[Bioperl-l] Blast information
Jason Stajich
jason at bioperl.org
Wed Oct 18 11:47:14 EDT 2006
I think this will work for you.
The seq_inds method parses the middle homology sequence and
classifies each alignment column and returns a list of the columns
meeting the criteria. You can interrogate query or hit in this case
since you are requiring it to be identical
my $identicalbases = scalar $hsp->seq_inds('query', 'identical');
my $conservedbases = scalar $hsp->seq_inds('query','conserved');
Conserved returns those identical or conserved, if you want just
those with conservative replacements use 'conserved-not-identical'
See http://bioperl.org/wiki/HOWTO:SearchIO#Table_of_Methods for more
info.
-jason
On Oct 18, 2006, at 8:16 AM, Kevin Brown wrote:
> I just recently upgraded to 1.5.1 on WinXP to bring this version
> closer
> to live to parse some locally created blast files. I'm trying to find
> the method that returns the values that are underneath the Identities
> and Positives information as I'm trying to replicate the output of an
> old blast parser we have here written in RealBasic which is showing
> its
> age. Once I have it replicating the old output I then intend to add
> more features in terms of filtering returned hits (like not returning
> self->self hits or a->b so don't show b->a).
>
> Example:
> I'm looking for the methods that will return 117 from identities
> and 117
> from positives. I can't just use num_identical/percent_identity as
> that
> isn't 100% accurate.
>
>> BurkM_2016
> Length = 241
>
> Score = 43.2 bits (88), Expect = 7e-005
> Identities = 26/117 (22%), Positives = 51/117 (43%)
>
> Query: 298
> QEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAIL
> 357
> Q F F + A+ ++ + + + L +R GL + P E +
> A+L
> Sbjct: 111
> QIALFNLFNEVRAHPMTALVVAGPAAPLALDVREDLRTRLGWGLVFHLAPLTDEGKAAVL
> 170
>
> Query: 358
> MRKAQSEGVSLSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHGREITIELTKEAL 414
> A+ G++L++DV ++ H R ++ L L + +S R +T+ L + L
> Sbjct: 171
> KHAAKERGIALADDVPSYLLTHFRRDMPSLMSLLDALDRFSLEQKRAVTLPLLRAML 227
>
> Thanks,
> Kevin
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l at lists.open-bio.org
> http://lists.open-bio.org/mailman/listinfo/bioperl-l
--
Jason Stajich, PhD
Miller Research Fellow
University of California
Dept of Plant and Microbial Biology
321 Koshland Hall #3102
Berkeley, CA 94720-3102
lab: 510.642.8441
http://pmb.berkeley.edu/~taylor/people/js.html
More information about the Bioperl-l
mailing list