seq.division = self.division bio_seq.sequence_version = self.version --- 448,456 ---- bio_seq.definition = self.description bio_seq.topology = self.topology ! bio_seq.date_created = self.date_created ! bio_seq.date_modified = self.date_modified ! bio_seq.release_created = self.release_created ! bio_seq.release_modified = self.release_modified ! bio_seq.entry_version = self.entry_version bio_seq.division = self.division bio_seq.sequence_version = self.version *************** *** 396,402 **** bio_seq.species = self.fetch('OS') bio_seq.classification = self.oc bio_seq.references = self.references bio_seq.features = self.ft ! return bio_seq end --- 458,469 ---- bio_seq.species = self.fetch('OS') bio_seq.classification = self.oc + # bio_seq.organelle = self.fetch('OG') # unsupported yet bio_seq.references = self.references bio_seq.features = self.ft ! bio_seq.comments = self.cc ! bio_seq.dblinks = get('DR').split(/\n/).collect { |x| ! Bio::Sequence::DBLink.parse_embl_DR_line(x) ! } ! return bio_seq end From ngoto at dev.open-bio.org Tue Jun 17 12:06:06 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Tue, 17 Jun 2008 16:06:06 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio/db/embl format_embl.rb, 1.1.2.5, 1.1.2.6 Message-ID: <200806171606.m5HG66iI021322@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio/db/embl In directory dev.open-bio.org:/tmp/cvs-serv21282/lib/bio/db/embl Modified Files: Tag: BRANCH-biohackathon2008 format_embl.rb Log Message: * Added support for CC lines (comments). * Added support for DR lines (database cross references). * Many improvements. Index: format_embl.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/db/embl/Attic/format_embl.rb,v retrieving revision 1.1.2.5 retrieving revision 1.1.2.6 diff -C2 -d -r1.1.2.5 -r1.1.2.6 *** format_embl.rb 28 May 2008 13:38:07 -0000 1.1.2.5 --- format_embl.rb 17 Jun 2008 16:06:04 -0000 1.1.2.6 *************** *** 2,6 **** # = bio/db/embl/format_embl.rb - EMBL format generater # ! # Copyright:: Copyright (C) 2008 Jan Aerts # License:: The Ruby License # --- 2,8 ---- # = bio/db/embl/format_embl.rb - EMBL format generater # ! # Copyright:: Copyright (C) 2008 ! # Jan Aerts , ! # Naohisa Goto # License:: The Ruby License # *************** *** 125,136 **** end # Erb template of EMBL format for Bio::Sequence erb_template <<'__END_OF_TEMPLATE__' ! ID <%= entry_id %>; SV <%= sequence_version %>; <%= topology %>; <%= molecule_type %>; <%= data_class %>; <%= division %>; <%= seq.length %> BP. XX <%= embl_wrap('AC ', accessions.reject{|a| a.nil?}.join('; ') + ';') %> XX ! DT <%= date_created %> ! DT <%= date_modified %> XX <%= embl_wrap('DE ', definition) %> --- 127,166 ---- end + # moleculue type + def mol_type_embl + if mt = molecule_type then + mt + elsif f = (features or []).find { |f| f.feature == 'source' } and + q = f.qualifiers.find { |q| q.qualifier == 'mol_type' } then + q.value + else + 'NA' + end + end + + # CC line. Comments. + def comments_format_embl(cmnts) + return '' if !cmnts or cmnts.empty? + cmnts = [ cmnts ] unless cmnts.kind_of?(Array) + a = [] + cmnts.each do |str| + a.push embl_wrap('CC ', str) + end + unless a.empty? then + a.push "XX " + a.push '' # dummy to put "\n" at the end of the string + end + a.join("\n") + end + + # Erb template of EMBL format for Bio::Sequence erb_template <<'__END_OF_TEMPLATE__' ! ID <%= primary_accession || entry_id %>; SV <%= sequence_version %>; <%= topology %>; <%= mol_type_embl %>; <%= data_class %>; <%= division %>; <%= seq.length %> BP. XX <%= embl_wrap('AC ', accessions.reject{|a| a.nil?}.join('; ') + ';') %> XX ! DT <%= format_date(date_created || null_date) %> (Rel. <%= release_created || 0 %>, Created) ! DT <%= format_date(date_modified || null_date) %> (Rel. <%= release_modified || 0 %>, Last updated, Version <%= entry_version || 0 %>) XX <%= embl_wrap('DE ', definition) %> *************** *** 142,146 **** XX <% hash = {}; (references || []).each do |ref| %><%= reference_format_embl(ref, hash) %> ! <% end %>FH Key Location/Qualifiers FH <%= format_features_embl(features || []) %>XX --- 172,181 ---- XX <% hash = {}; (references || []).each do |ref| %><%= reference_format_embl(ref, hash) %> ! <% end %><% (dblinks || []).each do |r| ! %>DR <%= r.database %>; <%= r.id %><% unless r.secondary_ids.empty? %>; <%= r.secondary_ids[0] %><% end %>. ! <% end %><% if dblinks and !dblinks.empty? then ! %>XX ! <% end %><%= comments_format_embl(comments) ! %>FH Key Location/Qualifiers FH <%= format_features_embl(features || []) %>XX From ngoto at dev.open-bio.org Tue Jun 17 12:09:55 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Tue, 17 Jun 2008 16:09:55 +0000 Subject: [BioRuby-cvs] bioruby/test/unit/bio/db/embl test_embl_to_bioseq.rb, 1.1.2.1, 1.1.2.2 Message-ID: <200806171609.m5HG9tFR021392@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/test/unit/bio/db/embl In directory dev.open-bio.org:/tmp/cvs-serv21372/test/unit/bio/db/embl Modified Files: Tag: BRANCH-biohackathon2008 test_embl_to_bioseq.rb Log Message: Unit test related to Bio::Sequence#date_created and date_modified are changed because these methods are changed to store Date (or Time or DateTime) objects instead of String objects. Index: test_embl_to_bioseq.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/test/unit/bio/db/embl/Attic/test_embl_to_bioseq.rb,v retrieving revision 1.1.2.1 retrieving revision 1.1.2.2 diff -C2 -d -r1.1.2.1 -r1.1.2.2 *** test_embl_to_bioseq.rb 20 Feb 2008 09:56:22 -0000 1.1.2.1 --- test_embl_to_bioseq.rb 17 Jun 2008 16:09:53 -0000 1.1.2.2 *************** *** 53,59 **** end ! def test_dates ! assert_equal('25-OCT-2002 (Rel. 73, Created)', @bio_seq.date_created) ! assert_equal('14-NOV-2006 (Rel. 89, Last updated, Version 3)', @bio_seq.date_modified) end --- 53,76 ---- end ! def test_date_created ! # '25-OCT-2002 (Rel. 73, Created)' ! assert_equal(Date.parse('25-OCT-2002'), @bio_seq.date_created) ! end ! ! def test_date_modified ! # '14-NOV-2006 (Rel. 89, Last updated, Version 3)' ! assert_equal(Date.parse('14-NOV-2006'), @bio_seq.date_modified) ! end ! ! def test_release_created ! assert_equal('73', @bio_seq.release_created) ! end ! ! def test_release_modified ! assert_equal('89', @bio_seq.release_modified) ! end ! ! def test_entry_version ! assert_equal('3', @bio_seq.entry_version) end *************** *** 129,135 **** end ! def test_dates ! assert_equal('25-OCT-2002 (Rel. 73, Created)', @bio_seq_2.date_created) ! assert_equal('14-NOV-2006 (Rel. 89, Last updated, Version 3)', @bio_seq_2.date_modified) end --- 146,169 ---- end ! def test_date_created ! # '25-OCT-2002 (Rel. 73, Created)' ! assert_equal(Date.parse('25-OCT-2002'), @bio_seq_2.date_created) ! end ! ! def test_date_modified ! # '14-NOV-2006 (Rel. 89, Last updated, Version 3)' ! assert_equal(Date.parse('14-NOV-2006'), @bio_seq_2.date_modified) ! end ! ! def test_release_created ! assert_equal('73', @bio_seq_2.release_created) ! end ! ! def test_release_modified ! assert_equal('89', @bio_seq_2.release_modified) ! end ! ! def test_entry_version ! assert_equal('3', @bio_seq_2.entry_version) end From ngoto at dev.open-bio.org Thu Jun 19 08:45:18 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Thu, 19 Jun 2008 12:45:18 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio/db/embl format_embl.rb, 1.1.2.6, 1.1.2.7 Message-ID: <200806191245.m5JCjIps000652@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio/db/embl In directory dev.open-bio.org:/tmp/cvs-serv596/lib/bio/db/embl Modified Files: Tag: BRANCH-biohackathon2008 format_embl.rb Log Message: avoid error when keywords or classification is nil Index: format_embl.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/db/embl/Attic/format_embl.rb,v retrieving revision 1.1.2.6 retrieving revision 1.1.2.7 diff -C2 -d -r1.1.2.6 -r1.1.2.7 *** format_embl.rb 17 Jun 2008 16:06:04 -0000 1.1.2.6 --- format_embl.rb 19 Jun 2008 12:45:15 -0000 1.1.2.7 *************** *** 166,173 **** <%= embl_wrap('DE ', definition) %> XX ! <%= embl_wrap('KW ', keywords.join('; ') + '.') %> XX OS <%= species %> ! <%= embl_wrap('OC ', classification.join('; ') + '.') %> XX <% hash = {}; (references || []).each do |ref| %><%= reference_format_embl(ref, hash) %> --- 166,173 ---- <%= embl_wrap('DE ', definition) %> XX ! <%= embl_wrap('KW ', (keywords || []).join('; ') + '.') %> XX OS <%= species %> ! <%= embl_wrap('OC ', (classification || []).join('; ') + '.') %> XX <% hash = {}; (references || []).each do |ref| %><%= reference_format_embl(ref, hash) %> From ngoto at dev.open-bio.org Fri Jun 20 09:22:34 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Fri, 20 Jun 2008 13:22:34 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio/db fasta.rb,1.28,1.28.2.1 Message-ID: <200806201322.m5KDMYOR021703@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio/db In directory dev.open-bio.org:/tmp/cvs-serv21681 Modified Files: Tag: BRANCH-biohackathon2008 fasta.rb Log Message: Split Bio::FastaDefline class into lib/bio/db/fasta/defline.rb Index: fasta.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/db/fasta.rb,v retrieving revision 1.28 retrieving revision 1.28.2.1 diff -C2 -d -r1.28 -r1.28.2.1 *** fasta.rb 5 Apr 2007 23:35:40 -0000 1.28 --- fasta.rb 20 Jun 2008 13:22:31 -0000 1.28.2.1 *************** *** 15,57 **** # == Examples # ! # rub = Bio::FastaDefline.new('>gi|671595|emb|CAA85678.1| rubisco large subunit [Perovskia abrotanoides]') ! # rub.entry_id ==> 'gi|671595' ! # rub.get('emb') ==> 'CAA85678.1' ! # rub.emb ==> 'CAA85678.1' ! # rub.gi ==> '671595' ! # rub.accession ==> 'CAA85678' ! # rub.accessions ==> [ 'CAA85678' ] ! # rub.acc_version ==> 'CAA85678.1' ! # rub.locus ==> nil ! # rub.list_ids ==> [["gi", "671595"], ! # ["emb", "CAA85678.1", nil], ! # ["Perovskia abrotanoides"]] ! # ! # ckr = Bio::FastaDefline.new(">gi|2495000|sp|Q63931|CCKR_CAVPO CHOLECYSTOKININ TYPE A RECEPTOR (CCK-A RECEPTOR) (CCK-AR)\001gi|2147182|pir||I51898 cholecystokinin A receptor - guinea pig\001gi|544724|gb|AAB29504.1| cholecystokinin A receptor; CCK-A receptor [Cavia]") ! # ckr.entry_id ==> "gi|2495000" ! # ckr.sp ==> "CCKR_CAVPO" ! # ckr.pir ==> "I51898" ! # ckr.gb ==> "AAB29504.1" ! # ckr.gi ==> "2495000" ! # ckr.accession ==> "AAB29504" ! # ckr.accessions ==> ["Q63931", "AAB29504"] ! # ckr.acc_version ==> "AAB29504.1" ! # ckr.locus ==> nil ! # ckr.description ==> ! # "CHOLECYSTOKININ TYPE A RECEPTOR (CCK-A RECEPTOR) (CCK-AR)" ! # ckr.descriptions ==> ! # ["CHOLECYSTOKININ TYPE A RECEPTOR (CCK-A RECEPTOR) (CCK-AR)", ! # "cholecystokinin A receptor - guinea pig", ! # "cholecystokinin A receptor; CCK-A receptor [Cavia]"] ! # ckr.words ==> ! # ["cavia", "cck-a", "cck-ar", "cholecystokinin", "guinea", "pig", ! # "receptor", "type"] ! # ckr.id_strings ==> ! # ["2495000", "Q63931", "CCKR_CAVPO", "2147182", "I51898", ! # "544724", "AAB29504.1", "Cavia"] ! # ckr.list_ids ==> ! # [["gi", "2495000"], ["sp", "Q63931", "CCKR_CAVPO"], ! # ["gi", "2147182"], ["pir", nil, "I51898"], ["gi", "544724"], ! # ["gb", "AAB29504.1", nil], ["Cavia"]] # # == References --- 15,19 ---- # == Examples # ! # See documents of Bio::FastaFormat class. # # == References *************** *** 66,69 **** --- 28,32 ---- require 'bio/db' require 'bio/sequence' + require 'bio/db/fasta/defline' module Bio *************** *** 363,825 **** end #class FastaNumericFormat - - # Parsing FASTA Defline, and extract IDs and other informations. - # IDs are NSIDs (NCBI standard FASTA sequence identifiers) - # or ":"-separated IDs. - # - # specs are described in: - # ftp://ftp.ncbi.nih.gov/blast/documents/README.formatdb - # http://blast.wustl.edu/doc/FAQ-Indexing.html#Identifiers - # - # === Examples - # - # rub = Bio::FastaDefline.new('>gi|671595|emb|CAA85678.1| rubisco large subunit [Perovskia abrotanoides]') - # rub.entry_id ==> 'gi|671595' - # rub.get('emb') ==> 'CAA85678.1' - # rub.emb ==> 'CAA85678.1' - # rub.gi ==> '671595' - # rub.accession ==> 'CAA85678' - # rub.accessions ==> [ 'CAA85678' ] - # rub.acc_version ==> 'CAA85678.1' - # rub.locus ==> nil - # rub.list_ids ==> [["gi", "671595"], - # ["emb", "CAA85678.1", nil], - # ["Perovskia abrotanoides"]] - # - # ckr = Bio::FastaDefline.new(">gi|2495000|sp|Q63931|CCKR_CAVPO CHOLECYSTOKININ TYPE A RECEPTOR (CCK-A RECEPTOR) (CCK-AR)\001gi|2147182|pir||I51898 cholecystokinin A receptor - guinea pig\001gi|544724|gb|AAB29504.1| cholecystokinin A receptor; CCK-A receptor [Cavia]") - # ckr.entry_id ==> "gi|2495000" - # ckr.sp ==> "CCKR_CAVPO" - # ckr.pir ==> "I51898" - # ckr.gb ==> "AAB29504.1" - # ckr.gi ==> "2495000" - # ckr.accession ==> "AAB29504" - # ckr.accessions ==> ["Q63931", "AAB29504"] - # ckr.acc_version ==> "AAB29504.1" - # ckr.locus ==> nil - # ckr.description ==> - # "CHOLECYSTOKININ TYPE A RECEPTOR (CCK-A RECEPTOR) (CCK-AR)" - # ckr.descriptions ==> - # ["CHOLECYSTOKININ TYPE A RECEPTOR (CCK-A RECEPTOR) (CCK-AR)", - # "cholecystokinin A receptor - guinea pig", - # "cholecystokinin A receptor; CCK-A receptor [Cavia]"] - # ckr.words ==> - # ["cavia", "cck-a", "cck-ar", "cholecystokinin", "guinea", "pig", - # "receptor", "type"] - # ckr.id_strings ==> - # ["2495000", "Q63931", "CCKR_CAVPO", "2147182", "I51898", - # "544724", "AAB29504.1", "Cavia"] - # ckr.list_ids ==> - # [["gi", "2495000"], ["sp", "Q63931", "CCKR_CAVPO"], - # ["gi", "2147182"], ["pir", nil, "I51898"], ["gi", "544724"], - # ["gb", "AAB29504.1", nil], ["Cavia"]] - # - # === Refereneces - # - # * Fasta format description (NCBI) - # http://www.ncbi.nlm.nih.gov/BLAST/fasta.shtml - # - # * Frequently Asked Questions: Indexing of Sequence Identifiers (by Warren R. Gish.) - # http://blast.wustl.edu/doc/FAQ-Indexing.html#Identifiers - # - # * README.formatdb - # ftp://ftp.ncbi.nih.gov/blast/documents/README.formatdb - # - class FastaDefline - - NSIDs = { - # NCBI and WU-BLAST - 'gi' => [ 'gi' ], # NCBI GI - 'gb' => [ 'acc_version', 'locus' ], # GenBank - 'emb' => [ 'acc_version', 'locus' ], # EMBL - 'dbj' => [ 'acc_version', 'locus' ], # DDBJ - 'sp' => [ 'accession', 'entry_id' ], # SWISS-PROT - 'pdb' => [ 'entry_id', 'chain' ], # PDB - 'bbs' => [ 'number' ], # GenInfo Backbone Id - 'gnl' => [ 'database' , 'entry_id' ], # General database identifier - 'ref' => [ 'acc_version' , 'locus' ], # NCBI Reference Sequence - 'lcl' => [ 'entry_id' ], # Local Sequence identifier - - # WU-BLAST and NCBI - 'pir' => [ 'accession', 'entry_id' ], # PIR - 'prf' => [ 'accession', 'entry_id' ], # Protein Research Foundation - 'pat' => [ 'country', 'number', 'serial' ], # Patents - - # WU-BLAST only - 'bbm' => [ 'number' ], # NCBI GenInfo Backbone database identifier - 'gim' => [ 'number' ], # NCBI GenInfo Import identifier - 'gp' => [ 'acc_version', 'locus' ], # GenPept - 'oth' => [ 'accession', 'name', 'release' ], # Other (user-definable) identifier - 'tpd' => [ 'accession', 'name' ], # Third party annotation, DDBJ - 'tpe' => [ 'accession', 'name' ], # Third party annotation, EMBL - 'tpg' => [ 'accession', 'name' ], # Third party annotation, GenBank - - # Original - 'ri' => [ 'entry_id', 'rearray_id', 'len' ], # RIKEN FANTOM DB - } - - # Shows array that contains IDs (or ID-like strings). - # Returns an array of arrays of strings. - attr_reader :list_ids - - # Shows a possibly unique identifier. - # Returns a string. - attr_reader :entry_id - - # Parses given string. - def initialize(str) - @deflines = [] - @info = {} - @list_ids = [] - - @entry_id = nil - - lines = str.split("\x01") - lines.each do |line| - add_defline(line) - end - end #def initialize - - # Parses given string and adds parsed data. - def add_defline(str) - case str - when /^\>?\s*((?:[^\|\s]*\|)+[^\s]+)\s*(.*)$/ - # NSIDs - # examples: - # >gi|9910844|sp|Q9UWG2|RL3_METVA 50S ribosomal protein L3P - # - # note: regexp (:?) means grouping without backreferences - i = $1 - d = $2 - tks = i.split('|') - tks << '' if i[-1,1] == '|' - a = parse_NSIDs(tks) - i = a[0].join('|') - a.unshift('|') - d = tks.join('|') + ' ' + d unless tks.empty? - a << d - this_line = a - match_EC(d) - parse_square_brackets(d).each do |x| - if !match_EC(x, false) and x =~ /\A[A-Z]/ then - di = [ x ] - @list_ids << di - @info['organism'] = x unless @info['organism'] - end - end - - when /^\>?\s*([a-zA-Z0-9]+\:[^\s]+)\s*(.*)$/ - # examples: - # >sce:YBR160W CDC28, SRM5; cyclin-dependent protein kinase catalytic subunit [EC:2.7.1.-] [SP:CC28_YEAST] - # >emb:CACDC28 [X80034] C.albicans CDC28 gene - i = $1 - d = $2 - a = parse_ColonSepID(i) - i = a.join(':') - this_line = [ ':', a , d ] - match_EC(d) - parse_square_brackets(d).each do |x| - if !match_EC(x, false) and x =~ /:/ then - parse_ColonSepID(x) - elsif x =~ /\A\s*([A-Z][A-Z0-9_\.]+)\s*\z/ then - @list_ids << [ $1 ] - end - end - - when /^\>?\s*(\S+)(?:\s+(.+))?$/ - # examples: - # >ABC12345 this is test - i = $1 - d = $2.to_s - @list_ids << [ i.chomp('.') ] - this_line = [ '', [ i ], d ] - match_EC(d) - else - i = str - d = '' - match_EC(i) - this_line = [ '', [ i ], d ] - end - - @deflines << this_line - @entry_id = i unless @entry_id - end - - def match_EC(str, write_flag = true) - di = nil - str.scan(/EC\:((:?[\-\d]+\.){3}(:?[\-\d]+))/i) do |x| - di = [ 'EC', $1 ] - if write_flag then - @info['ec'] = di[1] if (!@info['ec'] or @info['ec'].to_s =~ /\-/) - @list_ids << di - end - end - di - end - private :match_EC - - def parse_square_brackets(str) - r = [] - str.scan(/\[([^\]]*)\]/) do |x| - r << x[0] - end - r - end - private :parse_square_brackets - - def parse_ColonSepID(str) - di = str.split(':', 2) - di << nil if di.size <= 1 - @list_ids << di - di - end - private :parse_ColonSepID - - def parse_NSIDs(ary) - # this method destroys ary - data = [] - while token = ary.shift - if labels = self.class::NSIDs[token] then - di = [ token ] - idtype = token - labels.each do |x| - token = ary.shift - break unless token - if self.class::NSIDs[token] then - ary.unshift(token) - break #each - end - if token.length > 0 then - di << token - else - di << nil - end - end - data << di - else - if token.length > 0 then - # UCID (uncontrolled identifiers) - di = [ token ] - data << di - @info['ucid'] = token unless @info['ucid'] - end - break #while - end - end #while - @list_ids.concat data - data - end #def parse_NSIDs - private :parse_NSIDs - - - # Shows original string. - # Note that the result of this method may be different from - # original string which is given in FastaDefline.new method. - def to_s - @deflines.collect { |a| - s = a[0] - (a[1..-2].collect { |x| x.join(s) }.join(s) + ' ' + a[-1]).strip - }.join("\x01") - end - - # Shows description. - def description - @deflines[0].to_a[-1] - end - - # Returns descriptions. - def descriptions - @deflines.collect do |a| - a[-1] - end - end - - # Shows ID-like strings. - # Returns an array of strings. - def id_strings - r = [] - @list_ids.each do |a| - if a.size >= 2 then - r.concat a[1..-1].find_all { |x| x } - else - if a[0].to_s.size > 0 and a[0] =~ /\A[A-Za-z0-9\.\-\_]+\z/ - r << a[0] - end - end - end - r.concat( words(true, []).find_all do |x| - x =~ /\A[A-Z][A-Za-z0-9\_]*[0-9]+[A-Za-z0-9\_]+\z/ or - x =~ /\A[A-Z][A-Z0-9]*\_[A-Z0-9\_]+\z/ - end) - r - end - - KillWords = [ - 'an', 'the', 'this', 'that', - 'is', 'are', 'were', 'was', 'be', 'can', 'may', 'might', - 'as', 'at', 'by', 'for', 'in', 'of', 'on', 'to', 'with', - 'from', 'and', 'or', 'not', - 'dna', 'rna', 'mrna', 'cdna', 'orf', - 'aa', 'nt', 'pct', 'id', 'ec', 'sp', 'subsp', - 'similar', 'involved', 'identical', 'identity', - 'cds', 'clone', 'library', 'contig', 'contigs', - 'homolog', 'homologue', 'homologs', 'homologous', - 'protein', 'proteins', 'gene', 'genes', - 'product', 'products', 'sequence', 'sequences', - 'strain', 'strains', 'region', 'regions', - ] - KillWordsHash = {} - KillWords.each { |x| KillWordsHash[x] = true } - - KillRegexpArray = [ - /\A\d{1,3}\%?\z/, - /\A[A-Z][A-Za-z0-9\_]*[0-9]+[A-Za-z0-9\_]+\z/, - /\A[A-Z][A-Z0-9]*\_[A-Z0-9\_]+\z/ - ] - - # Shows words used in the defline. Returns an Array. - def words(case_sensitive = nil, kill_regexp = self.class::KillRegexpArray, - kwhash = self.class::KillWordsHash) - a = descriptions.join(' ').split(/[\.\,\;\:\(\)\[\]\{\}\<\>\"\'\`\~\/\|\?\!\&\@\#\s\x00-\x1f\x7f]+/) - a.collect! do |x| - x.sub!(/\A[\$\*\-\+]+/, '') - x.sub!(/[\$\*\-\=]+\z/, '') - if x.size <= 1 then - nil - elsif kwhash[x.downcase] then - nil - else - if kill_regexp.find { |expr| expr =~ x } then - nil - else - x - end - end - end - a.compact! - a.collect! { |x| x.downcase } unless case_sensitive - a.sort! - a.uniq! - a - end - - # Returns identifires by a database name. - def get(dbname) - db = dbname.to_s - r = nil - unless r = @info[db] then - di = @list_ids.find { |x| x[0] == db.to_s } - if di and di.size <= 2 then - r = di[-1] - elsif di then - labels = self.class::NSIDs[db] - [ 'acc_version', 'entry_id', - 'locus', 'accession', 'number'].each do |x| - if i = labels.index(x) then - r = di[i+1] - break if r - end - end - r = di[1..-1].find { |x| x } unless r - end - @info[db] = r if r - end - r - end - - # Returns an identifier by given type. - def get_by_type(type_str) - @list_ids.each do |x| - if labels = self.class::NSIDs[x[0]] then - if i = labels.index(type_str) then - return x[i+1] - end - end - end - nil - end - - # Returns identifiers by given type. - def get_all_by_type(*type_strarg) - d = [] - @list_ids.each do |x| - if labels = self.class::NSIDs[x[0]] then - type_strarg.each do |y| - if i = labels.index(y) then - d << x[i+1] if x[i+1] - end - end - end - end - d - end - - # Shows locus. - # If the entry has more than two of such IDs, - # only the first ID are shown. - # Returns a string or nil. - def locus - unless defined?(@locus) - @locus = get_by_type('locus') - end - @locus - end - - # Shows GI. - # If the entry has more than two of such IDs, - # only the first ID are shown. - # Returns a string or nil. - def gi - unless defined?(@gi) then - @gi = get_by_type('gi') - end - @gi - end - - # Shows accession with version number. - # If the entry has more than two of such IDs, - # only the first ID are shown. - # Returns a string or nil. - def acc_version - unless defined?(@acc_version) then - @acc_version = get_by_type('acc_version') - end - @acc_version - end - - # Shows accession numbers. - # Returns an array of strings. - def accessions - unless defined?(@accessions) then - @accessions = get_all_by_type('accession', 'acc_version') - @accessions.collect! { |x| x.sub(/\..*\z/, '') } - end - @accessions - end - - # Shows an accession number. - def accession - unless defined?(@accession) then - if acc_version then - @accession = acc_version.split('.')[0] - else - @accession = accessions[0] - end - end - @accession - end - - def method_missing(name, *args) - # raise ArgumentError, - # "wrong # of arguments(#{args.size} for 1)" if args.size >= 2 - r = get(name, *args) - if !r and !(self.class::NSIDs[name.to_s]) then - raise "NameError: undefined method `#{name.inspect}'" - end - r - end - - - end #class FastaDefline - end #module Bio --- 326,329 ---- From ngoto at dev.open-bio.org Fri Jun 20 09:22:34 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Fri, 20 Jun 2008 13:22:34 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio/db/fasta defline.rb,NONE,1.1.2.1 Message-ID: <200806201322.m5KDMYlh021706@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio/db/fasta In directory dev.open-bio.org:/tmp/cvs-serv21681/fasta Added Files: Tag: BRANCH-biohackathon2008 defline.rb Log Message: Split Bio::FastaDefline class into lib/bio/db/fasta/defline.rb --- NEW FILE: defline.rb --- # # = bio/db/fasta/defline.rb - FASTA defline parser class # # Copyright:: Copyright (C) 2001, 2002 # GOTO Naohisa , # Toshiaki Katayama # License:: The Ruby License # # $Id: defline.rb,v 1.1.2.1 2008/06/20 13:22:32 ngoto Exp $ # # == Description # # Bio::FastaDefline is a parser class for definition line (defline) # of the FASTA format. # # == Examples # # rub = Bio::FastaDefline.new('>gi|671595|emb|CAA85678.1| rubisco large subunit [Perovskia abrotanoides]') # rub.entry_id ==> 'gi|671595' # rub.get('emb') ==> 'CAA85678.1' # rub.emb ==> 'CAA85678.1' # rub.gi ==> '671595' # rub.accession ==> 'CAA85678' # rub.accessions ==> [ 'CAA85678' ] # rub.acc_version ==> 'CAA85678.1' # rub.locus ==> nil # rub.list_ids ==> [["gi", "671595"], # ["emb", "CAA85678.1", nil], # ["Perovskia abrotanoides"]] # # ckr = Bio::FastaDefline.new(">gi|2495000|sp|Q63931|CCKR_CAVPO CHOLECYSTOKININ TYPE A RECEPTOR (CCK-A RECEPTOR) (CCK-AR)\001gi|2147182|pir||I51898 cholecystokinin A receptor - guinea pig\001gi|544724|gb|AAB29504.1| cholecystokinin A receptor; CCK-A receptor [Cavia]") # ckr.entry_id ==> "gi|2495000" # ckr.sp ==> "CCKR_CAVPO" # ckr.pir ==> "I51898" # ckr.gb ==> "AAB29504.1" # ckr.gi ==> "2495000" # ckr.accession ==> "AAB29504" # ckr.accessions ==> ["Q63931", "AAB29504"] # ckr.acc_version ==> "AAB29504.1" # ckr.locus ==> nil # ckr.description ==> # "CHOLECYSTOKININ TYPE A RECEPTOR (CCK-A RECEPTOR) (CCK-AR)" # ckr.descriptions ==> # ["CHOLECYSTOKININ TYPE A RECEPTOR (CCK-A RECEPTOR) (CCK-AR)", # "cholecystokinin A receptor - guinea pig", # "cholecystokinin A receptor; CCK-A receptor [Cavia]"] # ckr.words ==> # ["cavia", "cck-a", "cck-ar", "cholecystokinin", "guinea", "pig", # "receptor", "type"] # ckr.id_strings ==> # ["2495000", "Q63931", "CCKR_CAVPO", "2147182", "I51898", # "544724", "AAB29504.1", "Cavia"] # ckr.list_ids ==> # [["gi", "2495000"], ["sp", "Q63931", "CCKR_CAVPO"], # ["gi", "2147182"], ["pir", nil, "I51898"], ["gi", "544724"], # ["gb", "AAB29504.1", nil], ["Cavia"]] # # == References # # * FASTA format (WikiPedia) # http://en.wikipedia.org/wiki/FASTA_format # # * Fasta format description (NCBI) # http://www.ncbi.nlm.nih.gov/BLAST/fasta.shtml # module Bio #-- # split from fasta.rb revision 1.28 #++ # Parsing FASTA Defline, and extract IDs and other informations. # IDs are NSIDs (NCBI standard FASTA sequence identifiers) # or ":"-separated IDs. # # specs are described in: # ftp://ftp.ncbi.nih.gov/blast/documents/README.formatdb # http://blast.wustl.edu/doc/FAQ-Indexing.html#Identifiers # # === Examples # # rub = Bio::FastaDefline.new('>gi|671595|emb|CAA85678.1| rubisco large subunit [Perovskia abrotanoides]') # rub.entry_id ==> 'gi|671595' # rub.get('emb') ==> 'CAA85678.1' # rub.emb ==> 'CAA85678.1' # rub.gi ==> '671595' # rub.accession ==> 'CAA85678' # rub.accessions ==> [ 'CAA85678' ] # rub.acc_version ==> 'CAA85678.1' # rub.locus ==> nil # rub.list_ids ==> [["gi", "671595"], # ["emb", "CAA85678.1", nil], # ["Perovskia abrotanoides"]] # # ckr = Bio::FastaDefline.new(">gi|2495000|sp|Q63931|CCKR_CAVPO CHOLECYSTOKININ TYPE A RECEPTOR (CCK-A RECEPTOR) (CCK-AR)\001gi|2147182|pir||I51898 cholecystokinin A receptor - guinea pig\001gi|544724|gb|AAB29504.1| cholecystokinin A receptor; CCK-A receptor [Cavia]") # ckr.entry_id ==> "gi|2495000" # ckr.sp ==> "CCKR_CAVPO" # ckr.pir ==> "I51898" # ckr.gb ==> "AAB29504.1" # ckr.gi ==> "2495000" # ckr.accession ==> "AAB29504" # ckr.accessions ==> ["Q63931", "AAB29504"] # ckr.acc_version ==> "AAB29504.1" # ckr.locus ==> nil # ckr.description ==> # "CHOLECYSTOKININ TYPE A RECEPTOR (CCK-A RECEPTOR) (CCK-AR)" # ckr.descriptions ==> # ["CHOLECYSTOKININ TYPE A RECEPTOR (CCK-A RECEPTOR) (CCK-AR)", # "cholecystokinin A receptor - guinea pig", # "cholecystokinin A receptor; CCK-A receptor [Cavia]"] # ckr.words ==> # ["cavia", "cck-a", "cck-ar", "cholecystokinin", "guinea", "pig", # "receptor", "type"] # ckr.id_strings ==> # ["2495000", "Q63931", "CCKR_CAVPO", "2147182", "I51898", # "544724", "AAB29504.1", "Cavia"] # ckr.list_ids ==> # [["gi", "2495000"], ["sp", "Q63931", "CCKR_CAVPO"], # ["gi", "2147182"], ["pir", nil, "I51898"], ["gi", "544724"], # ["gb", "AAB29504.1", nil], ["Cavia"]] # # === Refereneces # # * Fasta format description (NCBI) # http://www.ncbi.nlm.nih.gov/BLAST/fasta.shtml # # * Frequently Asked Questions: Indexing of Sequence Identifiers (by Warren R. Gish.) # http://blast.wustl.edu/doc/FAQ-Indexing.html#Identifiers # # * README.formatdb # ftp://ftp.ncbi.nih.gov/blast/documents/README.formatdb # class FastaDefline NSIDs = { # NCBI and WU-BLAST 'gi' => [ 'gi' ], # NCBI GI 'gb' => [ 'acc_version', 'locus' ], # GenBank 'emb' => [ 'acc_version', 'locus' ], # EMBL 'dbj' => [ 'acc_version', 'locus' ], # DDBJ 'sp' => [ 'accession', 'entry_id' ], # SWISS-PROT 'pdb' => [ 'entry_id', 'chain' ], # PDB 'bbs' => [ 'number' ], # GenInfo Backbone Id 'gnl' => [ 'database' , 'entry_id' ], # General database identifier 'ref' => [ 'acc_version' , 'locus' ], # NCBI Reference Sequence 'lcl' => [ 'entry_id' ], # Local Sequence identifier # WU-BLAST and NCBI 'pir' => [ 'accession', 'entry_id' ], # PIR 'prf' => [ 'accession', 'entry_id' ], # Protein Research Foundation 'pat' => [ 'country', 'number', 'serial' ], # Patents # WU-BLAST only 'bbm' => [ 'number' ], # NCBI GenInfo Backbone database identifier 'gim' => [ 'number' ], # NCBI GenInfo Import identifier 'gp' => [ 'acc_version', 'locus' ], # GenPept 'oth' => [ 'accession', 'name', 'release' ], # Other (user-definable) identifier 'tpd' => [ 'accession', 'name' ], # Third party annotation, DDBJ 'tpe' => [ 'accession', 'name' ], # Third party annotation, EMBL 'tpg' => [ 'accession', 'name' ], # Third party annotation, GenBank # Original 'ri' => [ 'entry_id', 'rearray_id', 'len' ], # RIKEN FANTOM DB } # Shows array that contains IDs (or ID-like strings). # Returns an array of arrays of strings. attr_reader :list_ids # Shows a possibly unique identifier. # Returns a string. attr_reader :entry_id # Parses given string. def initialize(str) @deflines = [] @info = {} @list_ids = [] @entry_id = nil lines = str.split("\x01") lines.each do |line| add_defline(line) end end #def initialize # Parses given string and adds parsed data. def add_defline(str) case str when /^\>?\s*((?:[^\|\s]*\|)+[^\s]+)\s*(.*)$/ # NSIDs # examples: # >gi|9910844|sp|Q9UWG2|RL3_METVA 50S ribosomal protein L3P # # note: regexp (:?) means grouping without backreferences i = $1 d = $2 tks = i.split('|') tks << '' if i[-1,1] == '|' a = parse_NSIDs(tks) i = a[0].join('|') a.unshift('|') d = tks.join('|') + ' ' + d unless tks.empty? a << d this_line = a match_EC(d) parse_square_brackets(d).each do |x| if !match_EC(x, false) and x =~ /\A[A-Z]/ then di = [ x ] @list_ids << di @info['organism'] = x unless @info['organism'] end end when /^\>?\s*([a-zA-Z0-9]+\:[^\s]+)\s*(.*)$/ # examples: # >sce:YBR160W CDC28, SRM5; cyclin-dependent protein kinase catalytic subunit [EC:2.7.1.-] [SP:CC28_YEAST] # >emb:CACDC28 [X80034] C.albicans CDC28 gene i = $1 d = $2 a = parse_ColonSepID(i) i = a.join(':') this_line = [ ':', a , d ] match_EC(d) parse_square_brackets(d).each do |x| if !match_EC(x, false) and x =~ /:/ then parse_ColonSepID(x) elsif x =~ /\A\s*([A-Z][A-Z0-9_\.]+)\s*\z/ then @list_ids << [ $1 ] end end when /^\>?\s*(\S+)(?:\s+(.+))?$/ # examples: # >ABC12345 this is test i = $1 d = $2.to_s @list_ids << [ i.chomp('.') ] this_line = [ '', [ i ], d ] match_EC(d) else i = str d = '' match_EC(i) this_line = [ '', [ i ], d ] end @deflines << this_line @entry_id = i unless @entry_id end def match_EC(str, write_flag = true) di = nil str.scan(/EC\:((:?[\-\d]+\.){3}(:?[\-\d]+))/i) do |x| di = [ 'EC', $1 ] if write_flag then @info['ec'] = di[1] if (!@info['ec'] or @info['ec'].to_s =~ /\-/) @list_ids << di end end di end private :match_EC def parse_square_brackets(str) r = [] str.scan(/\[([^\]]*)\]/) do |x| r << x[0] end r end private :parse_square_brackets def parse_ColonSepID(str) di = str.split(':', 2) di << nil if di.size <= 1 @list_ids << di di end private :parse_ColonSepID def parse_NSIDs(ary) # this method destroys ary data = [] while token = ary.shift if labels = self.class::NSIDs[token] then di = [ token ] idtype = token labels.each do |x| token = ary.shift break unless token if self.class::NSIDs[token] then ary.unshift(token) break #each end if token.length > 0 then di << token else di << nil end end data << di else if token.length > 0 then # UCID (uncontrolled identifiers) di = [ token ] data << di @info['ucid'] = token unless @info['ucid'] end break #while end end #while @list_ids.concat data data end #def parse_NSIDs private :parse_NSIDs # Shows original string. # Note that the result of this method may be different from # original string which is given in FastaDefline.new method. def to_s @deflines.collect { |a| s = a[0] (a[1..-2].collect { |x| x.join(s) }.join(s) + ' ' + a[-1]).strip }.join("\x01") end # Shows description. def description @deflines[0].to_a[-1] end # Returns descriptions. def descriptions @deflines.collect do |a| a[-1] end end # Shows ID-like strings. # Returns an array of strings. def id_strings r = [] @list_ids.each do |a| if a.size >= 2 then r.concat a[1..-1].find_all { |x| x } else if a[0].to_s.size > 0 and a[0] =~ /\A[A-Za-z0-9\.\-\_]+\z/ r << a[0] end end end r.concat( words(true, []).find_all do |x| x =~ /\A[A-Z][A-Za-z0-9\_]*[0-9]+[A-Za-z0-9\_]+\z/ or x =~ /\A[A-Z][A-Z0-9]*\_[A-Z0-9\_]+\z/ end) r end KillWords = [ 'an', 'the', 'this', 'that', 'is', 'are', 'were', 'was', 'be', 'can', 'may', 'might', 'as', 'at', 'by', 'for', 'in', 'of', 'on', 'to', 'with', 'from', 'and', 'or', 'not', 'dna', 'rna', 'mrna', 'cdna', 'orf', 'aa', 'nt', 'pct', 'id', 'ec', 'sp', 'subsp', 'similar', 'involved', 'identical', 'identity', 'cds', 'clone', 'library', 'contig', 'contigs', 'homolog', 'homologue', 'homologs', 'homologous', 'protein', 'proteins', 'gene', 'genes', 'product', 'products', 'sequence', 'sequences', 'strain', 'strains', 'region', 'regions', ] KillWordsHash = {} KillWords.each { |x| KillWordsHash[x] = true } KillRegexpArray = [ /\A\d{1,3}\%?\z/, /\A[A-Z][A-Za-z0-9\_]*[0-9]+[A-Za-z0-9\_]+\z/, /\A[A-Z][A-Z0-9]*\_[A-Z0-9\_]+\z/ ] # Shows words used in the defline. Returns an Array. def words(case_sensitive = nil, kill_regexp = self.class::KillRegexpArray, kwhash = self.class::KillWordsHash) a = descriptions.join(' ').split(/[\.\,\;\:\(\)\[\]\{\}\<\>\"\'\`\~\/\|\?\!\&\@\#\s\x00-\x1f\x7f]+/) a.collect! do |x| x.sub!(/\A[\$\*\-\+]+/, '') x.sub!(/[\$\*\-\=]+\z/, '') if x.size <= 1 then nil elsif kwhash[x.downcase] then nil else if kill_regexp.find { |expr| expr =~ x } then nil else x end end end a.compact! a.collect! { |x| x.downcase } unless case_sensitive a.sort! a.uniq! a end # Returns identifires by a database name. def get(dbname) db = dbname.to_s r = nil unless r = @info[db] then di = @list_ids.find { |x| x[0] == db.to_s } if di and di.size <= 2 then r = di[-1] elsif di then labels = self.class::NSIDs[db] [ 'acc_version', 'entry_id', 'locus', 'accession', 'number'].each do |x| if i = labels.index(x) then r = di[i+1] break if r end end r = di[1..-1].find { |x| x } unless r end @info[db] = r if r end r end # Returns an identifier by given type. def get_by_type(type_str) @list_ids.each do |x| if labels = self.class::NSIDs[x[0]] then if i = labels.index(type_str) then return x[i+1] end end end nil end # Returns identifiers by given type. def get_all_by_type(*type_strarg) d = [] @list_ids.each do |x| if labels = self.class::NSIDs[x[0]] then type_strarg.each do |y| if i = labels.index(y) then d << x[i+1] if x[i+1] end end end end d end # Shows locus. # If the entry has more than two of such IDs, # only the first ID are shown. # Returns a string or nil. def locus unless defined?(@locus) @locus = get_by_type('locus') end @locus end # Shows GI. # If the entry has more than two of such IDs, # only the first ID are shown. # Returns a string or nil. def gi unless defined?(@gi) then @gi = get_by_type('gi') end @gi end # Shows accession with version number. # If the entry has more than two of such IDs, # only the first ID are shown. # Returns a string or nil. def acc_version unless defined?(@acc_version) then @acc_version = get_by_type('acc_version') end @acc_version end # Shows accession numbers. # Returns an array of strings. def accessions unless defined?(@accessions) then @accessions = get_all_by_type('accession', 'acc_version') @accessions.collect! { |x| x.sub(/\..*\z/, '') } end @accessions end # Shows an accession number. def accession unless defined?(@accession) then if acc_version then @accession = acc_version.split('.')[0] else @accession = accessions[0] end end @accession end def method_missing(name, *args) # raise ArgumentError, # "wrong # of arguments(#{args.size} for 1)" if args.size >= 2 r = get(name, *args) if !r and !(self.class::NSIDs[name.to_s]) then raise "NameError: undefined method `#{name.inspect}'" end r end end #class FastaDefline end #module Bio From ngoto at dev.open-bio.org Fri Jun 20 09:30:16 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Fri, 20 Jun 2008 13:30:16 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio/db fasta.rb,1.28.2.1,1.28.2.2 Message-ID: <200806201330.m5KDUGds021895@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio/db In directory dev.open-bio.org:/tmp/cvs-serv21857 Modified Files: Tag: BRANCH-biohackathon2008 fasta.rb Log Message: Here-document separater string in example is changed to aviod confusion about "END" which is also a reserved word in Ruby. Index: fasta.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/db/fasta.rb,v retrieving revision 1.28.2.1 retrieving revision 1.28.2.2 diff -C2 -d -r1.28.2.1 -r1.28.2.2 *** fasta.rb 20 Jun 2008 13:22:31 -0000 1.28.2.1 --- fasta.rb 20 Jun 2008 13:30:14 -0000 1.28.2.2 *************** *** 3,7 **** # # Copyright:: Copyright (C) 2001, 2002 ! # GOTO Naohisa , # Toshiaki Katayama # License:: The Ruby License --- 3,7 ---- # # Copyright:: Copyright (C) 2001, 2002 ! # Naohisa Goto , # Toshiaki Katayama # License:: The Ruby License *************** *** 45,49 **** # === Examples # ! # f_str = <sce:YBR160W CDC28, SRM5; cyclin-dependent protein kinase catalytic subunit [EC:2.7.1.-] [SP:CC28_YEAST] # MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEG --- 45,49 ---- # === Examples # ! # f_str = <sce:YBR160W CDC28, SRM5; cyclin-dependent protein kinase catalytic subunit [EC:2.7.1.-] [SP:CC28_YEAST] # MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEG *************** *** 65,69 **** # FERLCELLGYDNVFPLIINIKTKSNGGYQLCGSISIIKIEEELKSVGFER # KTGDPLEWRRLFKKISTICRDIILIPN ! # END # # f = Bio::FastaFormat.new(f_str) --- 65,69 ---- # FERLCELLGYDNVFPLIINIKTKSNGGYQLCGSISIIKIEEELKSVGFER # KTGDPLEWRRLFKKISTICRDIILIPN ! # END_OF_STRING # # f = Bio::FastaFormat.new(f_str) From ngoto at dev.open-bio.org Fri Jun 20 09:43:38 2008 From: ngoto at dev.open-bio.org (Naohisa Goto) Date: Fri, 20 Jun 2008 13:43:38 +0000 Subject: [BioRuby-cvs] bioruby/lib/bio/db fasta.rb,1.28.2.2,1.28.2.3 Message-ID: <200806201343.m5KDhcUr021965@dev.open-bio.org> Update of /home/repository/bioruby/bioruby/lib/bio/db In directory dev.open-bio.org:/tmp/cvs-serv21945 Modified Files: Tag: BRANCH-biohackathon2008 fasta.rb Log Message: Bio::FastaFormat#to_seq is renamed to to_biosequence with improvement. The "to_seq" method is now an alias of to_biosequence. Index: fasta.rb =================================================================== RCS file: /home/repository/bioruby/bioruby/lib/bio/db/fasta.rb,v retrieving revision 1.28.2.2 retrieving revision 1.28.2.3 diff -C2 -d -r1.28.2.2 -r1.28.2.3 *** fasta.rb 20 Jun 2008 13:30:14 -0000 1.28.2.2 --- fasta.rb 20 Jun 2008 13:43:36 -0000 1.28.2.3 *************** *** 28,31 **** --- 28,32 ---- require 'bio/db' require 'bio/sequence' + require 'bio/sequence/dblink' require 'bio/db/fasta/defline' *************** *** 217,226 **** # because of efficiency. # ! def to_seq seq obj = Bio::Sequence.new(@seq) ! obj.definition = self.definition obj end # Parsing FASTA Defline, and extract IDs. --- 218,243 ---- # because of efficiency. # ! def to_biosequence seq obj = Bio::Sequence.new(@seq) ! d = self.identifiers ! # accessions ! obj.primary_accession = d.accessions.first ! obj.secondary_accessions = d.accessions[1..-1] ! # entry_id ! obj.entry_id = d.locus unless d.locus.to_s.empty? ! # GI ! other = [] ! other.push Bio::Sequence::DBLink.new('GI', d.gi) if d.gi ! obj.other_seqids = other unless other.empty? ! # definition ! if d.accessions.empty? and other.empty? then ! obj.definition = self.definition ! else ! obj.definition = d.description ! end obj end + alias to_seq to_biosequence # Parsing FASTA Defline, and extract IDs.