[Bioperl-l] Should coords be adjusted after removing alignment columns?
Sendu Bala
bix at sendu.me.uk
Tue Aug 14 10:57:29 EDT 2007
I'm looking at what looks like a pretty major bug in Bio::SimpleAlign,
but before I commit the fix I wanted to check my sanity/understanding.
My understanding is that an alignment may be built from just sub-parts
of a number of sequences. So you give each sequence in the alignment a
start and stop so you can later map back the aligned region to the
original sequence. So, for example, the following should all pass:
diff -r1.56 SimpleAlign.t
459a460,540
>
>
> # is _remove_col really working correctly?
> my $a = Bio::LocatableSeq->new(-id => 'a', -seq =>
'atcgatcgatcgatcg', -start => 5, -end => 20);
> my $b = Bio::LocatableSeq->new(-id => 'b', -seq =>
'-tcgatc-atcgatcg', -start => 30, -end => 43);
> my $c = Bio::LocatableSeq->new(-id => 'c', -seq =>
'atcgatcgatc-atc-', -start => 50, -end => 63);
> my $d = Bio::LocatableSeq->new(-id => 'd', -seq =>
'--cgatcgatcgat--', -start => 80, -end => 91);
> my $e = Bio::LocatableSeq->new(-id => 'e', -seq =>
'-t-gatcgatcga-c-', -start => 100, -end => 111);
> $aln = Bio::SimpleAlign->new();
> $aln->add_seq($a);
> $aln->add_seq($b);
> $aln->add_seq($c);
>
> my $gapless = $aln->remove_gaps();
> foreach my $seq ($gapless->each_seq) {
> if ($seq->id eq 'a') {
> is $seq->start, 6;
> is $seq->end, 19;
> is $seq->seq, 'tcgatcatcatc';
> }
> elsif ($seq->id eq 'b') {
> is $seq->start, 30;
> is $seq->end, 42;
> is $seq->seq, 'tcgatcatcatc';
> }
> elsif ($seq->id eq 'c') {
> is $seq->start, 51;
> is $seq->end, 63;
> is $seq->seq, 'tcgatcatcatc';
> }
> }
>
> $aln->add_seq($d);
> $aln->add_seq($e);
> $gapless = $aln->remove_gaps();
> foreach my $seq ($gapless->each_seq) {
> if ($seq->id eq 'a') {
> is $seq->start, 8;
> is $seq->end, 17;
> is $seq->seq, 'gatcatca';
> }
> elsif ($seq->id eq 'b') {
> is $seq->start, 32;
> is $seq->end, 40;
> is $seq->seq, 'gatcatca';
> }
> elsif ($seq->id eq 'c') {
> is $seq->start, 53;
> is $seq->end, 61;
> is $seq->seq, 'gatcatca';
> }
> elsif ($seq->id eq 'd') {
> is $seq->start, 81;
> is $seq->end, 90;
> is $seq->seq, 'gatcatca';
> }
> elsif ($seq->id eq 'e') {
> is $seq->start, 101;
> is $seq->end, 110;
> is $seq->seq, 'gatcatca';
> }
> }
>
> my $f = Bio::LocatableSeq->new(-id => 'f', -seq =>
'a-cgatcgatcgat-g', -start => 30, -end => 43);
> $aln = Bio::SimpleAlign->new();
> $aln->add_seq($a);
> $aln->add_seq($f);
>
> $gapless = $aln->remove_gaps();
> foreach my $seq ($gapless->each_seq) {
> if ($seq->id eq 'a') {
> is $seq->start, 5;
> is $seq->end, 20;
> is $seq->seq, 'acgatcgatcgatg';
> }
> elsif ($seq->id eq 'f') {
> is $seq->start, 30;
> is $seq->end, 43;
> is $seq->seq, 'acgatcgatcgatg';
> }
> }
But they don't. Once you remove certain columns the start and stop of
the sequences in the alignment are no longer correct coordinates for the
sub-sequence in the original sequence.
I propose the following patch to resolve this issue:
diff -r1.136 SimpleAlign.pm
1116c1116,1118
<
---
>
> my $gap = $self->gap_char;
>
1129,1137c1131,1147
< my $spliced;
< $spliced .= $start > 0 ? substr($sequence,0,$start) : '';
< $spliced .= substr($sequence,$end+1,$seq->length-$end+1);
< $sequence = $spliced;
< if ($start == 1) {
< $new_seq->start($end);
< }
< else {
< $new_seq->start( $seq->start);
---
> my $orig = $sequence;
> my $head = $start > 0 ? substr($sequence, 0, $start) : '';
> my $tail = ($end + 1) >= length($sequence) ? '' :
substr($sequence, $end + 1);
> $sequence = $head.$tail;
> # start
> unless (defined $new_seq->start) {
> if ($start == 0) {
> my $start_adjust = () = substr($orig, 0, $end +
1) =~ /$gap/g;
> $new_seq->start($seq->start + $end + 1 -
$start_adjust);
> }
> else {
> my $start_adjust = $orig =~ /$gap+/;
> if ($start_adjust) {
> $start_adjust = $+[0] - 1 < $start;
> }
> $new_seq->start($seq->start + $start_adjust);
> }
1140,1141c1150,1152
< if($end >= $seq->end){
< $new_seq->end( $start);
---
> if (($end + 1) >= length($orig)) {
> my $end_adjust = () = substr($orig, $start) =~ /$gap/g;
> $new_seq->end($seq->end - (length($orig) - $start) +
$end_adjust);
1144c1155
< $new_seq->end($seq->end);
---
> $new_seq->end($seq->end);
1148c1159
< push @new, $new_seq;
---
> push @new, $new_seq;
1207,1209c1218,1234
< # sort the positions to remove columns at the end 1st
< @$positions = sort { $b->[0] <=> $a->[0] } @$positions;
< $aln = $self->_remove_col($aln,$positions);
---
> # sort the positions
> @$positions = sort { $a->[0] <=> $b->[0] } @$positions;
>
> my @remove;
> my $length = 0;
> foreach my $pos (@{$positions}) {
> my ($start, $end) = @{$pos};
>
> #have to offset the start and end for subsequent removes
> $start-=$length;
> $end -=$length;
> $length += ($end-$start+1);
> push @remove, [$start,$end];
> }
>
> #remove the segments
> $aln = $#remove >= 0 ? $self->_remove_col($aln,\@remove) : $self;
This breaks 2 tests in SimpleAlign.t, but as far as I can tell, those
tests expect the wrong answer. Changed to expect the correct answer,
SimpleAlign.t and all other tests in the test suite pass.
diff -r1.56 SimpleAlign.t
214,215c214,215
< "P84139/1-33 NEGEHQIKLDELFEKLLRARLIFKNKDVLRRC\n".
< "P814153/1-33 NEGMHQIKLDVLFEKLLRARLIFKNKDVLRRC\n".
---
> "P84139/2-33 NEGEHQIKLDELFEKLLRARLIFKNKDVLRRC\n".
> "P814153/2-33 NEGMHQIKLDVLFEKLLRARLIFKNKDVLRRC\n".
229c229
< "gb|443893|124775/1-32 -RFRIKVPPAVEGARPALLIFKSRPELGC\n",
---
> "gb|443893|124775/2-32 -RFRIKVPPAVEGARPALLIFKSRPELGC\n",
Can someone triple-check my thinking and report back please?
Cheers,
Sendu.
More information about the Bioperl-l
mailing list