From bmoore at genetics.utah.edu Thu Sep 1 13:33:40 2005 From: bmoore at genetics.utah.edu (Barry Moore) Date: Thu Sep 1 13:32:39 2005 Subject: [Bioperl-l] Bio::Search results Message-ID: Sean- The top of you input hmmpfam file has these four lines: hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) When I copied that out of you e-mail and into emacs on my computer I got it all as one line like this: hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) The parser needs to see a line beginning with HMMER to trigger setting an internal variable called _reporttype (among other things). Since this never happened with a single line header I got the same results you did. Your header lines look OK in the e-mail you sent me, but assuming you have the same problem with you header lines that I did, fixing that should lead you to your next problem... This line of your code has an error: next unless ($hsp->name =~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i); HSP objects don't have names but their associated hit objects do, so this makes your script work as intended: next unless ($hit->name =~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i); I wonder if the header line problems could be the result of cross platform cutting and pasting (or just cross platform file incompatibilities). I noticed also that in you script that you sent the '=' turned into '=3D'. What computer platforms do you use in your work? HTH Barry -----Original Message----- From: Sean O'Keeffe [mailto:limericksean@gmail.com] Sent: Tuesday, August 30, 2005 9:28 AM To: Barry Moore Cc: bioperl-l@portal.open-bio.org Subject: Re: [Bioperl-l] Bio::Search results Hi Barry, thanks for the reply. Below is a snippet of the file (I generated it with hmmpfam using the alignment flag set to -A 0, to remove alignments - this shouldn't affect the parsing of the file) : hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /usr/local/lib/pfam-tm Sequence file: Mus_musculus.NCBIM34.jul.pep.fa-short - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: ENSMUSP00000089702 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- [no hits above thresholds] Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- [no hits above thresholds] // Query sequence: ENSMUSP00000089701 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- [no hits above thresholds] Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- [no hits above thresholds] // Query sequence: ENSMUSP00000020094 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- LRR_1 Leucine Rich Repeat 55.0 3.7e-15 6 LRRNT Leucine rich repeat N-terminal domain 30.1 1.1e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- LRRNT 1/1 117 142 .. 1 34 [] 30.1 1.1e-07 LRR_1 1/6 168 191 .. 1 25 [] 14.7 0.0049 LRR_1 2/6 192 210 .. 1 25 [] 9.1 0.2 LRR_1 3/6 212 237 .. 1 25 [] 8.4 0.26 LRR_1 4/6 238 257 .. 1 25 [] 10.3 0.1 LRR_1 5/6 259 282 .. 1 25 [] 10.1 0.12 LRR_1 6/6 290 314 .. 1 25 [] 2.4 2 // Query sequence: ENSMUSP00000074175 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- CUB CUB domain 232.5 1.3e-68 2 Trypsin Trypsin 206.0 1.2e-60 1 Sushi Sushi domain (SCR repeat) 88.7 2.6e-25 2 EGF_CA Calcium binding EGF domain 29.4 1.8e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- CUB 1/2 16 137 .. 1 116 [] 70.0 1.1e-19 EGF_CA 1/1 141 188 .. 1 55 [] 29.4 1.8e-07 CUB 2/2 192 301 .. 1 116 [] 162.5 1.5e-47 Sushi 1/2 308 370 .. 1 62 [] 47.5 6.5e-13 Sushi 2/2 375 446 .. 1 62 [] 41.2 5.1e-11 Trypsin 1/1 463 698 .. 1 259 [] 206.0 1.2e-60 // Cheers, Sean. On 8/30/05, Barry Moore wrote: > Sean, > > Don't see anything obviously wrong. If you want to send your input > file, I'll try to recreate the problem. > > Barry > > -----Original Message----- > From: bioperl-l-bounces@portal.open-bio.org > [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Sean > O'Keeffe > Sent: Tuesday, August 30, 2005 2:55 AM > To: bioperl-l@portal.open-bio.org > Subject: [Bioperl-l] Bio::Search results > > Hi, > The following code snippet is something I use to extract information > from hmmer result files: > > use Bio::SearchIO; > > my $in =3D new Bio::SearchIO( -format =3D> 'hmmer', -file =3D> > $ARGV[0] ); while(my $result =3D $in->next_result) { > print $result->query_name(), "\n",$result->query_description(),"\n"; > while (my $hit =3D $result->next_hit) { > while(my $hsp =3D $hit->next_domain) { > next unless ($hsp->name =3D~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i); > print $hsp->start(),"\t",$hsp->end(),"\t",$hsp->evalue(),"\n"; > } > } > } > > The input file is generated by hmmpfam and is given at the command > line. I use it to scan for specific domain names e.g ig, fn3 lrr etc. > This code works for the first loop and then ends so I get the name and > description (no hsp values as their are none for this result): > > ENSMUSP00000065602=20 > pep:novel supercontig::NT_085813:405:1510:-1 gene:ENSMUSG00000054059 > transcript:ENSMUST00000066517 > > My question is why does the loop end after one instance. Incidentally > the outputted name and description above are the last ones in the > hmmer file (maybe the file is read from the back??? - don't know if > this means anything). Any thoughts would be appreciated. Thanks, > Sean. > > _______________________________________________ > Bioperl-l mailing list > Bioperl-l@portal.open-bio.org > http://portal.open-bio.org/mailman/listinfo/bioperl-l > From lupey+ at pitt.edu Thu Sep 1 14:58:31 2005 From: lupey+ at pitt.edu (Paul G Cantalupo) Date: Thu Sep 1 14:48:10 2005 Subject: [Bioperl-l] RemoteBlast save_output does not handle -m8 output correctly Message-ID: Hello, I'm using bioperl-1.4 and I noticed that RemoteBlast save_output method creates an empty file (zero bytes) when dealing with blast -m8 output (i.e. ALIGNMENT_VIEW = Tabular). Is there a fix for this? Thank you, Paul Paul Cantalupo Research Specialist/Systems Programmer 559 Crawford Hall Department of Biological Sciences University of Pittsburgh Pittsburgh, PA 15260 Work: 412-624-4687 Fax: 412-624-4759 Ask me about Toastmasters: www.toastmasters.org Midday Club Treasurer From jason.stajich at duke.edu Thu Sep 1 15:21:41 2005 From: jason.stajich at duke.edu (Jason Stajich) Date: Thu Sep 1 15:29:23 2005 Subject: [Bioperl-l] RemoteBlast save_output does not handle -m8 output correctly In-Reply-To: References: Message-ID: <98417FE2-9F48-4EC1-AA7B-9A2922EADB9D@duke.edu> You'll need to fix this logic which expects to see a BLAST HEADER before it starts writing. If someone post a patch we can apply the fix. while(my $l = ) { next if ($l =~ /
/);
                 if( $l =~ /^(?:[T]?BLAST[NPX])\s*.+$/i ||
                          $l =~/^RPS-BLAST\s*.+$/i ) {
                         $seentop=1;
                 }
                 next if !$seentop;
                 if( $seentop ) {
                         print SAVEOUT $l;
                 }
         }

On Sep 1, 2005, at 2:58 PM, Paul G Cantalupo wrote:

> Hello,
>
> I'm using bioperl-1.4 and I noticed that RemoteBlast save_output  
> method creates an empty file (zero bytes) when dealing with blast - 
> m8 output (i.e. ALIGNMENT_VIEW = Tabular). Is there a fix for this?
>
> Thank you,
>
> Paul
>
> Paul Cantalupo
> Research Specialist/Systems Programmer
> 559 Crawford Hall
> Department of Biological Sciences
> University of Pittsburgh
> Pittsburgh, PA 15260
> Work: 412-624-4687
> Fax: 412-624-4759
>
> Ask me about Toastmasters: www.toastmasters.org
> Midday Club Treasurer
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From lupey+ at pitt.edu  Thu Sep  1 15:52:26 2005
From: lupey+ at pitt.edu (Paul G Cantalupo)
Date: Thu Sep  1 21:13:52 2005
Subject: [Bioperl-l] RemoteBlast retrieve_blast cannot return
	Bio::SearchIO::blasttable
Message-ID: 

Hello,

When using RemoteBlast with ALIGNMENT_VIEW = 'Tabular' (-m8 output) the 
method 'retrieve_blast' should return a Bio::SearchIO::blasttable object 
to handle the parsing of -m8 output. I think the easiest way to do this is 
by changing 'retrieve_blast'

FROM:

if( $self->readmethod =~ /BPlite/ ) {
    $blastobj = new Bio::Tools::BPlite(-file => $tempfile);
} else {
    $blastobj = new Bio::SearchIO( -file => $tempfile,
                                   -format => 'blast');
}


TO:


if( $self->readmethod =~ /BPlite/ ) {
    $blastobj = new Bio::Tools::BPlite(-file => $tempfile);
} elsif( $self->readmethod =~ /blasttable/ ) {
    $blastobj = new Bio::SearchIO( -file => $tempfile,
                                   -format => 'blasttable');
} else {
    $blastobj = new Bio::SearchIO( -file => $tempfile,
                                   -format => 'blast');
}


Any suggestions/criticisms?

Paul


Paul Cantalupo
Research Specialist/Systems Programmer
559 Crawford Hall
Department of Biological Sciences
University of Pittsburgh
Pittsburgh, PA 15260
Work: 412-624-4687
Fax: 412-624-4759

Ask me about Toastmasters: www.toastmasters.org
Midday Club Treasurer
From bmoore at genetics.utah.edu  Thu Sep  1 22:23:54 2005
From: bmoore at genetics.utah.edu (Barry Moore)
Date: Thu Sep  1 22:12:38 2005
Subject: [Bioperl-l] Bio::Search results
Message-ID: 

Sean I see that my mailer messed up the line formatting also.  What I
meant was you should have the top four lines like this:

#Line 1: hmmpfam - search one or more sequences against HMM database 
#Line 2: HMMER 2.3.2(Oct 2003) 
#Line 3: Copyright (C) 1992-2003 HHMI/Washington University School of
#Line 4: Medicine Freely distributed under the GNU General Public
License (GPL)

If you have that, and fix the hsp to hit error mentioned it works for
me.

Barry

-----Original Message-----
From: bioperl-l-bounces@portal.open-bio.org
[mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Barry Moore
Sent: Thursday, September 01, 2005 11:34 AM
To: Bioperl List
Subject: RE: [Bioperl-l] Bio::Search results

Sean-

 

The top of you input hmmpfam file has these four lines:

 

hmmpfam - search one or more sequences against HMM database HMMER 2.3.2
(Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of
Medicine Freely distributed under the GNU General Public License (GPL)

 

When I copied that out of you e-mail and into emacs on my computer I got
it all as one line like this:

 

hmmpfam - search one or more sequences against HMM database HMMER 2.3.2
(Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of
Medicine Freely distributed under the GNU General Public License (GPL)

 

The parser needs to see a line beginning with HMMER to trigger setting
an internal variable called _reporttype (among other things).  Since
this never happened with a single line header I got the same results you
did.  Your header lines look OK in the e-mail you sent me, but assuming
you have the same problem with you header lines that I did, fixing that
should lead you to your next problem...

 

This line of your code has an error:

 

next unless ($hsp->name =~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i);

 

HSP objects don't have names but their associated hit objects do, so
this makes your script work as intended:

 

next unless ($hit->name =~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i);

 

I wonder if the header line problems could be the result of cross
platform cutting and pasting (or just cross platform file
incompatibilities).  I noticed also that in you script that you sent the
'=' turned into '=3D'.  What computer platforms do you use in your work?

 

HTH

 

Barry

 

-----Original Message-----

From: Sean O'Keeffe [mailto:limericksean@gmail.com] 

Sent: Tuesday, August 30, 2005 9:28 AM

To: Barry Moore

Cc: bioperl-l@portal.open-bio.org

Subject: Re: [Bioperl-l] Bio::Search results

 

Hi Barry, thanks for the reply. Below is a snippet of the file (I
generated it with hmmpfam using the alignment flag set to -A 0, to
remove alignments - this shouldn't affect the parsing of the file) :

 

hmmpfam - search one or more sequences against HMM database HMMER 2.3.2
(Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of
Medicine Freely distributed under the GNU General Public License (GPL)

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

HMM file:                 /usr/local/lib/pfam-tm

Sequence file:            Mus_musculus.NCBIM34.jul.pep.fa-short

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

 

Query sequence: ENSMUSP00000089702

Accession:      [none]

Description:    [none]

 

Scores for sequence family classification (score includes all domains):

Model    Description                                    Score    E-value
N 

-------- -----------                                    -----    -------
---

      [no hits above thresholds]

 

Parsed for domains:

Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value

-------- ------- ----- -----    ----- -----      -----  -------

      [no hits above thresholds]

//

 

Query sequence: ENSMUSP00000089701

Accession:      [none]

Description:    [none]

 

Scores for sequence family classification (score includes all domains):

Model    Description                                    Score    E-value
N 

-------- -----------                                    -----    -------
---

      [no hits above thresholds]

 

Parsed for domains:

Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value

-------- ------- ----- -----    ----- -----      -----  -------

      [no hits above thresholds]

//

 

Query sequence: ENSMUSP00000020094

Accession:      [none]

Description:    [none]

 

Scores for sequence family classification (score includes all domains):

Model    Description                                    Score    E-value
N 

-------- -----------                                    -----    -------
---

LRR_1    Leucine Rich Repeat                             55.0    3.7e-15
6

LRRNT    Leucine rich repeat N-terminal domain           30.1    1.1e-07
1

 

Parsed for domains:

Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value

-------- ------- ----- -----    ----- -----      -----  -------

LRRNT      1/1     117   142 ..     1    34 []    30.1  1.1e-07

LRR_1      1/6     168   191 ..     1    25 []    14.7   0.0049

LRR_1      2/6     192   210 ..     1    25 []     9.1      0.2

LRR_1      3/6     212   237 ..     1    25 []     8.4     0.26

LRR_1      4/6     238   257 ..     1    25 []    10.3      0.1

LRR_1      5/6     259   282 ..     1    25 []    10.1     0.12

LRR_1      6/6     290   314 ..     1    25 []     2.4        2

//

 

Query sequence: ENSMUSP00000074175

Accession:      [none]

Description:    [none]

 

Scores for sequence family classification (score includes all domains):

Model    Description                                    Score    E-value
N 

-------- -----------                                    -----    -------
---

CUB      CUB domain                                     232.5    1.3e-68
2

Trypsin  Trypsin                                        206.0    1.2e-60
1

Sushi    Sushi domain (SCR repeat)                       88.7    2.6e-25
2

EGF_CA   Calcium binding EGF domain                      29.4    1.8e-07
1

 

Parsed for domains:

Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value

-------- ------- ----- -----    ----- -----      -----  -------

CUB        1/2      16   137 ..     1   116 []    70.0  1.1e-19

EGF_CA     1/1     141   188 ..     1    55 []    29.4  1.8e-07

CUB        2/2     192   301 ..     1   116 []   162.5  1.5e-47

Sushi      1/2     308   370 ..     1    62 []    47.5  6.5e-13

Sushi      2/2     375   446 ..     1    62 []    41.2  5.1e-11

Trypsin    1/1     463   698 ..     1   259 []   206.0  1.2e-60

//

 

 

Cheers,

Sean.

 

 

 

On 8/30/05, Barry Moore  wrote:

> Sean,

> 

> Don't see anything obviously wrong.  If you want to send your input 

> file, I'll try to recreate the problem.

> 

> Barry

> 

> -----Original Message-----

> From: bioperl-l-bounces@portal.open-bio.org

> [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Sean 

> O'Keeffe

> Sent: Tuesday, August 30, 2005 2:55 AM

> To: bioperl-l@portal.open-bio.org

> Subject: [Bioperl-l] Bio::Search results

> 

> Hi,

> The following code snippet is something I use to extract information 

> from hmmer result files:

> 

> use Bio::SearchIO;

> 

> my $in =3D new Bio::SearchIO( -format =3D> 'hmmer',  -file =3D> 

> $ARGV[0] ); while(my $result =3D $in->next_result) {

>   print $result->query_name(), "\n",$result->query_description(),"\n";

>   while (my $hit =3D $result->next_hit) {

>     while(my $hsp =3D $hit->next_domain) {

>       next unless ($hsp->name =3D~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i);

>       print $hsp->start(),"\t",$hsp->end(),"\t",$hsp->evalue(),"\n";

>     }

>   }

> }

> 

> The input file is generated by hmmpfam and is given at the command 

> line. I use it to scan for specific domain names e.g ig, fn3 lrr etc. 

> This code works for the first loop and then ends so I get the name and


> description (no hsp values as their are none for this result):

> 

> ENSMUSP00000065602=20

> pep:novel supercontig::NT_085813:405:1510:-1 gene:ENSMUSG00000054059 

> transcript:ENSMUST00000066517

> 

> My question is why does the loop end after one instance. Incidentally 

> the outputted  name and description above are the last ones in the 

> hmmer file (maybe the file is read from the back??? - don't know if 

> this means anything). Any thoughts would be appreciated. Thanks,

> Sean.

> 

> _______________________________________________

> Bioperl-l mailing list

> Bioperl-l@portal.open-bio.org 

> http://portal.open-bio.org/mailman/listinfo/bioperl-l

>

 

 


_______________________________________________
Bioperl-l mailing list
Bioperl-l@portal.open-bio.org
http://portal.open-bio.org/mailman/listinfo/bioperl-l

From ro_phls2 at dh.gov.hk  Fri Sep  2 00:02:10 2005
From: ro_phls2 at dh.gov.hk (Andrew Leung)
Date: Fri Sep  2 00:15:14 2005
Subject: [Bioperl-l] How to assess sequencing quality with Bioperl?
In-Reply-To: <200509020218.j822H6AJ015783@portal.open-bio.org>
Message-ID: <20050902040216.BQIP11840.pimx07@Leungkcro>

Hello,
How to read trace files and report sequencing quality using Bioperl? Is
there anyone who can give me some hints on what Bioperl modules I can use
and what I could obtain from using them? I've googled the Bioperl site for
this topic, but felt fluctuated.
Thank you in advance.
Andrew

From heikki at ebi.ac.uk  Fri Sep  2 04:48:44 2005
From: heikki at ebi.ac.uk (Heikki Lehvaslaiho)
Date: Fri Sep  2 05:09:34 2005
Subject: [Bioperl-l] Forthcoming EMBL databank changes
Message-ID: <200509020948.44892.heikki@ebi.ac.uk>

FYI:

There are number of planned changes that will affect the EMBL nucleotide 
databank:

http://www.ebi.ac.uk/embl/Documentation/forthcomingchanges.html

Most of them are minor but will be effective this year, but the one planned 
for June 2006 removes the ID completely:

http://www.ebi.ac.uk/embl/Documentation/changesdetails.html



Peter Rice has started  a discussion on its implications on the emboss mailing 
list: 
http://newportal.open-bio.org/pipermail/emboss/2005-September/002203.html

Perhaps we should pay attention! ;-)

 -Heikki

-- 
______ _/      _/_____________________________________________________
      _/      _/                      http://www.ebi.ac.uk/mutations/
     _/  _/  _/  Heikki Lehvaslaiho    heikki at_ebi _ac _uk
    _/_/_/_/_/  EMBL Outstation, European Bioinformatics Institute
   _/  _/  _/  Wellcome Trust Genome Campus, Hinxton
  _/  _/  _/  Cambridge, CB10 1SD, United Kingdom
     _/      Phone: +44 (0)1223 494 644   FAX: +44 (0)1223 494 468
___ _/_/_/_/_/________________________________________________________
From limericksean at gmail.com  Fri Sep  2 05:31:42 2005
From: limericksean at gmail.com (Sean O'Keeffe)
Date: Fri Sep  2 05:28:10 2005
Subject: [Bioperl-l] Bio::Search results
In-Reply-To: 
References: 
Message-ID: <46278464050902023159e6e822@mail.gmail.com>

I have those four lines (all contained on separate lines) but it didn't work . 

I ran "gawk '{if(/^\/\/$/) {print "//\n\nHMMER 2.3.2 (Oct 2003)"} else
{print}}' my_file > whatever" on the pfam file to include a HMMER
header after the // separator for each result.

It now works fine. I still don't understand why I need to include this
header to parse the file. Although from memory don't Blast reports all
include Blast header lines to separate next results?
By the way I think that its the mailer that seems to be altering the
text in these scripts (don't know where the "=3D" came from - it's not
in my original). I'm running a standard linux (suse 9.0) using nedit
as an editor.
Sean.

On 9/2/05, Barry Moore  wrote:
> Sean I see that my mailer messed up the line formatting also.  What I
> meant was you should have the top four lines like this:
> 
> #Line 1: hmmpfam - search one or more sequences against HMM database
> #Line 2: HMMER 2.3.2(Oct 2003)
> #Line 3: Copyright (C) 1992-2003 HHMI/Washington University School of
> #Line 4: Medicine Freely distributed under the GNU General Public
> License (GPL)
> 
> If you have that, and fix the hsp to hit error mentioned it works for
> me.
> 
> Barry
> 
> -----Original Message-----
> From: bioperl-l-bounces@portal.open-bio.org
> [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Barry Moore
> Sent: Thursday, September 01, 2005 11:34 AM
> To: Bioperl List
> Subject: RE: [Bioperl-l] Bio::Search results
> 
> Sean-
> 
> 
> 
> The top of you input hmmpfam file has these four lines:
> 
> 
> 
> hmmpfam - search one or more sequences against HMM database HMMER 2.3.2
> (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of
> Medicine Freely distributed under the GNU General Public License (GPL)
> 
> 
> 
> When I copied that out of you e-mail and into emacs on my computer I got
> it all as one line like this:
> 
> 
> 
> hmmpfam - search one or more sequences against HMM database HMMER 2.3.2
> (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of
> Medicine Freely distributed under the GNU General Public License (GPL)
> 
> 
> 
> The parser needs to see a line beginning with HMMER to trigger setting
> an internal variable called _reporttype (among other things).  Since
> this never happened with a single line header I got the same results you
> did.  Your header lines look OK in the e-mail you sent me, but assuming
> you have the same problem with you header lines that I did, fixing that
> should lead you to your next problem...
> 
> 
> 
> This line of your code has an error:
> 
> 
> 
> next unless ($hsp->name =~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i);
> 
> 
> 
> HSP objects don't have names but their associated hit objects do, so
> this makes your script work as intended:
> 
> 
> 
> next unless ($hit->name =~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i);
> 
> 
> 
> I wonder if the header line problems could be the result of cross
> platform cutting and pasting (or just cross platform file
> incompatibilities).  I noticed also that in you script that you sent the
> '=' turned into '=3D'.  What computer platforms do you use in your work?
> 
> 
> 
> HTH
> 
> 
> 
> Barry
> 
> 
> 
> -----Original Message-----
> 
> From: Sean O'Keeffe [mailto:limericksean@gmail.com]
> 
> Sent: Tuesday, August 30, 2005 9:28 AM
> 
> To: Barry Moore
> 
> Cc: bioperl-l@portal.open-bio.org
> 
> Subject: Re: [Bioperl-l] Bio::Search results
> 
> 
> 
> Hi Barry, thanks for the reply. Below is a snippet of the file (I
> generated it with hmmpfam using the alignment flag set to -A 0, to
> remove alignments - this shouldn't affect the parsing of the file) :
> 
> 
> 
> hmmpfam - search one or more sequences against HMM database HMMER 2.3.2
> (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of
> Medicine Freely distributed under the GNU General Public License (GPL)
> 
> - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
> 
> HMM file:                 /usr/local/lib/pfam-tm
> 
> Sequence file:            Mus_musculus.NCBIM34.jul.pep.fa-short
> 
> - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
> 
> 
> 
> Query sequence: ENSMUSP00000089702
> 
> Accession:      [none]
> 
> Description:    [none]
> 
> 
> 
> Scores for sequence family classification (score includes all domains):
> 
> Model    Description                                    Score    E-value
> N
> 
> -------- -----------                                    -----    -------
> ---
> 
>       [no hits above thresholds]
> 
> 
> 
> Parsed for domains:
> 
> Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> 
> -------- ------- ----- -----    ----- -----      -----  -------
> 
>       [no hits above thresholds]
> 
> //
> 
> 
> 
> Query sequence: ENSMUSP00000089701
> 
> Accession:      [none]
> 
> Description:    [none]
> 
> 
> 
> Scores for sequence family classification (score includes all domains):
> 
> Model    Description                                    Score    E-value
> N
> 
> -------- -----------                                    -----    -------
> ---
> 
>       [no hits above thresholds]
> 
> 
> 
> Parsed for domains:
> 
> Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> 
> -------- ------- ----- -----    ----- -----      -----  -------
> 
>       [no hits above thresholds]
> 
> //
> 
> 
> 
> Query sequence: ENSMUSP00000020094
> 
> Accession:      [none]
> 
> Description:    [none]
> 
> 
> 
> Scores for sequence family classification (score includes all domains):
> 
> Model    Description                                    Score    E-value
> N
> 
> -------- -----------                                    -----    -------
> ---
> 
> LRR_1    Leucine Rich Repeat                             55.0    3.7e-15
> 6
> 
> LRRNT    Leucine rich repeat N-terminal domain           30.1    1.1e-07
> 1
> 
> 
> 
> Parsed for domains:
> 
> Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> 
> -------- ------- ----- -----    ----- -----      -----  -------
> 
> LRRNT      1/1     117   142 ..     1    34 []    30.1  1.1e-07
> 
> LRR_1      1/6     168   191 ..     1    25 []    14.7   0.0049
> 
> LRR_1      2/6     192   210 ..     1    25 []     9.1      0.2
> 
> LRR_1      3/6     212   237 ..     1    25 []     8.4     0.26
> 
> LRR_1      4/6     238   257 ..     1    25 []    10.3      0.1
> 
> LRR_1      5/6     259   282 ..     1    25 []    10.1     0.12
> 
> LRR_1      6/6     290   314 ..     1    25 []     2.4        2
> 
> //
> 
> 
> 
> Query sequence: ENSMUSP00000074175
> 
> Accession:      [none]
> 
> Description:    [none]
> 
> 
> 
> Scores for sequence family classification (score includes all domains):
> 
> Model    Description                                    Score    E-value
> N
> 
> -------- -----------                                    -----    -------
> ---
> 
> CUB      CUB domain                                     232.5    1.3e-68
> 2
> 
> Trypsin  Trypsin                                        206.0    1.2e-60
> 1
> 
> Sushi    Sushi domain (SCR repeat)                       88.7    2.6e-25
> 2
> 
> EGF_CA   Calcium binding EGF domain                      29.4    1.8e-07
> 1
> 
> 
> 
> Parsed for domains:
> 
> Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> 
> -------- ------- ----- -----    ----- -----      -----  -------
> 
> CUB        1/2      16   137 ..     1   116 []    70.0  1.1e-19
> 
> EGF_CA     1/1     141   188 ..     1    55 []    29.4  1.8e-07
> 
> CUB        2/2     192   301 ..     1   116 []   162.5  1.5e-47
> 
> Sushi      1/2     308   370 ..     1    62 []    47.5  6.5e-13
> 
> Sushi      2/2     375   446 ..     1    62 []    41.2  5.1e-11
> 
> Trypsin    1/1     463   698 ..     1   259 []   206.0  1.2e-60
> 
> //
> 
> 
> 
> 
> 
> Cheers,
> 
> Sean.
> 
> 
> 
> 
> 
> 
> 
> On 8/30/05, Barry Moore  wrote:
> 
> > Sean,
> 
> >
> 
> > Don't see anything obviously wrong.  If you want to send your input
> 
> > file, I'll try to recreate the problem.
> 
> >
> 
> > Barry
> 
> >
> 
> > -----Original Message-----
> 
> > From: bioperl-l-bounces@portal.open-bio.org
> 
> > [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Sean
> 
> > O'Keeffe
> 
> > Sent: Tuesday, August 30, 2005 2:55 AM
> 
> > To: bioperl-l@portal.open-bio.org
> 
> > Subject: [Bioperl-l] Bio::Search results
> 
> >
> 
> > Hi,
> 
> > The following code snippet is something I use to extract information
> 
> > from hmmer result files:
> 
> >
> 
> > use Bio::SearchIO;
> 
> >
> 
> > my $in =3D new Bio::SearchIO( -format =3D> 'hmmer',  -file =3D>
> 
> > $ARGV[0] ); while(my $result =3D $in->next_result) {
> 
> >   print $result->query_name(), "\n",$result->query_description(),"\n";
> 
> >   while (my $hit =3D $result->next_hit) {
> 
> >     while(my $hsp =3D $hit->next_domain) {
> 
> >       next unless ($hsp->name =3D~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i);
> 
> >       print $hsp->start(),"\t",$hsp->end(),"\t",$hsp->evalue(),"\n";
> 
> >     }
> 
> >   }
> 
> > }
> 
> >
> 
> > The input file is generated by hmmpfam and is given at the command
> 
> > line. I use it to scan for specific domain names e.g ig, fn3 lrr etc.
> 
> > This code works for the first loop and then ends so I get the name and
> 
> 
> > description (no hsp values as their are none for this result):
> 
> >
> 
> > ENSMUSP00000065602=20
> 
> > pep:novel supercontig::NT_085813:405:1510:-1 gene:ENSMUSG00000054059
> 
> > transcript:ENSMUST00000066517
> 
> >
> 
> > My question is why does the loop end after one instance. Incidentally
> 
> > the outputted  name and description above are the last ones in the
> 
> > hmmer file (maybe the file is read from the back??? - don't know if
> 
> > this means anything). Any thoughts would be appreciated. Thanks,
> 
> > Sean.
> 
> >
> 
> > _______________________________________________
> 
> > Bioperl-l mailing list
> 
> > Bioperl-l@portal.open-bio.org
> 
> > http://portal.open-bio.org/mailman/listinfo/bioperl-l
> 
> >
> 
> 
> 
> 
> 
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

From n.haigh at sheffield.ac.uk  Fri Sep  2 05:01:26 2005
From: n.haigh at sheffield.ac.uk (Nathan Haigh)
Date: Fri Sep  2 05:30:01 2005
Subject: [Bioperl-l] How to assess sequencing quality with Bioperl?
In-Reply-To: <20050902040216.BQIP11840.pimx07@Leungkcro>
Message-ID: 

I'm sure other people will have better, more indepth help, but to get you
started, I can point you in the right direction - but I haven't had to deal
with trace files myself - yet!

You will need to use Bio::SeqIO. The following HowTO shows the supported
formats inc. trace file formats: http://bioperl.org/HOWTOs/html/SeqIO.html. 

Have a read through the Bio::SeqIO.pm file, there is mention of needing to
install the Staden "io_lib" package, as well as the Bio::SeqIO::staden::read
package available from the bioperl-ext repository.

Nathan

-----Original Message-----
From: bioperl-l-bounces@portal.open-bio.org
[mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Andrew Leung
Sent: 02 September 2005 05:02
To: bioperl-l@portal.open-bio.org
Subject: [Bioperl-l] How to assess sequencing quality with Bioperl?

Hello,
How to read trace files and report sequencing quality using Bioperl? Is
there anyone who can give me some hints on what Bioperl modules I can use
and what I could obtain from using them? I've googled the Bioperl site for
this topic, but felt fluctuated.
Thank you in advance.
Andrew

_______________________________________________
Bioperl-l mailing list
Bioperl-l@portal.open-bio.org
http://portal.open-bio.org/mailman/listinfo/bioperl-l


From Richard.Adams at ed.ac.uk  Fri Sep  2 05:12:38 2005
From: Richard.Adams at ed.ac.uk (Richard Adams)
Date: Fri Sep  2 05:34:11 2005
Subject: [Bioperl-l] Make test fails
Message-ID: <43181786.3030707@ed.ac.uk>

Hi,
Yes an  embarassingly large number of the fails are in my own code...
I've not used many of the BioToolsAnalysis modules for a while and they 
can always break at any point depending on
if the format of the output changes....
I'll try to look into them (will be next week)
Regarding the Bio::Graph modules. I was thinking of deleting them from 
CVS unless anybody is finding them useful,
as now that there is an excellent graph module in CPAN my effort is 
somewhat underfeatured and redundant. Plus I've found that everything 
gets dreadfully slow above a few thousand nodes and I've turned to Java 
implementations which are much faster.



Cheers Richard

-- 
Dr Richard Adams
Psychiatric Genetics Group,
Medical Genetics,
Molecular Medicine Centre,
Western General Hospital,
Crewe Rd West,
Edinburgh UK
EH4 2XU

Tel: 44 131 651 1084
richard.adams@ed.ac.uk


From akarger at CGR.Harvard.edu  Fri Sep  2 09:55:17 2005
From: akarger at CGR.Harvard.edu (Amir Karger)
Date: Fri Sep  2 09:59:21 2005
Subject: [Bioperl-l] Best method for downloading 100 sequences
Message-ID: <339D68B133EAD311971E009027DC47970354BEF0@montecarlo.cgr.harvard.edu>

Hi.

I'm using Bioperl's nice get_sequence in my Scriptome toolbox, to fetch a
single sequence. What would be the best method for downloading 100
sequences? Do I write a loop to call get_sequence N times? Will the various
websites get angry at me for doing that? Would they be less angry if I did a
1-second sleep after each download? I know NCBI has methods to pull in N
sequences, but I don't know whether Swiss et al. do too. I'm happy to use
other Bioperl code, rather than get_sequence. I just need to have a script
that people can cut and paste, where they just input the filename with
sequence IDs and the database to download from (sort of like
http://cgr.harvard.edu/cbg/scriptome/Tools/Fetch.html#fetch_a_sequence_from_
a_popular_internet_database__fetch_sequence_web_)

Thanks,

-Amir Karger
From MEC at Stowers-Institute.org  Fri Sep  2 10:36:59 2005
From: MEC at Stowers-Institute.org (Cook, Malcolm)
Date: Fri Sep  2 10:26:55 2005
Subject: [Bioperl-l] methods, etc. for Bio::SearchIO on exonerate output
Message-ID: <200509021426.j82EQ7AH020422@portal.open-bio.org>

Jason,
 
Thanks for the scripts and clues (esp re: using the --ryo option to
inject the needed length into the exonerate output to compensate).
 
I'm considering asking exonerate author to comport with GFF spec.  Do
you think this is a road to take?
 
Cheers,
 
Malcolm
 
-----Original Message-----
From: Jason Stajich [mailto:jason.stajich@duke.edu] 
Sent: Wednesday, August 31, 2005 12:35 PM
To: Cook, Malcolm
Cc: bioperl-l
Subject: Re: [Bioperl-l] methods, etc. for Bio::SearchIO on exonerate
output


http://fungal.genome.duke.edu/~jes12/software/scripts/process_exonerate_
gff3.pl

You may still want to massage it some, but I use the script in this
basic form, maybe with a few tweaks:

Note that it requires you to run exonerate with specific --ryo options
so that it includes the length of the query and hit sequences in the
report output. should be covered in the perldoc in the script.

Without the ryo options enabled,  you'll need to modify the script more
to have access to the original sequence db, use Bio::DB::Fasta,  and put
in some $dbh->length($seqid) calls instead.

I don't think the part which writes HSP/match lines is actually correct
- it is trying to roll gapped HSPs from the similarity features. 

I end up ignoring all but the 'exon' and 'gene' lines for my gbrowse
instance and/or grepping out the lines I really think I need.  
You may want to s/exon/CDS/ for the protein2genome output as well.

-jason

On Aug 31, 2005, at 1:04 PM, Cook, Malcolm wrote:


Jason, 

This message is in regards to an old thread  in which you offered to
shared a 'script for munging over' exonerate output for lading in
DB::GFF (c.f.

http://bioperl.org/pipermail/bioperl-l/2005-April/018741.html)

Would you be willing to still share that script, if you've got it
around? 

Thanks, and regards, 

Malcolm Cook -  
mec@stowers-institute.org - 816-926-4449
Database Applications Manager - Bioinformatics
Stowers Institute for Medical Research - Kansas City, MO  USA




--
Jason Stajich
Duke University
http://www.duke.edu/~jes12



From MEC at Stowers-Institute.org  Fri Sep  2 10:24:08 2005
From: MEC at Stowers-Institute.org (Cook, Malcolm)
Date: Fri Sep  2 10:27:04 2005
Subject: [Bioperl-l] How to assess sequencing quality with Bioperl?
Message-ID: <200509021426.j82EQgAH020435@portal.open-bio.org>

Andrew,

Following is a manpage for a program I wrote using Bioperl (and phred).

If you'd like it, let me know, I'll slap our institute approved software
license on it an put a `make install`able tarball on a webpage
somewhere...

Malcolm Cook - mec@stowers-institute.org - 816-926-4449
Database Applications Manager - Bioinformatics
Stowers Institute for Medical Research - Kansas City, MO  USA 

________________________________________________________________________
_________

SEQTRACESTATS(1)      User Contributed Perl Documentation
SEQTRACESTATS(1)



SYNOPSIS
       seqtracestats --bins=max1,max2,max3 --informat trace_format
--readname-
       convention attributelist=expression  --mtime daycount --abi2phd <
trace
       files > quality score summary

       Given a set of DNA sequence traces (or possibly a directory to
find
       them in based on their age), produce summary descriptive
statistics of
       the read quality (after optionally (re)base calling using phred).

OPTIONS
       Their case is ignored, and they may be abbreviated to uniqueness
(i.e.
       --v instead of --verbose).

       Options may be specified on the command line, and may optionally
also
       be read from files by providing on the command line the path to
the
       file preceded by a '@'.  These option files provide simple access
to
       typical calling scenarios (such as an analysis that is repeatedly
       invoked from the command line with the same parameters).
Additionally,
       if the current directory contains a file named
seqtracestats.config, it
       will be automatically used as an option file.

       --informat = PHD|SCF|ABI
           Format of input files.  Defaults to PHD.  Can be any
Bio::SeqIO
           format that contains quality values, such as SCF.

           TODO: currently only PHD works.  Get the staden integration
for ABI
           and SCF files working with BioPerl.

       --bins = n,m,o,p
           A comma separated list of numbers which should be in
increasing
           order.  They define the ranges into which the sequence
quality
           score for each base-pair read is binned; each number sets the
maxi-
           mum allowable value in the bin, with the minimum value being
deter-
           mined by the previous bin, if any.

           Note that any quality scores encountered which are greater
than the
           largest bin will not be included in any bin.  Otherwise, the
sum of
           the values in each of the bins will equal the entire sequence
           length.

           I have not encountered any documentation specifying a maximum
phred
           score assigned in practice by any base caller.  However, I
have
           never encountered a score, or a report of a score, greater
than 50.
           So, you can pretty safely use 60 as your highest bin, which
corre-
           sponds to an error probability of one in a million.

           Defaults to --bins=20,30,40,50,60.

       --mtimeatt timeattributes
           Allows specification of time attributes to appear in report.

       --readnameconvention attributelist=expression
           A method of decoding attributes such as are typically encoded
in
           the name of files holding seqreads.

           Implemented as an association between a comma delimited list
of
           attribute names and a perl expression which, when evaluated
yeilds
           corresponding values for each attribute.  The expression is
evalu-
           ated in the context of $_ being the filename holding a
seqread.

           Any attributes containing the word 'ignore' as a substring
are
           supressed from the summary.

           For example:

           "--readnameconvention='gene,library,plate,primer,platewellco-
           ord,=split /[-_.]/'"

           when reading the file: VPL3-15-I-BSB460_A01.seq

           will assign to the current read attributes as follows:

                   gene => VPL3
                   library => 15
                   plate => I
                   primer => BSB460
                   platewellcoord => A01

           Named aliases exist as shorthand methods for decoding
commonly used
           naming conventions.  The following are predefined:

           TODO: IMPLEMENT THESE - THEY ARE NOT.

           simr1
               Short for:
'(gene,library,plate,primer,platewellcoord)=split
               /[-_.]/'

       --mtime
           Interpret the input files as directorys to search for ab1
files
           created (modified) mtime days ago.  If none supplied,
defaults to
           current working directory.

           This value is used as --mtime argument to the unix find
command
           (along with -daystart), and as such may be prefixed with '-'
or
           '+', to mean 'less than' or 'greater than' mtime days ago.

           May be specified multiple times to produce data ranges.  I.e.
           --mtime -31 --mtime +0 will select files between 1 and 30
days old
           (inclusive)

           Implies --abi2phd

       --abi2phd
           Input files are ab1 chromatogram files and they should be
replaced
           with corresponding quality file, generated using phred as
needed.

           If there is an existing corresponding .phd (or .phd.1) file,
it
           will be used.

           Otherwise, the ab1 files will be (re) base-called by phred,
gener-
           ating sequence quality files in the same directory with
addition
           extension of ".phd".

           Note: if the input files already have corresponding '.phd' or
           '.phd.1' file, it will NOT be re-basecalled and the existing
QV
           scores will be used.

       --help
           Display command line usage with options.

       --man
           Display complete manual page and exit.

       --verbose
           Provides a trace of processing on STDERR.

       --version
           Display the scripts version number and exit.

DESCRIPTION
       Output is in csv format (comma separated values) and may be
visualied
       in Excel.

       TODO: Elaborate this description?

EXAMPLES
       seqtracestats --mtime 1 > seqtracestats.txt
           Summarize the result of run phred on all ab1 files created
yester-
           day which are subordinate to current directory, putting the
results
           in file seqtracestats.txt

       ./seqtracestats --mtime -10 '/n/facility/Genomics/Sequenc-
       ing/2003/Molecular\ Biology/' --readname 'platerow,plate-
       col=m/_([A-H])(\d{2})\./' --readname
',,submitter,lab=reverse(split
       /\//)'
           Summarize reads less than 10 days old, parsing out platerow
and
           plate col from the read filename, and interpreting selected
direc-
           tory components as the submitter of the sequencing request,
and the
           lab of which s/he is a member.

       seqtracestats --mtime +1,-30 ./2003 > ./2003/febqual.txt
           Summarize trace files that are less than 30 but more than 1
days
           old which are within the directory ./2003 which is in turn
within
           the current directory.  Put the results in
./2003/febqual.txt.

           Note: if this example is preceded by

           cd /n/facility/Genomics/Sequencing/

           then additional parameters will be picked up from the file
seq-
           tracestats.config in that directory.  This file implements
the
           standard read naming conventions.

       seqtracestats ./t/data/*.phd.1 --informat=PHD --bins=20,30,60
--read-
       nameconvention='gene,primer,platenumber,platecoord,=split
/[-_.]/'
           Result of summarize the PHD formatted files into three bins,
decod-
           ing the selected attributes from the read name:

 
trace_file_path,display_id,gene,primer,platenumber,platecoord,clone,vect
or,FR,plate_id,platerow,platecol,length,gc_content,mean,variance,20,30,6
0,20,30,60
 
./t/data/MC1081-M13F-20_A01.phd.1,MC1081-M13F-20_A01.ab1,MC1081,M13F,20,
A01,MC1081,M13,F,20,A,01,807,0.563816604708798,39.2094175960347,118.5479
01273288,54,83,670,54,83,670
 
./t/data/MC1081-M13R-48_A01.phd.1,MC1081-M13R-48_A01.ab1,MC1081,M13R,48,
A01,MC1081,M13,R,48,A,01,802,0.553615960099751,39.2418952618453,113.7466
57077655,54,76,672,54,76,672
 
./t/data/MC1081-M13R-48_A01.phd.1,MC1081-M13R-48_A01.ab1,MC1081,M13R,48,
A01,MC1081,M13,R,48,A,01,802,0.553615960099751,39.2418952618453,113.7466
57077655,54,76,672,54,76,672
            ...

       seqtracestats ./t/data/*.phd.1 --informat=PHD --bins=20,30,60
--read-
       nameconvention='clone,vector,FR,plate_id,platerow,plate-
       col=m/^([^\-]+)-(\w+)([FR])-(\d+)_(\w{1})(\d+)\..*$/'
           Result of running on the same data but parsing the readname
differ-
           ently, including pulling out read direction and plate row and
col-
           umn:

 
trace_file_path,display_id,clone,vector,FR,plate_id,platerow,platecol,le
ngth,gc_content,mean,variance,num bp q<=20,num bp q<=30,num bp q<=60
 
./t/data/MC1081-M13F-20_A01.phd.1,MC1081-M13F-20_A01.ab1,MC1081,M13,F,20
,A,01,807,0.563816604708798,39.2094175960347,118.547901273288,54,83,670
 
./t/data/MC1081-M13R-48_A01.phd.1,MC1081-M13R-48_A01.ab1,MC1081,M13,R,48
,A,01,802,0.553615960099751,39.2418952618453,113.746657077655,54,76,672
 
./t/data/MC1082-M13F-20_B01.phd.1,MC1082-M13F-20_B01.ab1,MC1082,M13,F,20
,B,01,816,0.498774509803922,29.9803921568627,105.805750030073,143,236,43
7
            ...

       seqtracestats ./t/data/*.phd.1 @./eg.config
           Process those same files, taking command line options from
eg.con-
           fig in the current directory.

       seqtracestats ./t/data/*.phd.1
           Process those same file, taking command line options from
seq-
           tracestats.config in the current working directory.

AUTHOR
       Malcolm Cook (mec@stowers-institute.org)

DEPENDENCIES
       perl, BioPerl, bioperl-ext,  Time::Seconds,
Statistics::Descriptive,
       /usr/local/bin/find

       Time::Piece

AVAILABILITY
       Email the author for sources.

VERSION
       $Revision: 1.4 $

TODO
       include support for ABI files
       support other output formats & destinations?  tab v. csv format
v.
       write to (mysql?) database.  Use DBD::AnyData for implementation?
       create textual report similar to ABI's software
       allow for reporting on trimmed sequences
       contibute patch to Bio::Tools::SeqStats to BioPerl

REFERENCES
       see the unix command trev, part of staden package, for viewing
.scf
       files under unix
       regarding the conversion of ABI files using SEQIO
 
http://open-bio.org/pipermail/bioperl-l/2003-January/010749.html -



perl v5.8.6                       2005-09-02
SEQTRACESTATS(1)

From MEC at Stowers-Institute.org  Fri Sep  2 11:22:15 2005
From: MEC at Stowers-Institute.org (Cook, Malcolm)
Date: Fri Sep  2 11:14:15 2005
Subject: [Bioperl-l] methods, etc. for Bio::SearchIO on exonerate output
Message-ID: <200509021511.j82FBMAH021211@portal.open-bio.org>

Hmmmm - I'd better get some clarification from Guy too.  
 
Guy, if you don't mind reading the thread below and chiming in on our
discussion of interpreting the output of your excellent exonerate
program:
 
The sections of the manpage (

http://www.ebi.ac.uk/~guy/exonerate/exonerate.man.1.html) that appear
relevant are these 2 excerpts:
 
 1) When an alignment is reported on the reverse complement of a
sequence, the coordinates are simply given on the reverse complement
copy of the sequence. Hence positions on the sequences are never
negative. Generally, the forward strand is indicated by '+', the reverse
strand by '-', and an unknown or not-applicable strand (as in the case
of a protein sequence) is indicated by '.' "
 
2)  --forwardcoordinates  By default, all coordinates are
reported on the forward strand. Setting this option to false reverts to
the old behaviour (pre-0.8.3) whereby alignments on the reverse
complement of a sequence are reported using coordinates on the reverse
complement. 
 
We see GFF DUMP coordinates still reported on the reverse stand
regardless of the setting of --forwardcoordinates.  So these two
excerpts from you manpage seem contradictory to me.     Unless I
understand `--forwardcoordinates FALSE` to only effect the coordinates
reported in the alignment section, not in the GFF DUMP section, which is
what it appears to do in practice.
 
Guy, can you confirm that the --forwardcoordinates option has no effect
on GFF output?
 
Further, can you tell us if you plan to comport more closely to the GFF
spec, in particular in this case by reporting forwardcoordinates in the
GFF DUMP section too?   I see 
I see in your TODO list "    o Should GFF show all coordinates on the
+ve strand? (jason_p2g eg)".  Hear hear!  I second the motion.
 
And TODO item " GFF3 support ? http://song.sf.net/" gets my vote too....
though this is more of a sticky wicket....
 
Cheers and Thanks!
 
Malcolm Cook
 
 
-----Original Message-----
From: Jason Stajich [mailto:jason.stajich@duke.edu] 
Sent: Friday, September 02, 2005 9:46 AM
To: Cook, Malcolm
Cc: bioperl-l
Subject: Re: [Bioperl-l] methods, etc. for Bio::SearchIO on exonerate
output


I've already talked to Guy about some of this and I assume fixes will be
part of the next release, but it can't hurt to have more people
requesting.  The main problem right now is reverse strand hits in GFF
output are still screwed up even if you provide the --forwardcoordinates
option. 

If someone wanted to write/donate a VULGAR to GFF subroutine (okay
VULGAR to a list of Bio::Search::HSP::GenericHSP).  We can also
reconstruct everything needed from that, I gave a stab at it once, but
there was something missing (or maybe it was pre --forwardcoordinates
option).   


-jason 

On Sep 2, 2005, at 10:36 AM, Cook, Malcolm wrote:


Jason,
 
Thanks for the scripts and clues (esp re: using the --ryo option to
inject the needed length into the exonerate output to compensate).
 
I'm considering asking exonerate author to comport with GFF spec.  Do
you think this is a road to take?
 
Cheers,
 
Malcolm
 
-----Original Message-----
From: Jason Stajich [mailto:jason.stajich@duke.edu] 
Sent: Wednesday, August 31, 2005 12:35 PM
To: Cook, Malcolm
Cc: bioperl-l
Subject: Re: [Bioperl-l] methods, etc. for Bio::SearchIO on exonerate
output


http://fungal.genome.duke.edu/~jes12/software/scripts/process_exonerate_
gff3.pl

You may still want to massage it some, but I use the script in this
basic form, maybe with a few tweaks:

Note that it requires you to run exonerate with specific --ryo options
so that it includes the length of the query and hit sequences in the
report output. should be covered in the perldoc in the script.

Without the ryo options enabled,  you'll need to modify the script more
to have access to the original sequence db, use Bio::DB::Fasta,  and put
in some $dbh->length($seqid) calls instead.

I don't think the part which writes HSP/match lines is actually correct
- it is trying to roll gapped HSPs from the similarity features. 

I end up ignoring all but the 'exon' and 'gene' lines for my gbrowse
instance and/or grepping out the lines I really think I need.  
You may want to s/exon/CDS/ for the protein2genome output as well.

-jason

On Aug 31, 2005, at 1:04 PM, Cook, Malcolm wrote:


Jason, 

This message is in regards to an old thread  in which you offered to
shared a 'script for munging over' exonerate output for lading in
DB::GFF (c.f.

http://bioperl.org/pipermail/bioperl-l/2005-April/018741.html)

Would you be willing to still share that script, if you've got it
around? 

Thanks, and regards, 

Malcolm Cook -  
mec@stowers-institute.org - 816-926-4449
Database Applications Manager - Bioinformatics
Stowers Institute for Medical Research - Kansas City, MO  USA





--
Jason Stajich
Duke University
http://www.duke.edu/~jes12




--
Jason Stajich
Duke University
http://www.duke.edu/~jes12



From walsh at cenix-bioscience.com  Fri Sep  2 11:34:07 2005
From: walsh at cenix-bioscience.com (Andrew Walsh)
Date: Fri Sep  2 11:55:50 2005
Subject: [Bioperl-l] How to assess sequencing quality with Bioperl?
In-Reply-To: <200509021426.j82EQgAH020435@portal.open-bio.org>
References: <200509021426.j82EQgAH020435@portal.open-bio.org>
Message-ID: <431870EF.3000601@cenix-bioscience.com>

There is also a program from TIGR called 'lucy' that can be used to 
process the output from phred.  The Bioperl module for dealing with lucy 
files is Bio::Tools::Lucy.  If you use it, make sure to check out the 
most recent version in CVS, as a bug was recently fixed.

lucy:
http://www.tigr.org/software/sequencing.shtml

Andrew


Cook, Malcolm wrote:
> Andrew,
> 
> Following is a manpage for a program I wrote using Bioperl (and phred).
> 
> If you'd like it, let me know, I'll slap our institute approved software
> license on it an put a `make install`able tarball on a webpage
> somewhere...
> 
> Malcolm Cook - mec@stowers-institute.org - 816-926-4449
> Database Applications Manager - Bioinformatics
> Stowers Institute for Medical Research - Kansas City, MO  USA 
> 
> ________________________________________________________________________
> _________
> 
> SEQTRACESTATS(1)      User Contributed Perl Documentation
> SEQTRACESTATS(1)
> 
> 
> 
> SYNOPSIS
>        seqtracestats --bins=max1,max2,max3 --informat trace_format
> --readname-
>        convention attributelist=expression  --mtime daycount --abi2phd <
> trace
>        files > quality score summary
> 
>        Given a set of DNA sequence traces (or possibly a directory to
> find
>        them in based on their age), produce summary descriptive
> statistics of
>        the read quality (after optionally (re)base calling using phred).
> 
> OPTIONS
>        Their case is ignored, and they may be abbreviated to uniqueness
> (i.e.
>        --v instead of --verbose).
> 
>        Options may be specified on the command line, and may optionally
> also
>        be read from files by providing on the command line the path to
> the
>        file preceded by a '@'.  These option files provide simple access
> to
>        typical calling scenarios (such as an analysis that is repeatedly
>        invoked from the command line with the same parameters).
> Additionally,
>        if the current directory contains a file named
> seqtracestats.config, it
>        will be automatically used as an option file.
> 
>        --informat = PHD|SCF|ABI
>            Format of input files.  Defaults to PHD.  Can be any
> Bio::SeqIO
>            format that contains quality values, such as SCF.
> 
>            TODO: currently only PHD works.  Get the staden integration
> for ABI
>            and SCF files working with BioPerl.
> 
>        --bins = n,m,o,p
>            A comma separated list of numbers which should be in
> increasing
>            order.  They define the ranges into which the sequence
> quality
>            score for each base-pair read is binned; each number sets the
> maxi-
>            mum allowable value in the bin, with the minimum value being
> deter-
>            mined by the previous bin, if any.
> 
>            Note that any quality scores encountered which are greater
> than the
>            largest bin will not be included in any bin.  Otherwise, the
> sum of
>            the values in each of the bins will equal the entire sequence
>            length.
> 
>            I have not encountered any documentation specifying a maximum
> phred
>            score assigned in practice by any base caller.  However, I
> have
>            never encountered a score, or a report of a score, greater
> than 50.
>            So, you can pretty safely use 60 as your highest bin, which
> corre-
>            sponds to an error probability of one in a million.
> 
>            Defaults to --bins=20,30,40,50,60.
> 
>        --mtimeatt timeattributes
>            Allows specification of time attributes to appear in report.
> 
>        --readnameconvention attributelist=expression
>            A method of decoding attributes such as are typically encoded
> in
>            the name of files holding seqreads.
> 
>            Implemented as an association between a comma delimited list
> of
>            attribute names and a perl expression which, when evaluated
> yeilds
>            corresponding values for each attribute.  The expression is
> evalu-
>            ated in the context of $_ being the filename holding a
> seqread.
> 
>            Any attributes containing the word 'ignore' as a substring
> are
>            supressed from the summary.
> 
>            For example:
> 
>            "--readnameconvention='gene,library,plate,primer,platewellco-
>            ord,=split /[-_.]/'"
> 
>            when reading the file: VPL3-15-I-BSB460_A01.seq
> 
>            will assign to the current read attributes as follows:
> 
>                    gene => VPL3
>                    library => 15
>                    plate => I
>                    primer => BSB460
>                    platewellcoord => A01
> 
>            Named aliases exist as shorthand methods for decoding
> commonly used
>            naming conventions.  The following are predefined:
> 
>            TODO: IMPLEMENT THESE - THEY ARE NOT.
> 
>            simr1
>                Short for:
> '(gene,library,plate,primer,platewellcoord)=split
>                /[-_.]/'
> 
>        --mtime
>            Interpret the input files as directorys to search for ab1
> files
>            created (modified) mtime days ago.  If none supplied,
> defaults to
>            current working directory.
> 
>            This value is used as --mtime argument to the unix find
> command
>            (along with -daystart), and as such may be prefixed with '-'
> or
>            '+', to mean 'less than' or 'greater than' mtime days ago.
> 
>            May be specified multiple times to produce data ranges.  I.e.
>            --mtime -31 --mtime +0 will select files between 1 and 30
> days old
>            (inclusive)
> 
>            Implies --abi2phd
> 
>        --abi2phd
>            Input files are ab1 chromatogram files and they should be
> replaced
>            with corresponding quality file, generated using phred as
> needed.
> 
>            If there is an existing corresponding .phd (or .phd.1) file,
> it
>            will be used.
> 
>            Otherwise, the ab1 files will be (re) base-called by phred,
> gener-
>            ating sequence quality files in the same directory with
> addition
>            extension of ".phd".
> 
>            Note: if the input files already have corresponding '.phd' or
>            '.phd.1' file, it will NOT be re-basecalled and the existing
> QV
>            scores will be used.
> 
>        --help
>            Display command line usage with options.
> 
>        --man
>            Display complete manual page and exit.
> 
>        --verbose
>            Provides a trace of processing on STDERR.
> 
>        --version
>            Display the scripts version number and exit.
> 
> DESCRIPTION
>        Output is in csv format (comma separated values) and may be
> visualied
>        in Excel.
> 
>        TODO: Elaborate this description?
> 
> EXAMPLES
>        seqtracestats --mtime 1 > seqtracestats.txt
>            Summarize the result of run phred on all ab1 files created
> yester-
>            day which are subordinate to current directory, putting the
> results
>            in file seqtracestats.txt
> 
>        ./seqtracestats --mtime -10 '/n/facility/Genomics/Sequenc-
>        ing/2003/Molecular\ Biology/' --readname 'platerow,plate-
>        col=m/_([A-H])(\d{2})\./' --readname
> ',,submitter,lab=reverse(split
>        /\//)'
>            Summarize reads less than 10 days old, parsing out platerow
> and
>            plate col from the read filename, and interpreting selected
> direc-
>            tory components as the submitter of the sequencing request,
> and the
>            lab of which s/he is a member.
> 
>        seqtracestats --mtime +1,-30 ./2003 > ./2003/febqual.txt
>            Summarize trace files that are less than 30 but more than 1
> days
>            old which are within the directory ./2003 which is in turn
> within
>            the current directory.  Put the results in
> ./2003/febqual.txt.
> 
>            Note: if this example is preceded by
> 
>            cd /n/facility/Genomics/Sequencing/
> 
>            then additional parameters will be picked up from the file
> seq-
>            tracestats.config in that directory.  This file implements
> the
>            standard read naming conventions.
> 
>        seqtracestats ./t/data/*.phd.1 --informat=PHD --bins=20,30,60
> --read-
>        nameconvention='gene,primer,platenumber,platecoord,=split
> /[-_.]/'
>            Result of summarize the PHD formatted files into three bins,
> decod-
>            ing the selected attributes from the read name:
> 
>  
> trace_file_path,display_id,gene,primer,platenumber,platecoord,clone,vect
> or,FR,plate_id,platerow,platecol,length,gc_content,mean,variance,20,30,6
> 0,20,30,60
>  
> ./t/data/MC1081-M13F-20_A01.phd.1,MC1081-M13F-20_A01.ab1,MC1081,M13F,20,
> A01,MC1081,M13,F,20,A,01,807,0.563816604708798,39.2094175960347,118.5479
> 01273288,54,83,670,54,83,670
>  
> ./t/data/MC1081-M13R-48_A01.phd.1,MC1081-M13R-48_A01.ab1,MC1081,M13R,48,
> A01,MC1081,M13,R,48,A,01,802,0.553615960099751,39.2418952618453,113.7466
> 57077655,54,76,672,54,76,672
>  
> ./t/data/MC1081-M13R-48_A01.phd.1,MC1081-M13R-48_A01.ab1,MC1081,M13R,48,
> A01,MC1081,M13,R,48,A,01,802,0.553615960099751,39.2418952618453,113.7466
> 57077655,54,76,672,54,76,672
>             ...
> 
>        seqtracestats ./t/data/*.phd.1 --informat=PHD --bins=20,30,60
> --read-
>        nameconvention='clone,vector,FR,plate_id,platerow,plate-
>        col=m/^([^\-]+)-(\w+)([FR])-(\d+)_(\w{1})(\d+)\..*$/'
>            Result of running on the same data but parsing the readname
> differ-
>            ently, including pulling out read direction and plate row and
> col-
>            umn:
> 
>  
> trace_file_path,display_id,clone,vector,FR,plate_id,platerow,platecol,le
> ngth,gc_content,mean,variance,num bp q<=20,num bp q<=30,num bp q<=60
>  
> ./t/data/MC1081-M13F-20_A01.phd.1,MC1081-M13F-20_A01.ab1,MC1081,M13,F,20
> ,A,01,807,0.563816604708798,39.2094175960347,118.547901273288,54,83,670
>  
> ./t/data/MC1081-M13R-48_A01.phd.1,MC1081-M13R-48_A01.ab1,MC1081,M13,R,48
> ,A,01,802,0.553615960099751,39.2418952618453,113.746657077655,54,76,672
>  
> ./t/data/MC1082-M13F-20_B01.phd.1,MC1082-M13F-20_B01.ab1,MC1082,M13,F,20
> ,B,01,816,0.498774509803922,29.9803921568627,105.805750030073,143,236,43
> 7
>             ...
> 
>        seqtracestats ./t/data/*.phd.1 @./eg.config
>            Process those same files, taking command line options from
> eg.con-
>            fig in the current directory.
> 
>        seqtracestats ./t/data/*.phd.1
>            Process those same file, taking command line options from
> seq-
>            tracestats.config in the current working directory.
> 
> AUTHOR
>        Malcolm Cook (mec@stowers-institute.org)
> 
> DEPENDENCIES
>        perl, BioPerl, bioperl-ext,  Time::Seconds,
> Statistics::Descriptive,
>        /usr/local/bin/find
> 
>        Time::Piece
> 
> AVAILABILITY
>        Email the author for sources.
> 
> VERSION
>        $Revision: 1.4 $
> 
> TODO
>        include support for ABI files
>        support other output formats & destinations?  tab v. csv format
> v.
>        write to (mysql?) database.  Use DBD::AnyData for implementation?
>        create textual report similar to ABI's software
>        allow for reporting on trimmed sequences
>        contibute patch to Bio::Tools::SeqStats to BioPerl
> 
> REFERENCES
>        see the unix command trev, part of staden package, for viewing
> .scf
>        files under unix
>        regarding the conversion of ABI files using SEQIO
>  
> http://open-bio.org/pipermail/bioperl-l/2003-January/010749.html -
> 
> 
> 
> perl v5.8.6                       2005-09-02
> SEQTRACESTATS(1)
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
> 


-- 
------------------------------------------------------------------
Andrew Walsh, M.Sc.
Bioinformatics Software Engineer
IT Unit
Cenix BioScience GmbH
Tatzberg 47
01307 Dresden
Germany
Tel. +49-351-4173 137
Fax  +49-351-4173 109

public key: http://www.cenix-bioscience.com/public_keys/walsh.gpg
------------------------------------------------------------------

From jason.stajich at duke.edu  Fri Sep  2 10:46:26 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Fri Sep  2 12:34:05 2005
Subject: [Bioperl-l] methods, etc. for Bio::SearchIO on exonerate output
In-Reply-To: <200509021437.j82Eb5Yx013918@gibson.acpub.duke.edu>
References: <200509021437.j82Eb5Yx013918@gibson.acpub.duke.edu>
Message-ID: 

I've already talked to Guy about some of this and I assume fixes will  
be part of the next release, but it can't hurt to have more people  
requesting.  The main problem right now is reverse strand hits in GFF  
output are still screwed up even if you provide the -- 
forwardcoordinates option.

If someone wanted to write/donate a VULGAR to GFF subroutine (okay  
VULGAR to a list of Bio::Search::HSP::GenericHSP).  We can also  
reconstruct everything needed from that, I gave a stab at it once,  
but there was something missing (or maybe it was pre -- 
forwardcoordinates option).


-jason

On Sep 2, 2005, at 10:36 AM, Cook, Malcolm wrote:

> Jason,
>
> Thanks for the scripts and clues (esp re: using the --ryo option to  
> inject the needed length into the exonerate output to compensate).
>
> I'm considering asking exonerate author to comport with GFF spec.   
> Do you think this is a road to take?
>
> Cheers,
>
> Malcolm
>
> -----Original Message-----
> From: Jason Stajich [mailto:jason.stajich@duke.edu]
> Sent: Wednesday, August 31, 2005 12:35 PM
> To: Cook, Malcolm
> Cc: bioperl-l
> Subject: Re: [Bioperl-l] methods, etc. for Bio::SearchIO on  
> exonerate output
>
> http://fungal.genome.duke.edu/~jes12/software/scripts/ 
> process_exonerate_gff3.pl
>
> You may still want to massage it some, but I use the script in this  
> basic form, maybe with a few tweaks:
>
> Note that it requires you to run exonerate with specific --ryo  
> options so that it includes the length of the query and hit  
> sequences in the report output. should be covered in the perldoc in  
> the script.
>
> Without the ryo options enabled,  you'll need to modify the script  
> more to have access to the original sequence db, use  
> Bio::DB::Fasta,  and put in some $dbh->length($seqid) calls instead.
>
> I don't think the part which writes HSP/match lines is actually  
> correct - it is trying to roll gapped HSPs from the similarity  
> features.
>
> I end up ignoring all but the 'exon' and 'gene' lines for my  
> gbrowse instance and/or grepping out the lines I really think I need.
> You may want to s/exon/CDS/ for the protein2genome output as well.
>
> -jason
>
> On Aug 31, 2005, at 1:04 PM, Cook, Malcolm wrote:
>
>> Jason,
>>
>> This message is in regards to an old thread  in which you offered  
>> to shared a 'script for munging over' exonerate output for lading  
>> in DB::GFF (c.f. http://bioperl.org/pipermail/bioperl-l/2005-April/ 
>> 018741.html)
>>
>> Would you be willing to still share that script, if you've got it  
>> around?
>>
>> Thanks, and regards,
>>
>> Malcolm Cook - mec@stowers-institute.org - 816-926-4449
>> Database Applications Manager - Bioinformatics
>> Stowers Institute for Medical Research - Kansas City, MO  USA
>>
>>
>
> --
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
>
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From arareko at campus.iztacala.unam.mx  Fri Sep  2 14:12:40 2005
From: arareko at campus.iztacala.unam.mx (Mauricio Herrera Cuadra)
Date: Fri Sep  2 14:16:48 2005
Subject: [Bioperl-l] Re: Best method for downloading 100 sequences
Message-ID: <43189618.9000205@campus.iztacala.unam.mx>

Hi Amir,

I've done it before by using a loop without sleep() for the EMBL-Bank 
and it works fine. I use an input file with all the sequence ID's 
organized by gene/allele name so all the downloaded files get into 
corresponding directories. I can send you the code if you want to adjust 
it to your needs.

Regards,
Mauricio.

--- Amir Karger  wrote:
 > Hi.
 >
 > I'm using Bioperl's nice get_sequence in my Scriptome toolbox, to
 > fetch a single sequence. What would be the best method for downloading
 > 100 sequences? Do I write a loop to call get_sequence N times? Will
 > the various websites get angry at me for doing that? Would they be
 > less angry if I did a 1-second sleep after each download? I know NCBI
 > has methods to pull in N sequences, but I don't know whether Swiss et
 > al. do too. I'm happy to use other Bioperl code, rather than
 > get_sequence. I just need to have a script that people can cut and
 > paste, where they just input the filename with sequence IDs and the
 > database to download from (sort of like
 > 
http://cgr.harvard.edu/cbg/scriptome/Tools/Fetch.html#fetch_a_sequence_from_
 > a_popular_internet_database__fetch_sequence_web_)
 >
 > Thanks,
 >
 > -Amir Karger

-- 
MAURICIO HERRERA CUADRA
arareko@campus.iztacala.unam.mx
Laboratorio de Gen?tica
Unidad de Morfofisiolog?a y Funci?n
Facultad de Estudios Superiores Iztacala, UNAM

From bmoore at genetics.utah.edu  Fri Sep  2 14:53:17 2005
From: bmoore at genetics.utah.edu (Barry Moore)
Date: Fri Sep  2 14:52:02 2005
Subject: [Bioperl-l] Best method for downloading 100 sequences
Message-ID: 

Most of the bioperl remote database modules have something like this
from Bio::DB::GenBank...

    my $seqio = $gb->get_Stream_by_acc(['AC013798', 'AC021953'] );

You should put some sore of a sleep in there.  It runs in my mind that
NCBI asks for 3 seconds, but I could be wrong about that.  100 shouldn't
be a problem for them.  1000+ you might want to think about downloading
directly by ftp and parsing at home.

Barry

-----Original Message-----
From: bioperl-l-bounces@portal.open-bio.org
[mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Amir Karger
Sent: Friday, September 02, 2005 7:55 AM
To: 'bioperl-l@portal.open-bio.org'
Subject: [Bioperl-l] Best method for downloading 100 sequences

Hi.

I'm using Bioperl's nice get_sequence in my Scriptome toolbox, to fetch
a
single sequence. What would be the best method for downloading 100
sequences? Do I write a loop to call get_sequence N times? Will the
various
websites get angry at me for doing that? Would they be less angry if I
did a
1-second sleep after each download? I know NCBI has methods to pull in N
sequences, but I don't know whether Swiss et al. do too. I'm happy to
use
other Bioperl code, rather than get_sequence. I just need to have a
script
that people can cut and paste, where they just input the filename with
sequence IDs and the database to download from (sort of like
http://cgr.harvard.edu/cbg/scriptome/Tools/Fetch.html#fetch_a_sequence_f
rom_
a_popular_internet_database__fetch_sequence_web_)

Thanks,

-Amir Karger
_______________________________________________
Bioperl-l mailing list
Bioperl-l@portal.open-bio.org
http://portal.open-bio.org/mailman/listinfo/bioperl-l

From james.wasmuth at ed.ac.uk  Fri Sep  2 14:46:13 2005
From: james.wasmuth at ed.ac.uk (James Wasmuth)
Date: Fri Sep  2 15:11:47 2005
Subject: [Bioperl-l] Re: Best method for downloading 100 sequences
In-Reply-To: <43189618.9000205@campus.iztacala.unam.mx>
References: <43189618.9000205@campus.iztacala.unam.mx>
Message-ID: <43189DF5.9040008@ed.ac.uk>

 From past experience the lovely people at EMBL only get cross and hunt 
you down if you do it for thousands of sequences.

james




Mauricio Herrera Cuadra wrote:

> Hi Amir,
>
> I've done it before by using a loop without sleep() for the EMBL-Bank 
> and it works fine. I use an input file with all the sequence ID's 
> organized by gene/allele name so all the downloaded files get into 
> corresponding directories. I can send you the code if you want to 
> adjust it to your needs.
>
> Regards,
> Mauricio.
>
> --- Amir Karger  wrote:
> > Hi.
> >
> > I'm using Bioperl's nice get_sequence in my Scriptome toolbox, to
> > fetch a single sequence. What would be the best method for downloading
> > 100 sequences? Do I write a loop to call get_sequence N times? Will
> > the various websites get angry at me for doing that? Would they be
> > less angry if I did a 1-second sleep after each download? I know NCBI
> > has methods to pull in N sequences, but I don't know whether Swiss et
> > al. do too. I'm happy to use other Bioperl code, rather than
> > get_sequence. I just need to have a script that people can cut and
> > paste, where they just input the filename with sequence IDs and the
> > database to download from (sort of like
> > 
> http://cgr.harvard.edu/cbg/scriptome/Tools/Fetch.html#fetch_a_sequence_from_ 
>
> > a_popular_internet_database__fetch_sequence_web_)
> >
> > Thanks,
> >
> > -Amir Karger
>

-- 
"The best model of a cat is another cat or,
	 better, the cat itself"
		-Norbert Wiener

Blaxter Nematode Genomics Group   |
Institute of Evolutionary Biology |
Ashworth Laboratories, KB         | tel: +44 131 650 7403
University of Edinburgh           | web: www.nematodes.org/~james
Edinburgh                         |
EH9 3JT                           |
UK                                |

From astew at wam.umd.edu  Fri Sep  2 16:06:14 2005
From: astew at wam.umd.edu (Andrew Stewart)
Date: Fri Sep  2 16:11:49 2005
Subject: [Bioperl-l] finding position of every instance of a pattern in a
	sequence
Message-ID: <4318B0B6.3070403@wam.umd.edu>

I have problem I am trying to solve.  I know I can no doubt rig up some 
regular perl code to solve it, but I'm wondering if there is some 
BioPerl module that might make the task much simpler.

I have a single sequence composed of a concatenation of several contigs, 
with special 'contig boundary tags' marking the transition between every 
of neighboring contigs. 

I wrote a script that reads in the sequence, as well as glimmer output 
from the sequence in order to create a series of features (for output 
into a genbank file).  Because any of these features spanning across 
these contig boundaries probably isn't real, I also want to create a 
miscellaneous feature whereever there is a 'contig boundary tag'.

Basically what I need is a function that will search the entire sequence 
for my tag sequence, and return a list of the locations for every 
instance of it found in the sequence. 

Can anyone direct me to a module that handles this sort of thing, or do 
I need to rig it up outside of bioperl?


Thanks,
-Andrew Stewart
From thechans at citiz.net  Sat Sep  3 08:58:36 2005
From: thechans at citiz.net (thechans@citiz.net)
Date: Sat Sep  3 09:07:28 2005
Subject: [Bioperl-l] problem!
Message-ID: <1125752316527.7102.app3.Naesasoft.DIPC05U2>

Hi,
My goal is to use Bio::Index::GenBank to index a flat-file gb file(multiple seqs) and then retrieve the sequence. The following is a pre test but receives unpredicable result.

#Begin
use Bio::Seq;
use Bio::Index::GenBank;

my $inx1 = Bio::Index::GenBank->new('-filename' => 'multiple.gb.idx', -write_flag => 1 );
$inx1->make_index('multiple.gb');

@ids=$inx1->get_all_primary_ids;
print $ids[1],"\n";
print $ids[0],"\n";

my $seq1 = $inx1->get_Seq_by_primary_id($ids[1]);
print "$ids[1]:",$seq1->seq,"\n";

#End 
The final screen shows the two right primary ids. But other is blank and MSG:Can't call method "seq" on an undefined value at D:\local\tempidx.pl


it is a very simple test. I find no err in the program and in fact if i change the same code with Bio::Index::Fasta with corresponding fasta file it is OK.

where is the problem and How to solve it?


From Marc.Logghe at DEVGEN.com  Sat Sep  3 16:19:24 2005
From: Marc.Logghe at DEVGEN.com (Marc Logghe)
Date: Sat Sep  3 16:20:47 2005
Subject: [Bioperl-l] finding position of every instance of a pattern in
	asequence
Message-ID: <0C528E3670D8CE4B8E013F6749231AA62F5510@ANTARESIA.be.devgen.com>

Hi Andrew,
One way you could do it, is to use the external EMBOSS application
fuzznuc or dreg. There is a API available in bioperl-run
(Bio::Factory::EMBOSS). Nice thing is that you can give the EMBOSS
option -rformat2 gff so that your output is in GFF. The latter can
easily be turned into a feature object:
my $tag = Bio::SeqFeature::Generic->new(-gff_string => $gff); 

HTH,
Marc

> -----Original Message-----
> From: bioperl-l-bounces@portal.open-bio.org 
> [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of 
> Andrew Stewart
> Sent: Friday, September 02, 2005 10:06 PM
> To: bioperl-l@portal.open-bio.org
> Subject: [Bioperl-l] finding position of every instance of a 
> pattern in asequence
> 
> I have problem I am trying to solve.  I know I can no doubt 
> rig up some regular perl code to solve it, but I'm wondering 
> if there is some BioPerl module that might make the task much simpler.
> 
> I have a single sequence composed of a concatenation of 
> several contigs, with special 'contig boundary tags' marking 
> the transition between every of neighboring contigs. 
> 
> I wrote a script that reads in the sequence, as well as 
> glimmer output from the sequence in order to create a series 
> of features (for output into a genbank file).  Because any of 
> these features spanning across these contig boundaries 
> probably isn't real, I also want to create a miscellaneous 
> feature whereever there is a 'contig boundary tag'.
> 
> Basically what I need is a function that will search the 
> entire sequence for my tag sequence, and return a list of the 
> locations for every instance of it found in the sequence. 
> 
> Can anyone direct me to a module that handles this sort of 
> thing, or do I need to rig it up outside of bioperl?
> 
> 
> Thanks,
> -Andrew Stewart
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
> 

From hartzell at kestrel.alerce.com  Sat Sep  3 19:55:36 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Sat Sep  3 20:05:37 2005
Subject: [Bioperl-l] finding position of every instance of a pattern in
	asequence
In-Reply-To: <0C528E3670D8CE4B8E013F6749231AA62F5510@ANTARESIA.be.devgen.com>
References: <0C528E3670D8CE4B8E013F6749231AA62F5510@ANTARESIA.be.devgen.com>
Message-ID: <17178.14328.451226.314394@satchel.alerce.com>


If the 'contig boundary tags' are something that you can match
exactly, you can probably touch up this to do what you want: $seq and
$oligo are simple sequence strings (in this case I'm looking for exact
matches to a short oligo sequence) and you end up with an array full
of generic seqfeatures.


    while (($pos = index($seq, $oligo, $pos)) != -1) {
      my $feat = new Bio::SeqFeature::Generic(-start => $pos+1,
					      -end => $pos + length $oligo,
					      -strand => +1,
					      -primary => 'hit',
					      -source_tag => 'oligo_search',
					      -display_name => $name,
					      -seq_id => $seqobj->id(),
					      -tag => {
						       name => $name,
						       oligo_seq => $oligo,
						      },
					     );
      push @$results, $feat->gff_string;
      $pos++;
    }

g.


Marc Logghe writes:
 > Hi Andrew,
 > One way you could do it, is to use the external EMBOSS application
 > fuzznuc or dreg. There is a API available in bioperl-run
 > (Bio::Factory::EMBOSS). Nice thing is that you can give the EMBOSS
 > option -rformat2 gff so that your output is in GFF. The latter can
 > easily be turned into a feature object:
 > my $tag = Bio::SeqFeature::Generic->new(-gff_string => $gff); 
 > 
 > HTH,
 > Marc
 > 
 > > -----Original Message-----
 > > From: bioperl-l-bounces@portal.open-bio.org 
 > > [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of 
 > > Andrew Stewart
 > > Sent: Friday, September 02, 2005 10:06 PM
 > > To: bioperl-l@portal.open-bio.org
 > > Subject: [Bioperl-l] finding position of every instance of a 
 > > pattern in asequence
 > > 
 > > I have problem I am trying to solve.  I know I can no doubt 
 > > rig up some regular perl code to solve it, but I'm wondering 
 > > if there is some BioPerl module that might make the task much simpler.
 > > 
 > > I have a single sequence composed of a concatenation of 
 > > several contigs, with special 'contig boundary tags' marking 
 > > the transition between every of neighboring contigs. 
 > > 
 > > I wrote a script that reads in the sequence, as well as 
 > > glimmer output from the sequence in order to create a series 
 > > of features (for output into a genbank file).  Because any of 
 > > these features spanning across these contig boundaries 
 > > probably isn't real, I also want to create a miscellaneous 
 > > feature whereever there is a 'contig boundary tag'.
 > > 
 > > Basically what I need is a function that will search the 
 > > entire sequence for my tag sequence, and return a list of the 
 > > locations for every instance of it found in the sequence. 
 > > 
 > > Can anyone direct me to a module that handles this sort of 
 > > thing, or do I need to rig it up outside of bioperl?
 > > 
 > > 
 > > Thanks,
 > > -Andrew Stewart
 > > _______________________________________________
 > > Bioperl-l mailing list
 > > Bioperl-l@portal.open-bio.org
 > > http://portal.open-bio.org/mailman/listinfo/bioperl-l
 > > 
 > 
 > _______________________________________________
 > Bioperl-l mailing list
 > Bioperl-l@portal.open-bio.org
 > http://portal.open-bio.org/mailman/listinfo/bioperl-l
 > 
From ro_phls2 at dh.gov.hk  Sun Sep  4 21:01:58 2005
From: ro_phls2 at dh.gov.hk (Andrew Leung)
Date: Sun Sep  4 21:11:56 2005
Subject: [Bioperl-l] How to assess sequencing quality with Bioperl?
In-Reply-To: <431870EF.3000601@cenix-bioscience.com>
Message-ID: <20050905010206.BVWT11840.pimx07@Leungkcro>

Hi,
It seems that Phred is commonly used and I need to apply a license for it
first. Is it difficult to apply one from the author? Shall I apply
personally or on behalf of our department? The latter seems to involve much
admin work in my situation!
Andrew

-----Original Message-----
From: Andrew Walsh [mailto:walsh@cenix-bioscience.com] 
Sent: Friday, September 02, 2005 11:34 PM
To: andrew_leung@dh.gov.hk
Cc: bioperl-l@portal.open-bio.org
Subject: Re: [Bioperl-l] How to assess sequencing quality with Bioperl?

There is also a program from TIGR called 'lucy' that can be used to 
process the output from phred.  The Bioperl module for dealing with lucy 
files is Bio::Tools::Lucy.  If you use it, make sure to check out the 
most recent version in CVS, as a bug was recently fixed.

lucy:
http://www.tigr.org/software/sequencing.shtml

Andrew


Cook, Malcolm wrote:
> Andrew,
> 
> Following is a manpage for a program I wrote using Bioperl (and phred).
> 
> If you'd like it, let me know, I'll slap our institute approved software
> license on it an put a `make install`able tarball on a webpage
> somewhere...
> 
> Malcolm Cook - mec@stowers-institute.org - 816-926-4449
> Database Applications Manager - Bioinformatics
> Stowers Institute for Medical Research - Kansas City, MO  USA 
> 
> ________________________________________________________________________
> _________
> 
> SEQTRACESTATS(1)      User Contributed Perl Documentation
> SEQTRACESTATS(1)
> 
> 
> 
> SYNOPSIS
>        seqtracestats --bins=max1,max2,max3 --informat trace_format
> --readname-
>        convention attributelist=expression  --mtime daycount --abi2phd <
> trace
>        files > quality score summary
> 
>        Given a set of DNA sequence traces (or possibly a directory to
> find
>        them in based on their age), produce summary descriptive
> statistics of
>        the read quality (after optionally (re)base calling using phred).
> 
> OPTIONS
>        Their case is ignored, and they may be abbreviated to uniqueness
> (i.e.
>        --v instead of --verbose).
> 
>        Options may be specified on the command line, and may optionally
> also
>        be read from files by providing on the command line the path to
> the
>        file preceded by a '@'.  These option files provide simple access
> to
>        typical calling scenarios (such as an analysis that is repeatedly
>        invoked from the command line with the same parameters).
> Additionally,
>        if the current directory contains a file named
> seqtracestats.config, it
>        will be automatically used as an option file.
> 
>        --informat = PHD|SCF|ABI
>            Format of input files.  Defaults to PHD.  Can be any
> Bio::SeqIO
>            format that contains quality values, such as SCF.
> 
>            TODO: currently only PHD works.  Get the staden integration
> for ABI
>            and SCF files working with BioPerl.
> 
>        --bins = n,m,o,p
>            A comma separated list of numbers which should be in
> increasing
>            order.  They define the ranges into which the sequence
> quality
>            score for each base-pair read is binned; each number sets the
> maxi-
>            mum allowable value in the bin, with the minimum value being
> deter-
>            mined by the previous bin, if any.
> 
>            Note that any quality scores encountered which are greater
> than the
>            largest bin will not be included in any bin.  Otherwise, the
> sum of
>            the values in each of the bins will equal the entire sequence
>            length.
> 
>            I have not encountered any documentation specifying a maximum
> phred
>            score assigned in practice by any base caller.  However, I
> have
>            never encountered a score, or a report of a score, greater
> than 50.
>            So, you can pretty safely use 60 as your highest bin, which
> corre-
>            sponds to an error probability of one in a million.
> 
>            Defaults to --bins=20,30,40,50,60.
> 
>        --mtimeatt timeattributes
>            Allows specification of time attributes to appear in report.
> 
>        --readnameconvention attributelist=expression
>            A method of decoding attributes such as are typically encoded
> in
>            the name of files holding seqreads.
> 
>            Implemented as an association between a comma delimited list
> of
>            attribute names and a perl expression which, when evaluated
> yeilds
>            corresponding values for each attribute.  The expression is
> evalu-
>            ated in the context of $_ being the filename holding a
> seqread.
> 
>            Any attributes containing the word 'ignore' as a substring
> are
>            supressed from the summary.
> 
>            For example:
> 
>            "--readnameconvention='gene,library,plate,primer,platewellco-
>            ord,=split /[-_.]/'"
> 
>            when reading the file: VPL3-15-I-BSB460_A01.seq
> 
>            will assign to the current read attributes as follows:
> 
>                    gene => VPL3
>                    library => 15
>                    plate => I
>                    primer => BSB460
>                    platewellcoord => A01
> 
>            Named aliases exist as shorthand methods for decoding
> commonly used
>            naming conventions.  The following are predefined:
> 
>            TODO: IMPLEMENT THESE - THEY ARE NOT.
> 
>            simr1
>                Short for:
> '(gene,library,plate,primer,platewellcoord)=split
>                /[-_.]/'
> 
>        --mtime
>            Interpret the input files as directorys to search for ab1
> files
>            created (modified) mtime days ago.  If none supplied,
> defaults to
>            current working directory.
> 
>            This value is used as --mtime argument to the unix find
> command
>            (along with -daystart), and as such may be prefixed with '-'
> or
>            '+', to mean 'less than' or 'greater than' mtime days ago.
> 
>            May be specified multiple times to produce data ranges.  I.e.
>            --mtime -31 --mtime +0 will select files between 1 and 30
> days old
>            (inclusive)
> 
>            Implies --abi2phd
> 
>        --abi2phd
>            Input files are ab1 chromatogram files and they should be
> replaced
>            with corresponding quality file, generated using phred as
> needed.
> 
>            If there is an existing corresponding .phd (or .phd.1) file,
> it
>            will be used.
> 
>            Otherwise, the ab1 files will be (re) base-called by phred,
> gener-
>            ating sequence quality files in the same directory with
> addition
>            extension of ".phd".
> 
>            Note: if the input files already have corresponding '.phd' or
>            '.phd.1' file, it will NOT be re-basecalled and the existing
> QV
>            scores will be used.
> 
>        --help
>            Display command line usage with options.
> 
>        --man
>            Display complete manual page and exit.
> 
>        --verbose
>            Provides a trace of processing on STDERR.
> 
>        --version
>            Display the scripts version number and exit.
> 
> DESCRIPTION
>        Output is in csv format (comma separated values) and may be
> visualied
>        in Excel.
> 
>        TODO: Elaborate this description?
> 
> EXAMPLES
>        seqtracestats --mtime 1 > seqtracestats.txt
>            Summarize the result of run phred on all ab1 files created
> yester-
>            day which are subordinate to current directory, putting the
> results
>            in file seqtracestats.txt
> 
>        ./seqtracestats --mtime -10 '/n/facility/Genomics/Sequenc-
>        ing/2003/Molecular\ Biology/' --readname 'platerow,plate-
>        col=m/_([A-H])(\d{2})\./' --readname
> ',,submitter,lab=reverse(split
>        /\//)'
>            Summarize reads less than 10 days old, parsing out platerow
> and
>            plate col from the read filename, and interpreting selected
> direc-
>            tory components as the submitter of the sequencing request,
> and the
>            lab of which s/he is a member.
> 
>        seqtracestats --mtime +1,-30 ./2003 > ./2003/febqual.txt
>            Summarize trace files that are less than 30 but more than 1
> days
>            old which are within the directory ./2003 which is in turn
> within
>            the current directory.  Put the results in
> ./2003/febqual.txt.
> 
>            Note: if this example is preceded by
> 
>            cd /n/facility/Genomics/Sequencing/
> 
>            then additional parameters will be picked up from the file
> seq-
>            tracestats.config in that directory.  This file implements
> the
>            standard read naming conventions.
> 
>        seqtracestats ./t/data/*.phd.1 --informat=PHD --bins=20,30,60
> --read-
>        nameconvention='gene,primer,platenumber,platecoord,=split
> /[-_.]/'
>            Result of summarize the PHD formatted files into three bins,
> decod-
>            ing the selected attributes from the read name:
> 
>  
> trace_file_path,display_id,gene,primer,platenumber,platecoord,clone,vect
> or,FR,plate_id,platerow,platecol,length,gc_content,mean,variance,20,30,6
> 0,20,30,60
>  
> ./t/data/MC1081-M13F-20_A01.phd.1,MC1081-M13F-20_A01.ab1,MC1081,M13F,20,
> A01,MC1081,M13,F,20,A,01,807,0.563816604708798,39.2094175960347,118.5479
> 01273288,54,83,670,54,83,670
>  
> ./t/data/MC1081-M13R-48_A01.phd.1,MC1081-M13R-48_A01.ab1,MC1081,M13R,48,
> A01,MC1081,M13,R,48,A,01,802,0.553615960099751,39.2418952618453,113.7466
> 57077655,54,76,672,54,76,672
>  
> ./t/data/MC1081-M13R-48_A01.phd.1,MC1081-M13R-48_A01.ab1,MC1081,M13R,48,
> A01,MC1081,M13,R,48,A,01,802,0.553615960099751,39.2418952618453,113.7466
> 57077655,54,76,672,54,76,672
>             ...
> 
>        seqtracestats ./t/data/*.phd.1 --informat=PHD --bins=20,30,60
> --read-
>        nameconvention='clone,vector,FR,plate_id,platerow,plate-
>        col=m/^([^\-]+)-(\w+)([FR])-(\d+)_(\w{1})(\d+)\..*$/'
>            Result of running on the same data but parsing the readname
> differ-
>            ently, including pulling out read direction and plate row and
> col-
>            umn:
> 
>  
> trace_file_path,display_id,clone,vector,FR,plate_id,platerow,platecol,le
> ngth,gc_content,mean,variance,num bp q<=20,num bp q<=30,num bp q<=60
>  
> ./t/data/MC1081-M13F-20_A01.phd.1,MC1081-M13F-20_A01.ab1,MC1081,M13,F,20
> ,A,01,807,0.563816604708798,39.2094175960347,118.547901273288,54,83,670
>  
> ./t/data/MC1081-M13R-48_A01.phd.1,MC1081-M13R-48_A01.ab1,MC1081,M13,R,48
> ,A,01,802,0.553615960099751,39.2418952618453,113.746657077655,54,76,672
>  
> ./t/data/MC1082-M13F-20_B01.phd.1,MC1082-M13F-20_B01.ab1,MC1082,M13,F,20
> ,B,01,816,0.498774509803922,29.9803921568627,105.805750030073,143,236,43
> 7
>             ...
> 
>        seqtracestats ./t/data/*.phd.1 @./eg.config
>            Process those same files, taking command line options from
> eg.con-
>            fig in the current directory.
> 
>        seqtracestats ./t/data/*.phd.1
>            Process those same file, taking command line options from
> seq-
>            tracestats.config in the current working directory.
> 
> AUTHOR
>        Malcolm Cook (mec@stowers-institute.org)
> 
> DEPENDENCIES
>        perl, BioPerl, bioperl-ext,  Time::Seconds,
> Statistics::Descriptive,
>        /usr/local/bin/find
> 
>        Time::Piece
> 
> AVAILABILITY
>        Email the author for sources.
> 
> VERSION
>        $Revision: 1.4 $
> 
> TODO
>        include support for ABI files
>        support other output formats & destinations?  tab v. csv format
> v.
>        write to (mysql?) database.  Use DBD::AnyData for implementation?
>        create textual report similar to ABI's software
>        allow for reporting on trimmed sequences
>        contibute patch to Bio::Tools::SeqStats to BioPerl
> 
> REFERENCES
>        see the unix command trev, part of staden package, for viewing
> .scf
>        files under unix
>        regarding the conversion of ABI files using SEQIO
>  
> http://open-bio.org/pipermail/bioperl-l/2003-January/010749.html -
> 
> 
> 
> perl v5.8.6                       2005-09-02
> SEQTRACESTATS(1)
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
> 


-- 
------------------------------------------------------------------
Andrew Walsh, M.Sc.
Bioinformatics Software Engineer
IT Unit
Cenix BioScience GmbH
Tatzberg 47
01307 Dresden
Germany
Tel. +49-351-4173 137
Fax  +49-351-4173 109

public key: http://www.cenix-bioscience.com/public_keys/walsh.gpg
------------------------------------------------------------------

From limericksean at gmail.com  Mon Sep  5 05:26:06 2005
From: limericksean at gmail.com (Sean O'Keeffe)
Date: Mon Sep  5 07:11:54 2005
Subject: [Bioperl-l] Bio::Search results
In-Reply-To: 
References: 
Message-ID: <462784640509050226222fe55@mail.gmail.com>

Ok I am using bp 1.4 and haven't tried the new 1.5 (not sure how
stable it is yet) - I might install and test it.
Sean.

On 9/2/05, Barry Moore  wrote:
> Sean,
> 
> Am I guessing correctly that you are using bioperl 1.4?  You should not
> have to have header information at the top of each result.  The problem
> you are having is that the parser can read single result or multi result
> files.  I didn't write this parser, so I won't pretend to know it well,
> but when you are only getting the last result it is parsing your multi
> result file as a single result file and everything but the last result
> is being overwritten rather than pushed to an array (I think).  I
> introduced a problem in the header when I copied the data out of out of
> your e-mail, and fixing that made it work.  I just tried it with bioperl
> 1.4, and I get the same problem again (with a good header).  Diffing the
> 1.4 and 1.5 versions shows a lot of changes.  If you're on 1.4 try
> upgrading to 1.5 or live from CVS, and see if that solves your problem.
> The two attached files are your data, and your script as I have been
> running them.  They should work as is with 1.5.
> 
> Barry
> 
> -----Original Message-----
> From: Sean O'Keeffe [mailto:limericksean@gmail.com]
> Sent: Friday, September 02, 2005 3:32 AM
> To: Barry Moore
> Cc: Bioperl List
> Subject: Re: [Bioperl-l] Bio::Search results
> 
> I have those four lines (all contained on separate lines) but it didn't
> work .
> 
> I ran "gawk '{if(/^\/\/$/) {print "//\n\nHMMER 2.3.2 (Oct 2003)"} else
> {print}}' my_file > whatever" on the pfam file to include a HMMER
> header after the // separator for each result.
> 
> It now works fine. I still don't understand why I need to include this
> header to parse the file. Although from memory don't Blast reports all
> include Blast header lines to separate next results?
> By the way I think that its the mailer that seems to be altering the
> text in these scripts (don't know where the "=3D" came from - it's not
> in my original). I'm running a standard linux (suse 9.0) using nedit
> as an editor.
> Sean.
> 
> On 9/2/05, Barry Moore  wrote:
> > Sean I see that my mailer messed up the line formatting also.  What I
> > meant was you should have the top four lines like this:
> >
> > #Line 1: hmmpfam - search one or more sequences against HMM database
> > #Line 2: HMMER 2.3.2(Oct 2003)
> > #Line 3: Copyright (C) 1992-2003 HHMI/Washington University School of
> > #Line 4: Medicine Freely distributed under the GNU General Public
> > License (GPL)
> >
> > If you have that, and fix the hsp to hit error mentioned it works for
> > me.
> >
> > Barry
> >
> > -----Original Message-----
> > From: bioperl-l-bounces@portal.open-bio.org
> > [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Barry
> Moore
> > Sent: Thursday, September 01, 2005 11:34 AM
> > To: Bioperl List
> > Subject: RE: [Bioperl-l] Bio::Search results
> >
> > Sean-
> >
> >
> >
> > The top of you input hmmpfam file has these four lines:
> >
> >
> >
> > hmmpfam - search one or more sequences against HMM database HMMER
> 2.3.2
> > (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School
> of
> > Medicine Freely distributed under the GNU General Public License (GPL)
> >
> >
> >
> > When I copied that out of you e-mail and into emacs on my computer I
> got
> > it all as one line like this:
> >
> >
> >
> > hmmpfam - search one or more sequences against HMM database HMMER
> 2.3.2
> > (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School
> of
> > Medicine Freely distributed under the GNU General Public License (GPL)
> >
> >
> >
> > The parser needs to see a line beginning with HMMER to trigger setting
> > an internal variable called _reporttype (among other things).  Since
> > this never happened with a single line header I got the same results
> you
> > did.  Your header lines look OK in the e-mail you sent me, but
> assuming
> > you have the same problem with you header lines that I did, fixing
> that
> > should lead you to your next problem...
> >
> >
> >
> > This line of your code has an error:
> >
> >
> >
> > next unless ($hsp->name =~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i);
> >
> >
> >
> > HSP objects don't have names but their associated hit objects do, so
> > this makes your script work as intended:
> >
> >
> >
> > next unless ($hit->name =~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i);
> >
> >
> >
> > I wonder if the header line problems could be the result of cross
> > platform cutting and pasting (or just cross platform file
> > incompatibilities).  I noticed also that in you script that you sent
> the
> > '=' turned into '=3D'.  What computer platforms do you use in your
> work?
> >
> >
> >
> > HTH
> >
> >
> >
> > Barry
> >
> >
> >
> > -----Original Message-----
> >
> > From: Sean O'Keeffe [mailto:limericksean@gmail.com]
> >
> > Sent: Tuesday, August 30, 2005 9:28 AM
> >
> > To: Barry Moore
> >
> > Cc: bioperl-l@portal.open-bio.org
> >
> > Subject: Re: [Bioperl-l] Bio::Search results
> >
> >
> >
> > Hi Barry, thanks for the reply. Below is a snippet of the file (I
> > generated it with hmmpfam using the alignment flag set to -A 0, to
> > remove alignments - this shouldn't affect the parsing of the file) :
> >
> >
> >
> > hmmpfam - search one or more sequences against HMM database HMMER
> 2.3.2
> > (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School
> of
> > Medicine Freely distributed under the GNU General Public License (GPL)
> >
> > - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
> -
> >
> > HMM file:                 /usr/local/lib/pfam-tm
> >
> > Sequence file:            Mus_musculus.NCBIM34.jul.pep.fa-short
> >
> > - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
> >
> >
> >
> > Query sequence: ENSMUSP00000089702
> >
> > Accession:      [none]
> >
> > Description:    [none]
> >
> >
> >
> > Scores for sequence family classification (score includes all
> domains):
> >
> > Model    Description                                    Score
> E-value
> > N
> >
> > -------- -----------                                    -----
> -------
> > ---
> >
> >       [no hits above thresholds]
> >
> >
> >
> > Parsed for domains:
> >
> > Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> >
> > -------- ------- ----- -----    ----- -----      -----  -------
> >
> >       [no hits above thresholds]
> >
> > //
> >
> >
> >
> > Query sequence: ENSMUSP00000089701
> >
> > Accession:      [none]
> >
> > Description:    [none]
> >
> >
> >
> > Scores for sequence family classification (score includes all
> domains):
> >
> > Model    Description                                    Score
> E-value
> > N
> >
> > -------- -----------                                    -----
> -------
> > ---
> >
> >       [no hits above thresholds]
> >
> >
> >
> > Parsed for domains:
> >
> > Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> >
> > -------- ------- ----- -----    ----- -----      -----  -------
> >
> >       [no hits above thresholds]
> >
> > //
> >
> >
> >
> > Query sequence: ENSMUSP00000020094
> >
> > Accession:      [none]
> >
> > Description:    [none]
> >
> >
> >
> > Scores for sequence family classification (score includes all
> domains):
> >
> > Model    Description                                    Score
> E-value
> > N
> >
> > -------- -----------                                    -----
> -------
> > ---
> >
> > LRR_1    Leucine Rich Repeat                             55.0
> 3.7e-15
> > 6
> >
> > LRRNT    Leucine rich repeat N-terminal domain           30.1
> 1.1e-07
> > 1
> >
> >
> >
> > Parsed for domains:
> >
> > Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> >
> > -------- ------- ----- -----    ----- -----      -----  -------
> >
> > LRRNT      1/1     117   142 ..     1    34 []    30.1  1.1e-07
> >
> > LRR_1      1/6     168   191 ..     1    25 []    14.7   0.0049
> >
> > LRR_1      2/6     192   210 ..     1    25 []     9.1      0.2
> >
> > LRR_1      3/6     212   237 ..     1    25 []     8.4     0.26
> >
> > LRR_1      4/6     238   257 ..     1    25 []    10.3      0.1
> >
> > LRR_1      5/6     259   282 ..     1    25 []    10.1     0.12
> >
> > LRR_1      6/6     290   314 ..     1    25 []     2.4        2
> >
> > //
> >
> >
> >
> > Query sequence: ENSMUSP00000074175
> >
> > Accession:      [none]
> >
> > Description:    [none]
> >
> >
> >
> > Scores for sequence family classification (score includes all
> domains):
> >
> > Model    Description                                    Score
> E-value
> > N
> >
> > -------- -----------                                    -----
> -------
> > ---
> >
> > CUB      CUB domain                                     232.5
> 1.3e-68
> > 2
> >
> > Trypsin  Trypsin                                        206.0
> 1.2e-60
> > 1
> >
> > Sushi    Sushi domain (SCR repeat)                       88.7
> 2.6e-25
> > 2
> >
> > EGF_CA   Calcium binding EGF domain                      29.4
> 1.8e-07
> > 1
> >
> >
> >
> > Parsed for domains:
> >
> > Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> >
> > -------- ------- ----- -----    ----- -----      -----  -------
> >
> > CUB        1/2      16   137 ..     1   116 []    70.0  1.1e-19
> >
> > EGF_CA     1/1     141   188 ..     1    55 []    29.4  1.8e-07
> >
> > CUB        2/2     192   301 ..     1   116 []   162.5  1.5e-47
> >
> > Sushi      1/2     308   370 ..     1    62 []    47.5  6.5e-13
> >
> > Sushi      2/2     375   446 ..     1    62 []    41.2  5.1e-11
> >
> > Trypsin    1/1     463   698 ..     1   259 []   206.0  1.2e-60
> >
> > //
> >
> >
> >
> >
> >
> > Cheers,
> >
> > Sean.
> >
> >
> >
> >
> >
> >
> >
> > On 8/30/05, Barry Moore  wrote:
> >
> > > Sean,
> >
> > >
> >
> > > Don't see anything obviously wrong.  If you want to send your input
> >
> > > file, I'll try to recreate the problem.
> >
> > >
> >
> > > Barry
> >
> > >
> >
> > > -----Original Message-----
> >
> > > From: bioperl-l-bounces@portal.open-bio.org
> >
> > > [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Sean
> >
> > > O'Keeffe
> >
> > > Sent: Tuesday, August 30, 2005 2:55 AM
> >
> > > To: bioperl-l@portal.open-bio.org
> >
> > > Subject: [Bioperl-l] Bio::Search results
> >
> > >
> >
> > > Hi,
> >
> > > The following code snippet is something I use to extract information
> >
> > > from hmmer result files:
> >
> > >
> >
> > > use Bio::SearchIO;
> >
> > >
> >
> > > my $in =3D new Bio::SearchIO( -format =3D> 'hmmer',  -file =3D>
> >
> > > $ARGV[0] ); while(my $result =3D $in->next_result) {
> >
> > >   print $result->query_name(),
> "\n",$result->query_description(),"\n";
> >
> > >   while (my $hit =3D $result->next_hit) {
> >
> > >     while(my $hsp =3D $hit->next_domain) {
> >
> > >       next unless ($hsp->name =3D~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i);
> >
> > >       print $hsp->start(),"\t",$hsp->end(),"\t",$hsp->evalue(),"\n";
> >
> > >     }
> >
> > >   }
> >
> > > }
> >
> > >
> >
> > > The input file is generated by hmmpfam and is given at the command
> >
> > > line. I use it to scan for specific domain names e.g ig, fn3 lrr
> etc.
> >
> > > This code works for the first loop and then ends so I get the name
> and
> >
> >
> > > description (no hsp values as their are none for this result):
> >
> > >
> >
> > > ENSMUSP00000065602=20
> >
> > > pep:novel supercontig::NT_085813:405:1510:-1 gene:ENSMUSG00000054059
> >
> > > transcript:ENSMUST00000066517
> >
> > >
> >
> > > My question is why does the loop end after one instance.
> Incidentally
> >
> > > the outputted  name and description above are the last ones in the
> >
> > > hmmer file (maybe the file is read from the back??? - don't know if
> >
> > > this means anything). Any thoughts would be appreciated. Thanks,
> >
> > > Sean.
> >
> > >
> >
> > > _______________________________________________
> >
> > > Bioperl-l mailing list
> >
> > > Bioperl-l@portal.open-bio.org
> >
> > > http://portal.open-bio.org/mailman/listinfo/bioperl-l
> >
> > >
> >
> >
> >
> >
> >
> >
> > _______________________________________________
> > Bioperl-l mailing list
> > Bioperl-l@portal.open-bio.org
> > http://portal.open-bio.org/mailman/listinfo/bioperl-l
> >
> > _______________________________________________
> > Bioperl-l mailing list
> > Bioperl-l@portal.open-bio.org
> > http://portal.open-bio.org/mailman/listinfo/bioperl-l
> >
> 
> 
>

From bmoore at genetics.utah.edu  Mon Sep  5 14:18:25 2005
From: bmoore at genetics.utah.edu (Barry Moore)
Date: Mon Sep  5 14:05:35 2005
Subject: [Bioperl-l] Bio::Search results
Message-ID: 

Stability of 1.5 depends on what parts you're using I guess.  You can
always keep 1.4 installed, and then have a live CVS version in your home
directory.  Just use your .bashrc or .cshrc file to set PERL5LIB to the
path in your home directory.  This will put the path to the CVS version
at the top of @INC so it gets used first.  Then in testing or if you
have problems, you could shift the 1.5 path off of @INC to revert to
1.4.

Barry

-----Original Message-----
From: bioperl-l-bounces@portal.open-bio.org
[mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Sean
O'Keeffe
Sent: Monday, September 05, 2005 3:26 AM
To: Barry Moore
Cc: Bioperl List
Subject: Re: [Bioperl-l] Bio::Search results

Ok I am using bp 1.4 and haven't tried the new 1.5 (not sure how
stable it is yet) - I might install and test it.
Sean.

On 9/2/05, Barry Moore  wrote:
> Sean,
> 
> Am I guessing correctly that you are using bioperl 1.4?  You should
not
> have to have header information at the top of each result.  The
problem
> you are having is that the parser can read single result or multi
result
> files.  I didn't write this parser, so I won't pretend to know it
well,
> but when you are only getting the last result it is parsing your multi
> result file as a single result file and everything but the last result
> is being overwritten rather than pushed to an array (I think).  I
> introduced a problem in the header when I copied the data out of out
of
> your e-mail, and fixing that made it work.  I just tried it with
bioperl
> 1.4, and I get the same problem again (with a good header).  Diffing
the
> 1.4 and 1.5 versions shows a lot of changes.  If you're on 1.4 try
> upgrading to 1.5 or live from CVS, and see if that solves your
problem.
> The two attached files are your data, and your script as I have been
> running them.  They should work as is with 1.5.
> 
> Barry
> 
> -----Original Message-----
> From: Sean O'Keeffe [mailto:limericksean@gmail.com]
> Sent: Friday, September 02, 2005 3:32 AM
> To: Barry Moore
> Cc: Bioperl List
> Subject: Re: [Bioperl-l] Bio::Search results
> 
> I have those four lines (all contained on separate lines) but it
didn't
> work .
> 
> I ran "gawk '{if(/^\/\/$/) {print "//\n\nHMMER 2.3.2 (Oct 2003)"} else
> {print}}' my_file > whatever" on the pfam file to include a HMMER
> header after the // separator for each result.
> 
> It now works fine. I still don't understand why I need to include this
> header to parse the file. Although from memory don't Blast reports all
> include Blast header lines to separate next results?
> By the way I think that its the mailer that seems to be altering the
> text in these scripts (don't know where the "=3D" came from - it's not
> in my original). I'm running a standard linux (suse 9.0) using nedit
> as an editor.
> Sean.
> 
> On 9/2/05, Barry Moore  wrote:
> > Sean I see that my mailer messed up the line formatting also.  What
I
> > meant was you should have the top four lines like this:
> >
> > #Line 1: hmmpfam - search one or more sequences against HMM database
> > #Line 2: HMMER 2.3.2(Oct 2003)
> > #Line 3: Copyright (C) 1992-2003 HHMI/Washington University School
of
> > #Line 4: Medicine Freely distributed under the GNU General Public
> > License (GPL)
> >
> > If you have that, and fix the hsp to hit error mentioned it works
for
> > me.
> >
> > Barry
> >
> > -----Original Message-----
> > From: bioperl-l-bounces@portal.open-bio.org
> > [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Barry
> Moore
> > Sent: Thursday, September 01, 2005 11:34 AM
> > To: Bioperl List
> > Subject: RE: [Bioperl-l] Bio::Search results
> >
> > Sean-
> >
> >
> >
> > The top of you input hmmpfam file has these four lines:
> >
> >
> >
> > hmmpfam - search one or more sequences against HMM database HMMER
> 2.3.2
> > (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School
> of
> > Medicine Freely distributed under the GNU General Public License
(GPL)
> >
> >
> >
> > When I copied that out of you e-mail and into emacs on my computer I
> got
> > it all as one line like this:
> >
> >
> >
> > hmmpfam - search one or more sequences against HMM database HMMER
> 2.3.2
> > (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School
> of
> > Medicine Freely distributed under the GNU General Public License
(GPL)
> >
> >
> >
> > The parser needs to see a line beginning with HMMER to trigger
setting
> > an internal variable called _reporttype (among other things).  Since
> > this never happened with a single line header I got the same results
> you
> > did.  Your header lines look OK in the e-mail you sent me, but
> assuming
> > you have the same problem with you header lines that I did, fixing
> that
> > should lead you to your next problem...
> >
> >
> >
> > This line of your code has an error:
> >
> >
> >
> > next unless ($hsp->name =~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i);
> >
> >
> >
> > HSP objects don't have names but their associated hit objects do, so
> > this makes your script work as intended:
> >
> >
> >
> > next unless ($hit->name =~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i);
> >
> >
> >
> > I wonder if the header line problems could be the result of cross
> > platform cutting and pasting (or just cross platform file
> > incompatibilities).  I noticed also that in you script that you sent
> the
> > '=' turned into '=3D'.  What computer platforms do you use in your
> work?
> >
> >
> >
> > HTH
> >
> >
> >
> > Barry
> >
> >
> >
> > -----Original Message-----
> >
> > From: Sean O'Keeffe [mailto:limericksean@gmail.com]
> >
> > Sent: Tuesday, August 30, 2005 9:28 AM
> >
> > To: Barry Moore
> >
> > Cc: bioperl-l@portal.open-bio.org
> >
> > Subject: Re: [Bioperl-l] Bio::Search results
> >
> >
> >
> > Hi Barry, thanks for the reply. Below is a snippet of the file (I
> > generated it with hmmpfam using the alignment flag set to -A 0, to
> > remove alignments - this shouldn't affect the parsing of the file) :
> >
> >
> >
> > hmmpfam - search one or more sequences against HMM database HMMER
> 2.3.2
> > (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School
> of
> > Medicine Freely distributed under the GNU General Public License
(GPL)
> >
> > - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
-
> -
> >
> > HMM file:                 /usr/local/lib/pfam-tm
> >
> > Sequence file:            Mus_musculus.NCBIM34.jul.pep.fa-short
> >
> > - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
> >
> >
> >
> > Query sequence: ENSMUSP00000089702
> >
> > Accession:      [none]
> >
> > Description:    [none]
> >
> >
> >
> > Scores for sequence family classification (score includes all
> domains):
> >
> > Model    Description                                    Score
> E-value
> > N
> >
> > -------- -----------                                    -----
> -------
> > ---
> >
> >       [no hits above thresholds]
> >
> >
> >
> > Parsed for domains:
> >
> > Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> >
> > -------- ------- ----- -----    ----- -----      -----  -------
> >
> >       [no hits above thresholds]
> >
> > //
> >
> >
> >
> > Query sequence: ENSMUSP00000089701
> >
> > Accession:      [none]
> >
> > Description:    [none]
> >
> >
> >
> > Scores for sequence family classification (score includes all
> domains):
> >
> > Model    Description                                    Score
> E-value
> > N
> >
> > -------- -----------                                    -----
> -------
> > ---
> >
> >       [no hits above thresholds]
> >
> >
> >
> > Parsed for domains:
> >
> > Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> >
> > -------- ------- ----- -----    ----- -----      -----  -------
> >
> >       [no hits above thresholds]
> >
> > //
> >
> >
> >
> > Query sequence: ENSMUSP00000020094
> >
> > Accession:      [none]
> >
> > Description:    [none]
> >
> >
> >
> > Scores for sequence family classification (score includes all
> domains):
> >
> > Model    Description                                    Score
> E-value
> > N
> >
> > -------- -----------                                    -----
> -------
> > ---
> >
> > LRR_1    Leucine Rich Repeat                             55.0
> 3.7e-15
> > 6
> >
> > LRRNT    Leucine rich repeat N-terminal domain           30.1
> 1.1e-07
> > 1
> >
> >
> >
> > Parsed for domains:
> >
> > Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> >
> > -------- ------- ----- -----    ----- -----      -----  -------
> >
> > LRRNT      1/1     117   142 ..     1    34 []    30.1  1.1e-07
> >
> > LRR_1      1/6     168   191 ..     1    25 []    14.7   0.0049
> >
> > LRR_1      2/6     192   210 ..     1    25 []     9.1      0.2
> >
> > LRR_1      3/6     212   237 ..     1    25 []     8.4     0.26
> >
> > LRR_1      4/6     238   257 ..     1    25 []    10.3      0.1
> >
> > LRR_1      5/6     259   282 ..     1    25 []    10.1     0.12
> >
> > LRR_1      6/6     290   314 ..     1    25 []     2.4        2
> >
> > //
> >
> >
> >
> > Query sequence: ENSMUSP00000074175
> >
> > Accession:      [none]
> >
> > Description:    [none]
> >
> >
> >
> > Scores for sequence family classification (score includes all
> domains):
> >
> > Model    Description                                    Score
> E-value
> > N
> >
> > -------- -----------                                    -----
> -------
> > ---
> >
> > CUB      CUB domain                                     232.5
> 1.3e-68
> > 2
> >
> > Trypsin  Trypsin                                        206.0
> 1.2e-60
> > 1
> >
> > Sushi    Sushi domain (SCR repeat)                       88.7
> 2.6e-25
> > 2
> >
> > EGF_CA   Calcium binding EGF domain                      29.4
> 1.8e-07
> > 1
> >
> >
> >
> > Parsed for domains:
> >
> > Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> >
> > -------- ------- ----- -----    ----- -----      -----  -------
> >
> > CUB        1/2      16   137 ..     1   116 []    70.0  1.1e-19
> >
> > EGF_CA     1/1     141   188 ..     1    55 []    29.4  1.8e-07
> >
> > CUB        2/2     192   301 ..     1   116 []   162.5  1.5e-47
> >
> > Sushi      1/2     308   370 ..     1    62 []    47.5  6.5e-13
> >
> > Sushi      2/2     375   446 ..     1    62 []    41.2  5.1e-11
> >
> > Trypsin    1/1     463   698 ..     1   259 []   206.0  1.2e-60
> >
> > //
> >
> >
> >
> >
> >
> > Cheers,
> >
> > Sean.
> >
> >
> >
> >
> >
> >
> >
> > On 8/30/05, Barry Moore  wrote:
> >
> > > Sean,
> >
> > >
> >
> > > Don't see anything obviously wrong.  If you want to send your
input
> >
> > > file, I'll try to recreate the problem.
> >
> > >
> >
> > > Barry
> >
> > >
> >
> > > -----Original Message-----
> >
> > > From: bioperl-l-bounces@portal.open-bio.org
> >
> > > [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Sean
> >
> > > O'Keeffe
> >
> > > Sent: Tuesday, August 30, 2005 2:55 AM
> >
> > > To: bioperl-l@portal.open-bio.org
> >
> > > Subject: [Bioperl-l] Bio::Search results
> >
> > >
> >
> > > Hi,
> >
> > > The following code snippet is something I use to extract
information
> >
> > > from hmmer result files:
> >
> > >
> >
> > > use Bio::SearchIO;
> >
> > >
> >
> > > my $in =3D new Bio::SearchIO( -format =3D> 'hmmer',  -file =3D>
> >
> > > $ARGV[0] ); while(my $result =3D $in->next_result) {
> >
> > >   print $result->query_name(),
> "\n",$result->query_description(),"\n";
> >
> > >   while (my $hit =3D $result->next_hit) {
> >
> > >     while(my $hsp =3D $hit->next_domain) {
> >
> > >       next unless ($hsp->name =3D~
/^ig|^lrr|^fn3|^egf|^tsp|^psi/i);
> >
> > >       print
$hsp->start(),"\t",$hsp->end(),"\t",$hsp->evalue(),"\n";
> >
> > >     }
> >
> > >   }
> >
> > > }
> >
> > >
> >
> > > The input file is generated by hmmpfam and is given at the command
> >
> > > line. I use it to scan for specific domain names e.g ig, fn3 lrr
> etc.
> >
> > > This code works for the first loop and then ends so I get the name
> and
> >
> >
> > > description (no hsp values as their are none for this result):
> >
> > >
> >
> > > ENSMUSP00000065602=20
> >
> > > pep:novel supercontig::NT_085813:405:1510:-1
gene:ENSMUSG00000054059
> >
> > > transcript:ENSMUST00000066517
> >
> > >
> >
> > > My question is why does the loop end after one instance.
> Incidentally
> >
> > > the outputted  name and description above are the last ones in the
> >
> > > hmmer file (maybe the file is read from the back??? - don't know
if
> >
> > > this means anything). Any thoughts would be appreciated. Thanks,
> >
> > > Sean.
> >
> > >
> >
> > > _______________________________________________
> >
> > > Bioperl-l mailing list
> >
> > > Bioperl-l@portal.open-bio.org
> >
> > > http://portal.open-bio.org/mailman/listinfo/bioperl-l
> >
> > >
> >
> >
> >
> >
> >
> >
> > _______________________________________________
> > Bioperl-l mailing list
> > Bioperl-l@portal.open-bio.org
> > http://portal.open-bio.org/mailman/listinfo/bioperl-l
> >
> > _______________________________________________
> > Bioperl-l mailing list
> > Bioperl-l@portal.open-bio.org
> > http://portal.open-bio.org/mailman/listinfo/bioperl-l
> >
> 
> 
>

_______________________________________________
Bioperl-l mailing list
Bioperl-l@portal.open-bio.org
http://portal.open-bio.org/mailman/listinfo/bioperl-l

From cjfields at uiuc.edu  Mon Sep  5 23:51:28 2005
From: cjfields at uiuc.edu (Christopher Fields)
Date: Mon Sep  5 23:56:07 2005
Subject: [Bioperl-l] About RNA representations in Bioperl
Message-ID: <4a95d83e.375acae6.8198700@expms6.cites.uiuc.edu>

I am using a few programs to scan genome sequences for potential sites for 
RNA-binding proteins.  I want to get these into GFF format for eventual import 
into a mySQL database for GBrowse in order to map the hits against CDS and 
predicted rho-independent terminators in bacterial genomes.  For the moment, I 
plan on either using 
Bio::SeqFeature::Generic (they are pretty simple matches to sequences, much 
like tRNAscan-SE or BLAST, with start, stop, score, and strand information) or 
creating my own class inheriting from Bio::SeqFeature::Generic.  However, these 
regions are protein-binding regions on RNA, not DNA (much like a ribosome-
binding site).  Should I just use misc_bind or protein_bind as a feature label and 
not worry about it?

I asked a similar question recently, which about what SO term would be 
appropriate.  However, I am trying to start out with a simple approach first and 
then get into the details (like secondary structures, free energies, etc), so any 
information would be helpful (and greatly appreciated).

Chris Fields
From brian_osborne at cognia.com  Tue Sep  6 10:10:17 2005
From: brian_osborne at cognia.com (Brian Osborne)
Date: Tue Sep  6 10:18:12 2005
Subject: [Bioperl-l] problem!
In-Reply-To: <1125752316527.7102.app3.Naesasoft.DIPC05U2>
Message-ID: 

thechans,

Your code works fine for me, bioperl-live, it's possible there's something
odd about your Genbank file.

Brian O.


On 9/3/05 8:58 AM, "thechans@citiz.net"  wrote:

> Hi,
> My goal is to use Bio::Index::GenBank to index a flat-file gb file(multiple
> seqs) and then retrieve the sequence. The following is a pre test but receives
> unpredicable result.
> 
> #Begin
> use Bio::Seq;
> use Bio::Index::GenBank;
> 
> my $inx1 = Bio::Index::GenBank->new('-filename' => 'multiple.gb.idx',
> -write_flag => 1 );
> $inx1->make_index('multiple.gb');
> 
> @ids=$inx1->get_all_primary_ids;
> print $ids[1],"\n";
> print $ids[0],"\n";
> 
> my $seq1 = $inx1->get_Seq_by_primary_id($ids[1]);
> print "$ids[1]:",$seq1->seq,"\n";
> 
> #End 
> The final screen shows the two right primary ids. But other is blank and
> MSG:Can't call method "seq" on an undefined value at D:\local\tempidx.pl
> 
> 
> it is a very simple test. I find no err in the program and in fact if i change
> the same code with Bio::Index::Fasta with corresponding fasta file it is OK.
> 
> where is the problem and How to solve it?
> 
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l


From jason.stajich at duke.edu  Tue Sep  6 10:11:22 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Tue Sep  6 10:43:59 2005
Subject: [Bioperl-l] Fwd: BIoPerl and user complaints. 
References: <69BA0F938FAC6A4CBEF49461720696F20A6B6248@nihexchange16.nih.gov>
Message-ID: <02542A2B-63FB-40A6-9D46-7C707435361F@duke.edu>



Begin forwarded message:

> From: "Mcginnis, Scott (NIH/NLM/NCBI)" 
> Date: September 6, 2005 9:38:10 AM EDT
> To: "'Barry Moore'" ,  
> "'jason@bioperl.org'" 
> Subject: BIoPerl and user complaints.
>
>
> Dear Jason and Barry:
>
> We recently received an e-mail from a user complaining that a small  
> change
> to the format of the BLAST output resulted in a problem with the  
> BPLite
> parser.
>
> BPLite appears to be parsing the plain text output of the BLAST  
> results and
> simple change such as removing a colon form the output causes it to  
> not work
> properly.
>
> NCBI does not advocate the use of the plain text or HTML of BLAST  
> output as
> a means of accurately parsing the data. We reserve the right to  
> alter the
> appearance of "human readable" formats precisely to make them more  
> usable to
> human readers of the results. It's not convenient for us to tie the  
> human
> readable results down to a software compatible format.
>
> To this effect we make the ASN.1 and XML outputs available for  
> parsing the
> BLAST output. We support these formats and we will not alter or  
> change them
> without ample forewarning and support.
>
> You may wish to repair your BPLite program, but can I also ask that  
> you put
> some sort of disclaimer in it that it relies on a format which is  
> subject to
> change with out advanced notice.
>
> Thanks,
>
> Scott McGinnis.
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From brian_osborne at cognia.com  Tue Sep  6 22:31:51 2005
From: brian_osborne at cognia.com (Brian Osborne)
Date: Tue Sep  6 22:39:57 2005
Subject: [Bioperl-l] Missing SeqIO tests - need example files
Message-ID: 

bioperl-l,

A while back I took the general t/SeqIO.t file and split it into separate
test scripts, one per format. This exercise showed that there were a number
of SeqIO formats that weren?t being tested. On one hand it may be that a
given format is a bit antiquated or little used. However, I don?t think it?s
the case that all the formats below are unused.

  36 Bio/SeqIO/tigr.pm
  16 Bio/SeqIO/tigrxml.pm
  48 Bio/SeqIO/bsml.pm
   4 Bio/SeqIO/exp.pm
   8 Bio/SeqIO/fastq.pm
  44 Bio/SeqIO/chadoxml.pm
  20 Bio/SeqIO/chaos.pm
   4 Bio/SeqIO/pln.pm
   4 Bio/SeqIO/chaosxml.pm

If you have a sequence file in any of these formats can you send it to me?
That we?ll be able to create simple test scripts for all of our important
formats.

Thanks again,

Brian O.

From fgarret at ub.edu  Wed Sep  7 11:15:40 2005
From: fgarret at ub.edu (Filipe Garrett)
Date: Wed Sep  7 11:24:37 2005
Subject: [Bioperl-l] delete some nodes in a Bio::Tree
Message-ID: <431F041C.5010500@ub.edu>

Hi all,

I have been looking at Bio::Tree and I would like to ask if there is a
way to delete the nodes that don't match with the names in a list.

The idea would be to delete some nodes in a Bio::Tree object.

Any idea about how I could do that?

Thanks in advance,

Bests,

    Filipe.

From jason.stajich at duke.edu  Wed Sep  7 11:46:32 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Wed Sep  7 11:35:10 2005
Subject: [Bioperl-l] delete some nodes in a Bio::Tree
In-Reply-To: <431F041C.5010500@ub.edu>
References: <431F041C.5010500@ub.edu>
Message-ID: <4CA1D2E6-54B7-465F-BB61-36F4AF406B45@duke.edu>

Don't forget to look at the HOWTO:
  http://bioperl.org/HOWTOs/html/Trees.html

There is a remove_Node function for Bio::Tree objects in  
Bio::Tree::TreeFunctionI module.
You use it like:
   $tree->remove_Node($node);

So for example to remove all the nodes (presumably terminal taxa)  
which start with 'hsap':
for my $node ( $tree->get_nodes ) {
   if( $node->id =~ /^hsap/ ) {
    $tree->remove_Node($node);
   }
}

I've just fixed a small bug when a node is last in a clade so you'd  
do best to grab the code from CVS , at least the Bio/Tree and Bio/ 
TreeIO directories.
http://cvs.open-bio.org/

-jason
On Sep 7, 2005, at 11:15 AM, Filipe Garrett wrote:

> Hi all,
>
> I have been looking at Bio::Tree and I would like to ask if there is a
> way to delete the nodes that don't match with the names in a list.
>
> The idea would be to delete some nodes in a Bio::Tree object.
>
> Any idea about how I could do that?
>
> Thanks in advance,
>
> Bests,
>
>    Filipe.
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From hlapp at gnf.org  Thu Sep  8 20:05:09 2005
From: hlapp at gnf.org (Hilmar Lapp)
Date: Thu Sep  8 20:23:55 2005
Subject: [Bioperl-l] Re: LocationI implementation details
In-Reply-To: <16604770-4422-4B0B-AFDC-8B2FD45C7F12@duke.edu>
References: <16604770-4422-4B0B-AFDC-8B2FD45C7F12@duke.edu>
Message-ID: 

So long as the API definition stays on the interface, no particular 
reason other than historical ones (as so often with Bioperl): 
originally we didn't have Atomic.pm from which now all location impls 
inherit (they do, right?) and the coordinate policy was introduced to 
the API some time after inception, so the easiest way to add the method 
and provide all classes with an implementation was to decorate the 
interface.

In the (extremely unlikely) event that somebody has written a LocationI 
implementation without inheriting from Atomic.pm and took advantage of 
the interface implementing the coordinate policy, he/she'd be screwed 
if you move it to Atomic.pm. So maybe just announce on the mailing list 
that you'll do this and who needs to pay attention.

	-hilmar


On Sep 8, 2005, at 1:49 PM, Jason Stajich wrote:

> Hilmar -
>
> Is there any reason for Bio::LocationI to have the coordinate policy 
> implementation?  I have moved the implementation to Atomic.pm in my 
> code with no effects on any of the tests.
>
> I don't like having the implementation there because it assumes the 
> object is represented by a Hash and I think that some ways we could 
> achieve speedier objects are to make some Location and feature objects 
> with arrays underneath (theoretically)...
>
> -jason
> --
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
>
>
>
-- 
-------------------------------------------------------------
Hilmar Lapp                            email: lapp at gnf.org
GNF, San Diego, Ca. 92121              phone: +1-858-812-1757
-------------------------------------------------------------


From guy at ebi.ac.uk  Fri Sep  2 12:52:00 2005
From: guy at ebi.ac.uk (Guy Slater)
Date: Thu Sep  8 20:27:05 2005
Subject: [Bioperl-l] methods, etc. for Bio::SearchIO on exonerate output
In-Reply-To: <200509021537.j82FbXb8002524@madeiro.ebi.ac.uk>
Message-ID: 

On Fri, 2 Sep 2005, Cook, Malcolm wrote:

> Hmmmm - I'd better get some clarification from Guy too.  
>  
> Guy, if you don't mind reading the thread below and chiming in on our
> discussion of interpreting the output of your excellent exonerate
> program:
>  
> The sections of the manpage (
> 
> http://www.ebi.ac.uk/~guy/exonerate/exonerate.man.1.html) that appear
> relevant are these 2 excerpts:
>  
>  1) When an alignment is reported on the reverse complement of a
> sequence, the coordinates are simply given on the reverse complement
> copy of the sequence. Hence positions on the sequences are never
> negative. Generally, the forward strand is indicated by '+', the reverse
> strand by '-', and an unknown or not-applicable strand (as in the case
> of a protein sequence) is indicated by '.' "
>  
> 2)  --forwardcoordinates  By default, all coordinates are
> reported on the forward strand. Setting this option to false reverts to
> the old behaviour (pre-0.8.3) whereby alignments on the reverse
> complement of a sequence are reported using coordinates on the reverse
> complement. 
>  
> We see GFF DUMP coordinates still reported on the reverse stand
> regardless of the setting of --forwardcoordinates.  So these two
> excerpts from you manpage seem contradictory to me.     Unless I
> understand `--forwardcoordinates FALSE` to only effect the coordinates
> reported in the alignment section, not in the GFF DUMP section, which is
> what it appears to do in practice.
>  
> Guy, can you confirm that the --forwardcoordinates option has no effect
> on GFF output?
>  

Hi,

Yes, it has no effect, and this is a bug
(sorry - it was due to my misinterpretation of the GFF2 spec)
- its on the list of things to be fixed for exonerate 1.1 (soon)

> Further, can you tell us if you plan to comport more closely to the GFF
> spec, in particular in this case by reporting forwardcoordinates in the
> GFF DUMP section too?   I see 
> I see in your TODO list "    o Should GFF show all coordinates on the
> +ve strand? (jason_p2g eg)".  Hear hear!  I second the motion.
>  
> And TODO item " GFF3 support ? http://song.sf.net/" gets my vote too....
> though this is more of a sticky wicket....
>  

Yup, GFF3 support is on the list,
but probably it will not be done in time for exonerate 1.1
Of course, I'd welcome a patch ...    ;)

(I'm mainly working on getting the cdna2genome
 and genome2genome models working properly for 1.1)

Cheers,

Guy.

> Cheers and Thanks!
>  
> Malcolm Cook
>  
>  
> -----Original Message-----
> From: Jason Stajich [mailto:jason.stajich@duke.edu] 
> Sent: Friday, September 02, 2005 9:46 AM
> To: Cook, Malcolm
> Cc: bioperl-l
> Subject: Re: [Bioperl-l] methods, etc. for Bio::SearchIO on exonerate
> output
> 
> 
> I've already talked to Guy about some of this and I assume fixes will be
> part of the next release, but it can't hurt to have more people
> requesting.  The main problem right now is reverse strand hits in GFF
> output are still screwed up even if you provide the --forwardcoordinates
> option. 
> 
> If someone wanted to write/donate a VULGAR to GFF subroutine (okay
> VULGAR to a list of Bio::Search::HSP::GenericHSP).  We can also
> reconstruct everything needed from that, I gave a stab at it once, but
> there was something missing (or maybe it was pre --forwardcoordinates
> option).   
> 
> 
> -jason 
> 
> On Sep 2, 2005, at 10:36 AM, Cook, Malcolm wrote:
> 
> 
> Jason,
>  
> Thanks for the scripts and clues (esp re: using the --ryo option to
> inject the needed length into the exonerate output to compensate).
>  
> I'm considering asking exonerate author to comport with GFF spec.  Do
> you think this is a road to take?
>  
> Cheers,
>  
> Malcolm
>  
> -----Original Message-----
> From: Jason Stajich [mailto:jason.stajich@duke.edu] 
> Sent: Wednesday, August 31, 2005 12:35 PM
> To: Cook, Malcolm
> Cc: bioperl-l
> Subject: Re: [Bioperl-l] methods, etc. for Bio::SearchIO on exonerate
> output
> 
> 
> http://fungal.genome.duke.edu/~jes12/software/scripts/process_exonerate_
> gff3.pl
> 
> You may still want to massage it some, but I use the script in this
> basic form, maybe with a few tweaks:
> 
> Note that it requires you to run exonerate with specific --ryo options
> so that it includes the length of the query and hit sequences in the
> report output. should be covered in the perldoc in the script.
> 
> Without the ryo options enabled,  you'll need to modify the script more
> to have access to the original sequence db, use Bio::DB::Fasta,  and put
> in some $dbh->length($seqid) calls instead.
> 
> I don't think the part which writes HSP/match lines is actually correct
> - it is trying to roll gapped HSPs from the similarity features. 
> 
> I end up ignoring all but the 'exon' and 'gene' lines for my gbrowse
> instance and/or grepping out the lines I really think I need.  
> You may want to s/exon/CDS/ for the protein2genome output as well.
> 
> -jason
> 
> On Aug 31, 2005, at 1:04 PM, Cook, Malcolm wrote:
> 
> 
> Jason, 
> 
> This message is in regards to an old thread  in which you offered to
> shared a 'script for munging over' exonerate output for lading in
> DB::GFF (c.f.
> 
> http://bioperl.org/pipermail/bioperl-l/2005-April/018741.html)
> 
> Would you be willing to still share that script, if you've got it
> around? 
> 
> Thanks, and regards, 
> 
> Malcolm Cook -  
> mec@stowers-institute.org - 816-926-4449
> Database Applications Manager - Bioinformatics
> Stowers Institute for Medical Research - Kansas City, MO  USA
> 
> 
> 
> 
> 
> --
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
> 
> 
> 
> 
> --
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
> 
> 
> 

-- 
%!PS % <------ Guy St.C. Slater ------> http://www.ebi.ac.uk/~guy/  <------
210 297/a{def}def/b{translate}a b 36/c{rotate}a c 0 1 0 1 12/d{exch moveto}
a/e{closepath stroke}a/f{index}a/g{0 0 0 0 4 f}a/h{setlinewidth newpath dup
g}a{pop exch 1 f add 0 h neg d lineto 72 c lineto e 2 h d 3 f 0 108 arc d e
18 c 0 2 f neg b 18 c}for 72 c newpath add g 0 7 arc d e pop showpage

From guy at ebi.ac.uk  Fri Sep  2 12:51:39 2005
From: guy at ebi.ac.uk (Guy Slater)
Date: Thu Sep  8 20:27:07 2005
Subject: [Bioperl-l] methods, etc. for Bio::SearchIO on exonerate output
In-Reply-To: <200509021537.j82FbXb8002524@madeiro.ebi.ac.uk>
Message-ID: 

On Fri, 2 Sep 2005, Cook, Malcolm wrote:

> Hmmmm - I'd better get some clarification from Guy too.  
>  
> Guy, if you don't mind reading the thread below and chiming in on our
> discussion of interpreting the output of your excellent exonerate
> program:
>  
> The sections of the manpage (
> 
> http://www.ebi.ac.uk/~guy/exonerate/exonerate.man.1.html) that appear
> relevant are these 2 excerpts:
>  
>  1) When an alignment is reported on the reverse complement of a
> sequence, the coordinates are simply given on the reverse complement
> copy of the sequence. Hence positions on the sequences are never
> negative. Generally, the forward strand is indicated by '+', the reverse
> strand by '-', and an unknown or not-applicable strand (as in the case
> of a protein sequence) is indicated by '.' "
>  
> 2)  --forwardcoordinates  By default, all coordinates are
> reported on the forward strand. Setting this option to false reverts to
> the old behaviour (pre-0.8.3) whereby alignments on the reverse
> complement of a sequence are reported using coordinates on the reverse
> complement. 
>  
> We see GFF DUMP coordinates still reported on the reverse stand
> regardless of the setting of --forwardcoordinates.  So these two
> excerpts from you manpage seem contradictory to me.     Unless I
> understand `--forwardcoordinates FALSE` to only effect the coordinates
> reported in the alignment section, not in the GFF DUMP section, which is
> what it appears to do in practice.
>  
> Guy, can you confirm that the --forwardcoordinates option has no effect
> on GFF output?
>  

Hi,

Yes, it has no effect, and this is a bug
(sorry - it was due to my misinterpretation of the GFF2 spec)
- its on the list of things to be fixed for exonerate 1.1 (soon)

> Further, can you tell us if you plan to comport more closely to the GFF
> spec, in particular in this case by reporting forwardcoordinates in the
> GFF DUMP section too?   I see 
> I see in your TODO list "    o Should GFF show all coordinates on the
> +ve strand? (jason_p2g eg)".  Hear hear!  I second the motion.
>  
> And TODO item " GFF3 support ? http://song.sf.net/" gets my vote too....
> though this is more of a sticky wicket....
>  

Yup, GFF3 support is on the list,
but probably it will not be done in time for exonerate 1.1
Of course, I'd welcome a patch ...    ;)

(I'm mainly working on getting the cdna2genome
 and genome2genome models working properly for 1.1)

Cheers,

Guy.

> Cheers and Thanks!
>  
> Malcolm Cook
>  
>  
> -----Original Message-----
> From: Jason Stajich [mailto:jason.stajich@duke.edu] 
> Sent: Friday, September 02, 2005 9:46 AM
> To: Cook, Malcolm
> Cc: bioperl-l
> Subject: Re: [Bioperl-l] methods, etc. for Bio::SearchIO on exonerate
> output
> 
> 
> I've already talked to Guy about some of this and I assume fixes will be
> part of the next release, but it can't hurt to have more people
> requesting.  The main problem right now is reverse strand hits in GFF
> output are still screwed up even if you provide the --forwardcoordinates
> option. 
> 
> If someone wanted to write/donate a VULGAR to GFF subroutine (okay
> VULGAR to a list of Bio::Search::HSP::GenericHSP).  We can also
> reconstruct everything needed from that, I gave a stab at it once, but
> there was something missing (or maybe it was pre --forwardcoordinates
> option).   
> 
> 
> -jason 
> 
> On Sep 2, 2005, at 10:36 AM, Cook, Malcolm wrote:
> 
> 
> Jason,
>  
> Thanks for the scripts and clues (esp re: using the --ryo option to
> inject the needed length into the exonerate output to compensate).
>  
> I'm considering asking exonerate author to comport with GFF spec.  Do
> you think this is a road to take?
>  
> Cheers,
>  
> Malcolm
>  
> -----Original Message-----
> From: Jason Stajich [mailto:jason.stajich@duke.edu] 
> Sent: Wednesday, August 31, 2005 12:35 PM
> To: Cook, Malcolm
> Cc: bioperl-l
> Subject: Re: [Bioperl-l] methods, etc. for Bio::SearchIO on exonerate
> output
> 
> 
> http://fungal.genome.duke.edu/~jes12/software/scripts/process_exonerate_
> gff3.pl
> 
> You may still want to massage it some, but I use the script in this
> basic form, maybe with a few tweaks:
> 
> Note that it requires you to run exonerate with specific --ryo options
> so that it includes the length of the query and hit sequences in the
> report output. should be covered in the perldoc in the script.
> 
> Without the ryo options enabled,  you'll need to modify the script more
> to have access to the original sequence db, use Bio::DB::Fasta,  and put
> in some $dbh->length($seqid) calls instead.
> 
> I don't think the part which writes HSP/match lines is actually correct
> - it is trying to roll gapped HSPs from the similarity features. 
> 
> I end up ignoring all but the 'exon' and 'gene' lines for my gbrowse
> instance and/or grepping out the lines I really think I need.  
> You may want to s/exon/CDS/ for the protein2genome output as well.
> 
> -jason
> 
> On Aug 31, 2005, at 1:04 PM, Cook, Malcolm wrote:
> 
> 
> Jason, 
> 
> This message is in regards to an old thread  in which you offered to
> shared a 'script for munging over' exonerate output for lading in
> DB::GFF (c.f.
> 
> http://bioperl.org/pipermail/bioperl-l/2005-April/018741.html)
> 
> Would you be willing to still share that script, if you've got it
> around? 
> 
> Thanks, and regards, 
> 
> Malcolm Cook -  
> mec@stowers-institute.org - 816-926-4449
> Database Applications Manager - Bioinformatics
> Stowers Institute for Medical Research - Kansas City, MO  USA
> 
> 
> 
> 
> 
> --
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
> 
> 
> 
> 
> --
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
> 
> 
> 

-- 
%!PS % <------ Guy St.C. Slater ------> http://www.ebi.ac.uk/~guy/  <------
210 297/a{def}def/b{translate}a b 36/c{rotate}a c 0 1 0 1 12/d{exch moveto}
a/e{closepath stroke}a/f{index}a/g{0 0 0 0 4 f}a/h{setlinewidth newpath dup
g}a{pop exch 1 f add 0 h neg d lineto 72 c lineto e 2 h d 3 f 0 108 arc d e
18 c 0 2 f neg b 18 c}for 72 c newpath add g 0 7 arc d e pop showpage

From bmoore at genetics.utah.edu  Fri Sep  2 14:43:27 2005
From: bmoore at genetics.utah.edu (Barry Moore)
Date: Thu Sep  8 20:27:08 2005
Subject: [Bioperl-l] Bio::Search results
Message-ID: 

Sean,

Am I guessing correctly that you are using bioperl 1.4?  You should not
have to have header information at the top of each result.  The problem
you are having is that the parser can read single result or multi result
files.  I didn't write this parser, so I won't pretend to know it well,
but when you are only getting the last result it is parsing your multi
result file as a single result file and everything but the last result
is being overwritten rather than pushed to an array (I think).  I
introduced a problem in the header when I copied the data out of out of
your e-mail, and fixing that made it work.  I just tried it with bioperl
1.4, and I get the same problem again (with a good header).  Diffing the
1.4 and 1.5 versions shows a lot of changes.  If you're on 1.4 try
upgrading to 1.5 or live from CVS, and see if that solves your problem.
The two attached files are your data, and your script as I have been
running them.  They should work as is with 1.5.

Barry

-----Original Message-----
From: Sean O'Keeffe [mailto:limericksean@gmail.com] 
Sent: Friday, September 02, 2005 3:32 AM
To: Barry Moore
Cc: Bioperl List
Subject: Re: [Bioperl-l] Bio::Search results

I have those four lines (all contained on separate lines) but it didn't
work . 

I ran "gawk '{if(/^\/\/$/) {print "//\n\nHMMER 2.3.2 (Oct 2003)"} else
{print}}' my_file > whatever" on the pfam file to include a HMMER
header after the // separator for each result.

It now works fine. I still don't understand why I need to include this
header to parse the file. Although from memory don't Blast reports all
include Blast header lines to separate next results?
By the way I think that its the mailer that seems to be altering the
text in these scripts (don't know where the "=3D" came from - it's not
in my original). I'm running a standard linux (suse 9.0) using nedit
as an editor.
Sean.

On 9/2/05, Barry Moore  wrote:
> Sean I see that my mailer messed up the line formatting also.  What I
> meant was you should have the top four lines like this:
> 
> #Line 1: hmmpfam - search one or more sequences against HMM database
> #Line 2: HMMER 2.3.2(Oct 2003)
> #Line 3: Copyright (C) 1992-2003 HHMI/Washington University School of
> #Line 4: Medicine Freely distributed under the GNU General Public
> License (GPL)
> 
> If you have that, and fix the hsp to hit error mentioned it works for
> me.
> 
> Barry
> 
> -----Original Message-----
> From: bioperl-l-bounces@portal.open-bio.org
> [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Barry
Moore
> Sent: Thursday, September 01, 2005 11:34 AM
> To: Bioperl List
> Subject: RE: [Bioperl-l] Bio::Search results
> 
> Sean-
> 
> 
> 
> The top of you input hmmpfam file has these four lines:
> 
> 
> 
> hmmpfam - search one or more sequences against HMM database HMMER
2.3.2
> (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School
of
> Medicine Freely distributed under the GNU General Public License (GPL)
> 
> 
> 
> When I copied that out of you e-mail and into emacs on my computer I
got
> it all as one line like this:
> 
> 
> 
> hmmpfam - search one or more sequences against HMM database HMMER
2.3.2
> (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School
of
> Medicine Freely distributed under the GNU General Public License (GPL)
> 
> 
> 
> The parser needs to see a line beginning with HMMER to trigger setting
> an internal variable called _reporttype (among other things).  Since
> this never happened with a single line header I got the same results
you
> did.  Your header lines look OK in the e-mail you sent me, but
assuming
> you have the same problem with you header lines that I did, fixing
that
> should lead you to your next problem...
> 
> 
> 
> This line of your code has an error:
> 
> 
> 
> next unless ($hsp->name =~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i);
> 
> 
> 
> HSP objects don't have names but their associated hit objects do, so
> this makes your script work as intended:
> 
> 
> 
> next unless ($hit->name =~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i);
> 
> 
> 
> I wonder if the header line problems could be the result of cross
> platform cutting and pasting (or just cross platform file
> incompatibilities).  I noticed also that in you script that you sent
the
> '=' turned into '=3D'.  What computer platforms do you use in your
work?
> 
> 
> 
> HTH
> 
> 
> 
> Barry
> 
> 
> 
> -----Original Message-----
> 
> From: Sean O'Keeffe [mailto:limericksean@gmail.com]
> 
> Sent: Tuesday, August 30, 2005 9:28 AM
> 
> To: Barry Moore
> 
> Cc: bioperl-l@portal.open-bio.org
> 
> Subject: Re: [Bioperl-l] Bio::Search results
> 
> 
> 
> Hi Barry, thanks for the reply. Below is a snippet of the file (I
> generated it with hmmpfam using the alignment flag set to -A 0, to
> remove alignments - this shouldn't affect the parsing of the file) :
> 
> 
> 
> hmmpfam - search one or more sequences against HMM database HMMER
2.3.2
> (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School
of
> Medicine Freely distributed under the GNU General Public License (GPL)
> 
> - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
-
> 
> HMM file:                 /usr/local/lib/pfam-tm
> 
> Sequence file:            Mus_musculus.NCBIM34.jul.pep.fa-short
> 
> - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
> 
> 
> 
> Query sequence: ENSMUSP00000089702
> 
> Accession:      [none]
> 
> Description:    [none]
> 
> 
> 
> Scores for sequence family classification (score includes all
domains):
> 
> Model    Description                                    Score
E-value
> N
> 
> -------- -----------                                    -----
-------
> ---
> 
>       [no hits above thresholds]
> 
> 
> 
> Parsed for domains:
> 
> Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> 
> -------- ------- ----- -----    ----- -----      -----  -------
> 
>       [no hits above thresholds]
> 
> //
> 
> 
> 
> Query sequence: ENSMUSP00000089701
> 
> Accession:      [none]
> 
> Description:    [none]
> 
> 
> 
> Scores for sequence family classification (score includes all
domains):
> 
> Model    Description                                    Score
E-value
> N
> 
> -------- -----------                                    -----
-------
> ---
> 
>       [no hits above thresholds]
> 
> 
> 
> Parsed for domains:
> 
> Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> 
> -------- ------- ----- -----    ----- -----      -----  -------
> 
>       [no hits above thresholds]
> 
> //
> 
> 
> 
> Query sequence: ENSMUSP00000020094
> 
> Accession:      [none]
> 
> Description:    [none]
> 
> 
> 
> Scores for sequence family classification (score includes all
domains):
> 
> Model    Description                                    Score
E-value
> N
> 
> -------- -----------                                    -----
-------
> ---
> 
> LRR_1    Leucine Rich Repeat                             55.0
3.7e-15
> 6
> 
> LRRNT    Leucine rich repeat N-terminal domain           30.1
1.1e-07
> 1
> 
> 
> 
> Parsed for domains:
> 
> Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> 
> -------- ------- ----- -----    ----- -----      -----  -------
> 
> LRRNT      1/1     117   142 ..     1    34 []    30.1  1.1e-07
> 
> LRR_1      1/6     168   191 ..     1    25 []    14.7   0.0049
> 
> LRR_1      2/6     192   210 ..     1    25 []     9.1      0.2
> 
> LRR_1      3/6     212   237 ..     1    25 []     8.4     0.26
> 
> LRR_1      4/6     238   257 ..     1    25 []    10.3      0.1
> 
> LRR_1      5/6     259   282 ..     1    25 []    10.1     0.12
> 
> LRR_1      6/6     290   314 ..     1    25 []     2.4        2
> 
> //
> 
> 
> 
> Query sequence: ENSMUSP00000074175
> 
> Accession:      [none]
> 
> Description:    [none]
> 
> 
> 
> Scores for sequence family classification (score includes all
domains):
> 
> Model    Description                                    Score
E-value
> N
> 
> -------- -----------                                    -----
-------
> ---
> 
> CUB      CUB domain                                     232.5
1.3e-68
> 2
> 
> Trypsin  Trypsin                                        206.0
1.2e-60
> 1
> 
> Sushi    Sushi domain (SCR repeat)                       88.7
2.6e-25
> 2
> 
> EGF_CA   Calcium binding EGF domain                      29.4
1.8e-07
> 1
> 
> 
> 
> Parsed for domains:
> 
> Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
> 
> -------- ------- ----- -----    ----- -----      -----  -------
> 
> CUB        1/2      16   137 ..     1   116 []    70.0  1.1e-19
> 
> EGF_CA     1/1     141   188 ..     1    55 []    29.4  1.8e-07
> 
> CUB        2/2     192   301 ..     1   116 []   162.5  1.5e-47
> 
> Sushi      1/2     308   370 ..     1    62 []    47.5  6.5e-13
> 
> Sushi      2/2     375   446 ..     1    62 []    41.2  5.1e-11
> 
> Trypsin    1/1     463   698 ..     1   259 []   206.0  1.2e-60
> 
> //
> 
> 
> 
> 
> 
> Cheers,
> 
> Sean.
> 
> 
> 
> 
> 
> 
> 
> On 8/30/05, Barry Moore  wrote:
> 
> > Sean,
> 
> >
> 
> > Don't see anything obviously wrong.  If you want to send your input
> 
> > file, I'll try to recreate the problem.
> 
> >
> 
> > Barry
> 
> >
> 
> > -----Original Message-----
> 
> > From: bioperl-l-bounces@portal.open-bio.org
> 
> > [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Sean
> 
> > O'Keeffe
> 
> > Sent: Tuesday, August 30, 2005 2:55 AM
> 
> > To: bioperl-l@portal.open-bio.org
> 
> > Subject: [Bioperl-l] Bio::Search results
> 
> >
> 
> > Hi,
> 
> > The following code snippet is something I use to extract information
> 
> > from hmmer result files:
> 
> >
> 
> > use Bio::SearchIO;
> 
> >
> 
> > my $in =3D new Bio::SearchIO( -format =3D> 'hmmer',  -file =3D>
> 
> > $ARGV[0] ); while(my $result =3D $in->next_result) {
> 
> >   print $result->query_name(),
"\n",$result->query_description(),"\n";
> 
> >   while (my $hit =3D $result->next_hit) {
> 
> >     while(my $hsp =3D $hit->next_domain) {
> 
> >       next unless ($hsp->name =3D~ /^ig|^lrr|^fn3|^egf|^tsp|^psi/i);
> 
> >       print $hsp->start(),"\t",$hsp->end(),"\t",$hsp->evalue(),"\n";
> 
> >     }
> 
> >   }
> 
> > }
> 
> >
> 
> > The input file is generated by hmmpfam and is given at the command
> 
> > line. I use it to scan for specific domain names e.g ig, fn3 lrr
etc.
> 
> > This code works for the first loop and then ends so I get the name
and
> 
> 
> > description (no hsp values as their are none for this result):
> 
> >
> 
> > ENSMUSP00000065602=20
> 
> > pep:novel supercontig::NT_085813:405:1510:-1 gene:ENSMUSG00000054059
> 
> > transcript:ENSMUST00000066517
> 
> >
> 
> > My question is why does the loop end after one instance.
Incidentally
> 
> > the outputted  name and description above are the last ones in the
> 
> > hmmer file (maybe the file is read from the back??? - don't know if
> 
> > this means anything). Any thoughts would be appreciated. Thanks,
> 
> > Sean.
> 
> >
> 
> > _______________________________________________
> 
> > Bioperl-l mailing list
> 
> > Bioperl-l@portal.open-bio.org
> 
> > http://portal.open-bio.org/mailman/listinfo/bioperl-l
> 
> >
> 
> 
> 
> 
> 
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>
-------------- next part --------------
A non-text attachment was scrubbed...
Name: pfam.out
Type: application/octet-stream
Size: 2758 bytes
Desc: pfam.out
Url : http://portal.open-bio.org/pipermail/bioperl-l/attachments/20050902/fca07e14/pfam-0001.obj
-------------- next part --------------
A non-text attachment was scrubbed...
Name: bp_pfam.pl
Type: application/octet-stream
Size: 473 bytes
Desc: bp_pfam.pl
Url : http://portal.open-bio.org/pipermail/bioperl-l/attachments/20050902/fca07e14/bp_pfam-0001.obj
From jason.stajich at duke.edu  Thu Sep  8 16:49:27 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Thu Sep  8 20:58:05 2005
Subject: [Bioperl-l] LocationI implementation details
Message-ID: <16604770-4422-4B0B-AFDC-8B2FD45C7F12@duke.edu>

Hilmar -

Is there any reason for Bio::LocationI to have the coordinate policy  
implementation?  I have moved the implementation to Atomic.pm in my  
code with no effects on any of the tests.

I don't like having the implementation there because it assumes the  
object is represented by a Hash and I think that some ways we could  
achieve speedier objects are to make some Location and feature  
objects with arrays underneath (theoretically)...

-jason
--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From jason.stajich at duke.edu  Thu Sep  8 17:30:09 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Thu Sep  8 20:58:06 2005
Subject: [Bioperl-l] releasing next week
Message-ID: <9A667AF7-3AEA-40B7-A646-7615A4F8F19D@duke.edu>

All tests pass for me on two different machines.

If you have any reason for the 1.5.1 release to not happen next week,  
please speak up now.  I'm trying to time it with the GMOD Gbrowse  
release so people can feel comfortable upgrading to bioperl 1.5 and  
the latest Gbrowse at the same time.

The only test failing for me to DBCUTG.t this seems  to be a  
webserver error - perhaps they have changed their interface?  This is  
rather minor so I won't let it hold up the release if no one looks at  
it before next week.

I'm choosing to ignore the "" overloading in SeqFeature/Annotation  
objects for 1.5.1.  Similarly, adding additional seqfeature tests are  
going to be on the backburner for this release but need to be done  
before the 1.6 release.

I'd like to see if we can help Brian with the SeqIO test overhaul.   
This seems like the only other outstanding issue.

My feeling is the TypedSeqFeature implementation can wait, perhaps in  
a future 1.5.x in prep for 1.6.

I'm thinking I will try and put a release candidate up by Monday and  
release as soon as a few people have tested it out.  Please do me a  
favor and do a fresh CVS checkout and run make test on your own  
machines to see what else still needs work.


-jason
--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From bmoore at genetics.utah.edu  Fri Sep  9 00:16:56 2005
From: bmoore at genetics.utah.edu (Barry Moore)
Date: Fri Sep  9 00:05:11 2005
Subject: [Bioperl-l] releasing next week
Message-ID: 

Jason,

BioDBGFF.t failed cause I gave it the wrong Postgres login detail -
can't remember my damn password!
RemoteBlast.t passed when run individually.
RestrictionIO.t failed to open an output file because the directory
didn't exist, and it wasn't clear to me why it should.
Didn't look into tutorial.t failures.

System is Debian Woody, Perl 5.6.1, and fresh live bioperl.

Failed Test       Stat Wstat Total Fail  Failed  List of Failed
------------------------------------------------------------------------
-------
t/BioDBGFF.t                   138  138 100.00%  1-138
t/RemoteBlast.t      2   512     6    1  16.67%  2
t/RestrictionIO.t               14    1   7.14%  10
t/tutorial.t       255 65280    21    6  28.57%  19-21
122 subtests skipped.
Failed 4/215 test scripts, 98.14% okay. 143/9892 subtests failed, 98.55%
okay.

Barry

-----Original Message-----
From: bioperl-l-bounces@portal.open-bio.org
[mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Jason
Stajich
Sent: Thursday, September 08, 2005 3:30 PM
To: bioperl-l List
Cc: Scott Cain
Subject: [Bioperl-l] releasing next week

All tests pass for me on two different machines.

If you have any reason for the 1.5.1 release to not happen next week,  
please speak up now.  I'm trying to time it with the GMOD Gbrowse  
release so people can feel comfortable upgrading to bioperl 1.5 and  
the latest Gbrowse at the same time.

The only test failing for me to DBCUTG.t this seems  to be a  
webserver error - perhaps they have changed their interface?  This is  
rather minor so I won't let it hold up the release if no one looks at  
it before next week.

I'm choosing to ignore the "" overloading in SeqFeature/Annotation  
objects for 1.5.1.  Similarly, adding additional seqfeature tests are  
going to be on the backburner for this release but need to be done  
before the 1.6 release.

I'd like to see if we can help Brian with the SeqIO test overhaul.   
This seems like the only other outstanding issue.

My feeling is the TypedSeqFeature implementation can wait, perhaps in  
a future 1.5.x in prep for 1.6.

I'm thinking I will try and put a release candidate up by Monday and  
release as soon as a few people have tested it out.  Please do me a  
favor and do a fresh CVS checkout and run make test on your own  
machines to see what else still needs work.


-jason
--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


_______________________________________________
Bioperl-l mailing list
Bioperl-l@portal.open-bio.org
http://portal.open-bio.org/mailman/listinfo/bioperl-l

From paul.boutros at utoronto.ca  Fri Sep  9 00:46:50 2005
From: paul.boutros at utoronto.ca (paul.boutros@utoronto.ca)
Date: Fri Sep  9 00:43:26 2005
Subject: [Bioperl-l] Remote Blast Failing
Message-ID: <1126241210.432113bad6e27@webmail.utoronto.ca>

Hello,

NCBI has changed their format for RemoteBlasts, and in some cases this is 
causing SearchIO to fail.  I think this is related to Jason's email from a few 
weeks back:
http://bioperl.org/pipermail/bioperl-l/2005-August/019634.html

All nucleotide queries I tried fail on perl 5.8.7 on both AIX and WinXP using 
Bioperl 1.4 (last stable release).  The reason appears to be a change in the HSP 
alignment format, removing a comma.  A work-around for BioPerl 1.4 is to change 
line 1145 of Bio\SearchIO\blast.pm this way:
-1145:        if( /^((Query|Sbjct):\s+(\-?\d+)\s*)(\S+)\s+(\-?\d+)/ ) {
+1145:        if( /^((Query|Sbjct):{0,1}\s+(\-?\d+)\s*)(\S+)\s+(\-?\d+)/ ) {

I downloaded the CVS tarball, and this change is already in bioperl-live.  
However, one class of queries that *doesn't* work from bioperl-live are genomic 
BLASTs.  Here, NCBI has added several extra lines have been added to the output.

Here's an example of the new format:
#################################################
gi|63489990|ref|NT_039206.4|Mm2_39246_34  Mus musculus chromosome  28.2       25
gi|63482841|ref|NT_078297.3|Mm1_78362_34  Mus musculus chromosome  28.2       25

ALIGNMENTS
>gi|63543231|ref|NT_039343.4|Mm6_39383_34 Mus musculus chromosome 6 genomic 
contig, strain C57BL/6J
          Length=21478308

 Features flanking this part of subject sequence:
   60669 bp at 5' side: hypothetical protein LOC101197
   386242 bp at 3' side: RIKEN cDNA A930040G15

 Score = 38.2 bits (19),  Expect = 0.026
 Identities = 19/19 (100%), Gaps = 0/19 (0%)
 Strand=Plus/Plus

Query  1       AGGCCGTTCACCAGTATGA  19
               |||||||||||||||||||
Sbjct  246489  AGGCCGTTCACCAGTATGA  246507
#################################################

And parsing a report containing this gives the error message:
#################################################
------------- EXCEPTION  -------------
MSG: no data for midline  Features flanking this part of subject sequence:
STACK Bio::SearchIO::blast::next_result C:/Perl/site/lib/Bio\SearchIO\blast.pm:
1173
STACK toplevel test_blast.pl:9
--------------------------------------
#################################################

I can submit a patch, but I wanted to get input on the best way to handle this:  
should the feature-data be stored somewhere, or just skipped?

Here are the parameters used for this query in case somebody wants to recreate 
it.  I can also forward the blast report file if you're interested.
Sequence: aggccgttcaccagtatgac
Database: mouse_contig/ref_contig
Entrez Query: Mus musculus [ORGN]

A short-term fix if anybody else is having this problem is to BLAST against the 
database 'chromosome' instead of 'mouse_contig/ref_contif' and so forth for 
other species.

Sorry for the long message!
Paul
From limericksean at gmail.com  Fri Sep  9 07:58:44 2005
From: limericksean at gmail.com (Sean O'Keeffe)
Date: Fri Sep  9 08:50:22 2005
Subject: [Bioperl-l] Bio::Tools::Run::TribeMCL
Message-ID: <4627846405090904585951f015@mail.gmail.com>

Hi,
I'm running the following code to cluster a protein set into families:

use Bio::Tools::Run::TribeMCL;
use Bio::SearchIO;

my $usage = "run_tribe.pl blastfile";
my $blastfile = $ARGV[0]; 
open (IN, $blastfile) || die $usage;

my $sio = Bio::SearchIO->new(-format=>'blast',
                               -file=>$blastfile);
my @params=('inputtype'=>'searchio',I=>'2.0',
	'mcl'=>'/home/sean/tribemcl/src/shmcl/mcl',
	'matrix'=>'/home/sean/tribemcl/src/contrib/tribe/tribe-matrix');

my $fact = Bio::Tools::Run::TribeMCL->new(@params);

my $fam = $fact->run($sio);

for (my $i = 0; $i [$i]})." members\n";
	foreach my $member (@{$fam->[$i]}){
		print "\t$member\n";
	}
}

It seems to run fine until the last part. The output from the command line is:

[mclIO] reading  ....................___
[mclvFromIvps_x] <323> found <1> repeated entries within vector
___ [mclvFromIvps_x] <323> vector went from <0> to <11> entries
....___ [mclvFromIvps_x] <387> found <3> repeated entries within vector
___ [mclvFromIvps_x] <387> vector went from <0> to <4> entries
.___ [mclvFromIvps_x] <414> found <2> repeated entries within vector
___ [mclvFromIvps_x] <414> vector went from <0> to <2> entries
.___ [mclvFromIvps_x] <425> found <2> repeated entries within vector
___ [mclvFromIvps_x] <425> vector went from <0> to <4> entries
..___ [mclvFromIvps_x] <455> found <2> repeated entries within vector
___ [mclvFromIvps_x] <455> vector went from <0> to <4> entries
.......___ [mclvFromIvps_x] <575> found <1> repeated entries within vector
___ [mclvFromIvps_x] <575> vector went from <0> to <8> entries
.___ [mclvFromIvps_x] <589> found <2> repeated entries within vector
___ [mclvFromIvps_x] <589> vector went from <0> to <8> entries
.___ [mclvFromIvps_x] <593> found <1> repeated entries within vector
___ [mclvFromIvps_x] <593> vector went from <0> to <10> entries
___ [mclvFromIvps_x] <596> found <1> repeated entries within vector
___ [mclvFromIvps_x] <596> vector went from <0> to <6> entries
___ [mclvFromIvps_x] <605> found <6> repeated entries within vector
___ [mclvFromIvps_x] <605> vector went from <0> to <42> entries
___ [mclvFromIvps_x] <606> found <4> repeated entries within vector
___ [mclvFromIvps_x] <606> vector went from <0> to <8> entries
___ [mclvFromIvps_x] <607> found <6> repeated entries within vector
___ [mclvFromIvps_x] <607> vector went from <0> to <11> entries
.___ [mclvFromIvps_x] <608> found <1> repeated entries within vector
___ [mclvFromIvps_x] <608> vector went from <0> to <3> entries
___ [mclvFromIvps_x] <611> found <9> repeated entries within vector
___ [mclvFromIvps_x] <611> vector went from <0> to <8> entries
___ [mclvFromIvps_x] <612> found <11> repeated entries within vector
___ [mclvFromIvps_x] <612> vector went from <0> to <10> entries
___ [mclvFromIvps_x] <613> found <10> repeated entries within vector
___ [mclvFromIvps_x] <613> vector went from <0> to <10> entries
___ [mclvFromIvps_x] <614> found <10> repeated entries within vector
___ [mclvFromIvps_x] <614> vector went from <0> to <10> entries
___ [mclvFromIvps_x] <615> found <9> repeated entries within vector
___ [mclvFromIvps_x] <615> vector went from <0> to <10> entries
___ [mclvFromIvps_x] <616> found <9> repeated entries within vector
___ [mclvFromIvps_x] <616> vector went from <0> to <10> entries
___ [mclvFromIvps_x] <617> found <10> repeated entries within vector
___ [mclvFromIvps_x] <617> vector went from <0> to <10> entries
___ [mclvFromIvps_x] <618> found <3> repeated entries within vector
___ [mclvFromIvps_x] <618> vector went from <0> to <2> entries
___ [mclvFromIvps_x] <619> found <2> repeated entries within vector
___ [mclvFromIvps_x] <619> vector went from <0> to <2> entries
___ [mclvFromIvps_x] <620> found <2> repeated entries within vector
___ [mclvFromIvps_x] <620> vector went from <0> to <3> entries
___ [mclvFromIvps_x] <621> found <5> repeated entries within vector
___ [mclvFromIvps_x] <621> vector went from <0> to <3> entries
___ [mclvFromIvps_x] <622> found <9> repeated entries within vector
___ [mclvFromIvps_x] <622> vector went from <0> to <4> entries
___ [mclvFromIvps_x] <623> found <8> repeated entries within vector
___ [mclvFromIvps_x] <623> vector went from <0> to <5> entries
.___ [mclvFromIvps_x] <624> found <5> repeated entries within vector
___ [mclvFromIvps_x] <624> vector went from <0> to <2> entries

[mclIO] read native ascii 625x625 matrix with 7731 entries
[mcl] pid 3353

 ite -----------------------------  chaos  time
  1  .............................   8.81  0.01
  2  .............................  14.76  0.01
  3  .............................  12.61  0.02
  4  .............................  11.41  0.01
  5  .............................   3.10  0.00
  6  .............................   4.16  0.00
  7  .............................   3.86  0.00
  8  .............................   2.36  0.00
  9  .............................   1.65  0.00
 10  .............................   1.03  0.01
 11  .............................   0.75  0.00
 12  .............................   0.38  0.00
 13  .............................   0.56  0.00
 14  .............................   0.69  0.01
 15  .............................   0.99  0.00
 16  .............................   0.49  0.00
 17  .............................   0.18  0.00
 18  .............................   0.01  0.00
 19  .............................   0.00  0.00
[mclIO] writing 
.......................................
[mclIO] wrote native ascii 625x195 matrix with 625 entries to stream

[mcl] jury pruning marks (worst 100 cases): <99,99,99>, out of 100
[mcl] jury pruning synopsis: <99 or perfect> (cf -scheme, -do log)
[mcl] 195 clusters found
[mcl] output is in /tmp/zKQ6iThFot/EdurhN5sGW
Can't use string ("195") as an ARRAY ref while "strict refs" in use at
../../../../scripts/run_tribe.pl line 21,  line 625.

It seems to run ok but fails in the result stage ( line 21 is: "for
(my $i = 0; $i 
References: <4627846405090904585951f015@mail.gmail.com>
Message-ID: <1126276875.7420.29.camel@localhost.localdomain>

> How
> can I make it put the output in the directory the program was called -
> is there a flag I can add to the @params ??

Hi all,

Jason and myself were considering to convert the tempdir method in
Bio::Tools::Run::WrapperBase in a setter/getter, so that instead of
getting a random tempdir, one could set the tempdir to a defined value:

Something like:

sub tempdir{
   my ($self) = @_;
   
## Add the setter part here
    return $self->{'_tmpdir'} = shift if @_;
##
   unless( $self->{'_tmpdir'} ) {
       $self->{'_tmpdir'} = $self->io->tempdir(CLEANUP => !
$self->save_tempfiles );
   }
   unless( -d $self->{'_tmpdir'} ) { 
       mkdir($self->{'_tmpdir'},0777);
   }
   $self->{'_tmpdir'};
}

Jason: How do you want the CLEANUP part to behave if the tempdir is
setted? The same way as save_tempfiles?

Bests,

    Albert.

From brian_osborne at cognia.com  Fri Sep  9 14:43:19 2005
From: brian_osborne at cognia.com (Brian Osborne)
Date: Fri Sep  9 14:37:54 2005
Subject: [Bioperl-l] releasing next week
In-Reply-To: 
Message-ID: 

Barry,

my $tmpdir = "t/tmp";
mkdir($tmpdir,0777);

So this fails for you? What about:

mkdir $tmpdir

?

Brian O.


On 9/9/05 12:16 AM, "Barry Moore"  wrote:

> Jason,
> 
> BioDBGFF.t failed cause I gave it the wrong Postgres login detail -
> can't remember my damn password!
> RemoteBlast.t passed when run individually.
> RestrictionIO.t failed to open an output file because the directory
> didn't exist, and it wasn't clear to me why it should.
> Didn't look into tutorial.t failures.
> 
> System is Debian Woody, Perl 5.6.1, and fresh live bioperl.
> 
> Failed Test       Stat Wstat Total Fail  Failed  List of Failed
> ------------------------------------------------------------------------
> -------
> t/BioDBGFF.t                   138  138 100.00%  1-138
> t/RemoteBlast.t      2   512     6    1  16.67%  2
> t/RestrictionIO.t               14    1   7.14%  10
> t/tutorial.t       255 65280    21    6  28.57%  19-21
> 122 subtests skipped.
> Failed 4/215 test scripts, 98.14% okay. 143/9892 subtests failed, 98.55%
> okay.
> 
> Barry
> 
> -----Original Message-----
> From: bioperl-l-bounces@portal.open-bio.org
> [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Jason
> Stajich
> Sent: Thursday, September 08, 2005 3:30 PM
> To: bioperl-l List
> Cc: Scott Cain
> Subject: [Bioperl-l] releasing next week
> 
> All tests pass for me on two different machines.
> 
> If you have any reason for the 1.5.1 release to not happen next week,
> please speak up now.  I'm trying to time it with the GMOD Gbrowse
> release so people can feel comfortable upgrading to bioperl 1.5 and
> the latest Gbrowse at the same time.
> 
> The only test failing for me to DBCUTG.t this seems  to be a
> webserver error - perhaps they have changed their interface?  This is
> rather minor so I won't let it hold up the release if no one looks at
> it before next week.
> 
> I'm choosing to ignore the "" overloading in SeqFeature/Annotation
> objects for 1.5.1.  Similarly, adding additional seqfeature tests are
> going to be on the backburner for this release but need to be done
> before the 1.6 release.
> 
> I'd like to see if we can help Brian with the SeqIO test overhaul.
> This seems like the only other outstanding issue.
> 
> My feeling is the TypedSeqFeature implementation can wait, perhaps in
> a future 1.5.x in prep for 1.6.
> 
> I'm thinking I will try and put a release candidate up by Monday and
> release as soon as a few people have tested it out.  Please do me a
> favor and do a fresh CVS checkout and run make test on your own
> machines to see what else still needs work.
> 
> 
> -jason
> --
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
> 
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l


From tothg at abc.hu  Sat Sep 10 09:22:19 2005
From: tothg at abc.hu (Gabor Toth)
Date: Sat Sep 10 09:18:43 2005
Subject: [Bioperl-l] Bio::SearchDist problem
Message-ID: <200509101522.19426.tothg@abc.hu>

Hi!

I would like to use Bio::SearchDist to fit an extreme value distribution to a 
sorted set of 20724 integer scores and calculate E-value for each score. The 
scores are distributed around a median of zero with a range between -204 and 
+1073.

However, using the script below, I cannot get meaningful E-values. The first 
29 "E-values" are 1075530112, the 30th is 1, and all other are zero.
(The input and output files can be found here: 
http://bioweb.abc.hu/tmp/evd/index.html).
My BioPerl version is 1.4.

What am I doing wrong?
I will appreciate any help,

Gabor Toth

------------------------------------------------------
#!/usr/bin/perl -w

use Bio::SearchDist;

$dis = Bio::SearchDist->new();

while (<>) {
    chomp;
    push @scores, $_;
    $dis->add_score($_);
}

if ( $dis->fit_evd() ) {
    foreach $score (@scores) {
	$evalue = $dis->evalue($score);
	print "S: $score   E: $evalue\n";
    }
}
else {
    warn("Cannot fit!");
}

From kliu_cali at yahoo.com  Sat Sep 10 15:42:01 2005
From: kliu_cali at yahoo.com (kevin liu)
Date: Sat Sep 10 17:13:15 2005
Subject: [Bioperl-l] TreeIO nexus file parsing issue (bug?)
Message-ID: <20050910194201.93270.qmail@web53103.mail.yahoo.com>

Hi,

  I'm posting a problem I ran across while using
Bio::TreeIO to convert trees from Nexus to Newick
format.
  Line 150 in nexus.pm reads:

  if( /^\s+(\S+)\s+([^\s\,\;]+)\s*([\,\;])?\s*$/ ) {

  It should really at least be changed to:

  if( /^\s*(\S+)\s+([^\s\,\;]+)\s*([\,\;])?\s*$/ ) {

  Thus, nexus.pm expects at least one space in front
of each line in the Translate block of the Nexus tree
file.
  Something like the sample Nexus tree file at
http://workshop.molecularevolution.org/resources/fileformats/tree_formats.php
 doesn't work! This ate up a bunch of my time until I
went through Jason Stajich's nexus.pm code. (file
below)
  #NEXUS 

Begin trees;  [Treefile saved Wed Jul 26 19:40:41
2000]

[output from your data run]

Translate 1 TRXEcoli, 2 TRXHomo, 3 TRXSacch, 4
erCaelA, 5 erCaelB, 6 erCaelC, 7 erHomoA, 8 erHomoB, 9
erHomoC, 10 erpCaelC ; tree PAUP_1 = [&U]
(1,((2,3),((((4,10),(5,8)),(6,9)),7))); End; 

  It needs to be something like:
#NEXUS 

Begin trees;  [Treefile saved Wed Jul 26 19:40:41
2000]

[output from your data run]

Translate 
 1 TRXEcoli, 
 2 TRXHomo, 
 3 TRXSacch, 
 4 erCaelA, 
 5 erCaelB, 
 6 erCaelC, 
 7 erHomoA, 
 8 erHomoB, 
 9 erHomoC, 
 10 erpCaelC ; 
tree PAUP_1 = [&U]
(1,((2,3),((((4,10),(5,8)),(6,9)),7))); End; 

  That will parse.
  What's annoying is that there aren't any error
messages in the event that there is a parse error - it
just fails silently, and then next_tree returns Undef
as if there were no tree. :(
  
           - Kevin

__________________________________________________
Do You Yahoo!?
Tired of spam?  Yahoo! Mail has the best spam protection around 
http://mail.yahoo.com 
From jason.stajich at duke.edu  Sat Sep 10 17:11:33 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Sat Sep 10 18:00:52 2005
Subject: [Bioperl-l] Bio::SearchDist problem
In-Reply-To: <200509101522.19426.tothg@abc.hu>
References: <200509101522.19426.tothg@abc.hu>
Message-ID: 

I see this too.  Ewan will have to report in on what is wrong.  I  
know this code is ancient but it should at least do what it says it  
can do.

Can you go ahead and submit it as a bug to bugzilla.
http://bugzilla.open-bio.org/

Thanks,
-jason
On Sep 10, 2005, at 9:22 AM, Gabor Toth wrote:

> Hi!
>
> I would like to use Bio::SearchDist to fit an extreme value  
> distribution to a
> sorted set of 20724 integer scores and calculate E-value for each  
> score. The
> scores are distributed around a median of zero with a range between  
> -204 and
> +1073.
>
> However, using the script below, I cannot get meaningful E-values.  
> The first
> 29 "E-values" are 1075530112, the 30th is 1, and all other are zero.
> (The input and output files can be found here:
> http://bioweb.abc.hu/tmp/evd/index.html).
> My BioPerl version is 1.4.
>
> What am I doing wrong?
> I will appreciate any help,
>
> Gabor Toth
>
> ------------------------------------------------------
> #!/usr/bin/perl -w
>
> use Bio::SearchDist;
>
> $dis = Bio::SearchDist->new();
>
> while (<>) {
>     chomp;
>     push @scores, $_;
>     $dis->add_score($_);
> }
>
> if ( $dis->fit_evd() ) {
>     foreach $score (@scores) {
>     $evalue = $dis->evalue($score);
>     print "S: $score   E: $evalue\n";
>     }
> }
> else {
>     warn("Cannot fit!");
> }
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From cain at cshl.edu  Mon Sep 12 16:17:13 2005
From: cain at cshl.edu (Scott Cain)
Date: Mon Sep 12 16:27:54 2005
Subject: [Bioperl-l] test failures on cvs head
Message-ID: <1126556233.3296.174.camel@localhost.localdomain>

Hi,

I think there was a thread for current test results, but I must have
deleted it.  On my Mac (perl 5.8.4, built from source), I get the
following failure-type things:

t/ztr........................Bio::SeqIO::staden::read is not installed or is installed incorrectly - skipping ztr.t tests
FAILED before any test output arrived
t/pln........................Bio::SeqIO::staden::read is not installed or is installed incorrectly - skipping pln.t tests
FAILED before any test output arrived
t/exp........................Bio::SeqIO::staden::read is not installed or is installed incorrectly - skipping exp.t tests
FAILED before any test output arrived
t/ctf........................Bio::SeqIO::staden::read is not installed or is installed incorrectly - skipping ctf.t tests
FAILED before any test output arrived
t/abi........................Bio::SeqIO::staden::read is not installed or is installed incorrectly - skipping abi.t tests
FAILED before any test output arrived

Scott

-- 
------------------------------------------------------------------------
Scott Cain, Ph. D.                                         cain@cshl.edu
GMOD Coordinator (http://www.gmod.org/)                     216-392-3087
Cold Spring Harbor Laboratory

From jason.stajich at duke.edu  Mon Sep 12 16:54:36 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Mon Sep 12 18:17:36 2005
Subject: [Bioperl-l] test failures on cvs head
In-Reply-To: <1126556233.3296.174.camel@localhost.localdomain>
References: <1126556233.3296.174.camel@localhost.localdomain>
Message-ID: <02980BD9-7617-4BA8-8DF5-D15B60BC23CA@duke.edu>

Fixed.  Thanks scott.

On Sep 12, 2005, at 4:17 PM, Scott Cain wrote:

> Hi,
>
> I think there was a thread for current test results, but I must have
> deleted it.  On my Mac (perl 5.8.4, built from source), I get the
> following failure-type things:
>
> t/ztr........................Bio::SeqIO::staden::read is not  
> installed or is installed incorrectly - skipping ztr.t tests
> FAILED before any test output arrived
> t/pln........................Bio::SeqIO::staden::read is not  
> installed or is installed incorrectly - skipping pln.t tests
> FAILED before any test output arrived
> t/exp........................Bio::SeqIO::staden::read is not  
> installed or is installed incorrectly - skipping exp.t tests
> FAILED before any test output arrived
> t/ctf........................Bio::SeqIO::staden::read is not  
> installed or is installed incorrectly - skipping ctf.t tests
> FAILED before any test output arrived
> t/abi........................Bio::SeqIO::staden::read is not  
> installed or is installed incorrectly - skipping abi.t tests
> FAILED before any test output arrived
>
> Scott
>
> -- 
> ---------------------------------------------------------------------- 
> --
> Scott Cain, Ph. D.                                          
> cain@cshl.edu
> GMOD Coordinator (http://www.gmod.org/)                      
> 216-392-3087
> Cold Spring Harbor Laboratory
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From neeti_somaiya at persistent.co.in  Mon Sep 12 07:56:02 2005
From: neeti_somaiya at persistent.co.in (Neeti Somaiya)
Date: Mon Sep 12 20:43:54 2005
Subject: [Bioperl-l] query
Message-ID: <43256CD2.7020008@persistent.co.in>

Barry,

I went through your code for parsing of GenBank files.It works perfectly 
fine,but for GenBank files of contigs,as in,sequences with NT 
accessions.Could you help me in this regard.

Thanks,
Neeti.
From jason.stajich at duke.edu  Mon Sep 12 21:01:48 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Mon Sep 12 21:32:28 2005
Subject: [Bioperl-l] Re: [Bioperl-guts-l] BioPerl 1.5 fasta.pm->next_seq()
	fails on sequence
In-Reply-To: <633b88d2050912082069a2161f@mail.gmail.com>
References: <633b88d2050912082069a2161f@mail.gmail.com>
Message-ID: <48ABBF10-09B9-491E-A1BD-977893A7B230@duke.edu>

If you pass in the -alphabet option to Bio::SeqIO you can prevent the  
sequence object from needing to guess its alphabet.

See the Bio::SeqIO perldoc:

-alphabet

Sets the alphabet ('dna', 'rna', or 'protein'). When the alphabet is
set then Bioperl will not attempt to guess what the alphabet is. This
may be important because Bioperl does not always guess correctly.


-jason

On Sep 12, 2005, at 11:20 AM, John Damask wrote:

> hi
> This record appears in NCBInr:
>
>> gi|999554|pdb|1EFG|C Chain C, Elongation Factor G Complexed With  
>> Guanosine
>>
> 5'-Diphosphate
> XXXXXXXXXXXXXXXXXXXXXXXXXXXX
>  BioPerl 1.5 throws "MSG: Got a sequence with no letters in it  
> cannot guess
> alphabet []"
>  This seems to be because the PrimarySeq->_guess_alphabet() method now
> contains a regex to remove "X" (compared with BioPerl 1.4).
> I don't want to throw away this record (or others of its type if they
> exist).
>  Suggestions on how to handle this?
>  Thanks
> John
>
> _______________________________________________
> Bioperl-guts-l mailing list
> Bioperl-guts-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-guts-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From fgarret at ub.edu  Tue Sep 13 06:06:30 2005
From: fgarret at ub.edu (Filipe Garrett)
Date: Tue Sep 13 05:59:29 2005
Subject: [Bioperl-l] Bio::Tree::Node set root_node
Message-ID: <4326A4A6.7050305@ub.edu>

Hi all,

I have a Bio::Tree object:
((GA11747-PA_dpse:0,(Obp8a-PA_dmel,SIM12665-PA_dsim:0):0):0);
where the initial branch only has one descendant.

How can I eliminate the first branch?
Can I just re-set the descendant as root node?

Thanks in advance,

Best regards,

FG
From shikida at gmail.com  Mon Sep 12 15:52:38 2005
From: shikida at gmail.com (Leonardo Kenji Shikida)
Date: Tue Sep 13 08:07:13 2005
Subject: [Bioperl-l] affymetrix CHP XDA (version 5)
Message-ID: <1b43644005091212526f5acfaa@mail.gmail.com>

I'd like to test the parser, where can I find a XDA file to test it?

thanks in advance

Kenji
_______________________
http://kenjiria.blogspot.com 
http://gaitabh.blogspot.com

From heikki at ebi.ac.uk  Tue Sep 13 09:04:15 2005
From: heikki at ebi.ac.uk (Heikki Lehvaslaiho)
Date: Tue Sep 13 09:02:22 2005
Subject: [Bioperl-l] affymetrix CHP XDA (version 5)
In-Reply-To: <1b43644005091212526f5acfaa@mail.gmail.com>
References: <1b43644005091212526f5acfaa@mail.gmail.com>
Message-ID: <200509131404.15314.heikki@ebi.ac.uk>


Kenji,

If you are talking about perl Bio::Affymetrix modules
 http://search.cpan.org/~skippy/Bio-Affymetrix-0.5/
(which are not part of BioPerl), the module documentation points to:

http://www.affymetrix.com/support/developer/AffxFileFormats.ZIP

but does not point to sample files.

Maybe someone hon the list uses these modules. You could contact the authors, 
of course.

Yours,
 -Heikki

On Monday 12 September 2005 20:52, Leonardo Kenji Shikida wrote:
> I'd like to test the parser, where can I find a XDA file to test it?
>
> thanks in advance
>
> Kenji
> _______________________
> http://kenjiria.blogspot.com
> http://gaitabh.blogspot.com
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l

-- 
______ _/      _/_____________________________________________________
      _/      _/                      http://www.ebi.ac.uk/mutations/
     _/  _/  _/  Heikki Lehvaslaiho    heikki at_ebi _ac _uk
    _/_/_/_/_/  EMBL Outstation, European Bioinformatics Institute
   _/  _/  _/  Wellcome Trust Genome Campus, Hinxton
  _/  _/  _/  Cambridge, CB10 1SD, United Kingdom
     _/      Phone: +44 (0)1223 494 644   FAX: +44 (0)1223 494 468
___ _/_/_/_/_/________________________________________________________
From ferdinand.marletaz at gmail.com  Tue Sep 13 05:58:32 2005
From: ferdinand.marletaz at gmail.com (Ferdinand Marletaz)
Date: Tue Sep 13 11:32:33 2005
Subject: [Bioperl-l] In silico Chromosome Walking
Message-ID: <4FC04CBA-390D-4FE0-A04E-11D323814B51@gmail.com>

Hi,

I'd like to find a script to make a kind of chromosome walking in  
matching pieces of cDNA on Traces of a Genome in order to find whole  
gene sequence from a little degenerate PCR fragment (100-500 pb).   
I've heard about  GenoTrace but it seems impossible to get it on the  
internet (link doesn't work http://rat.niob.knaw.nl/GENOTRACE/)  and  
I haven't understood if it requires full length cDNA or if it can  
work with shorter sequences (it would be possible to run GenScan on  
the previously obtained contig...)

Does anybody have the source of GenoTrace or an idea for my problem.

Thank you very much

Ferdi





___________________________________________
Ferdinand Marl?taz
Structure and Evolution of Nuclear Hormone Receptors
Laboratoire de Biologie Mol?culaire de la Cellule (UMR 5161)
Ecole Normale Sup?rieure de Lyon
46, All?e d'Italie
69364 Lyon Cedex 07,  France
Tel. (33) 04 72 72 82 85
Port. 33 (0)6 30 35 58 49
Fax. (33) 04 72 72 80 80
Mail. Ferdinand.Marletaz@ens-lyon.fr









From razi at genet.sickkids.on.ca  Tue Sep 13 12:07:10 2005
From: razi at genet.sickkids.on.ca (Razi Khaja)
Date: Tue Sep 13 12:02:57 2005
Subject: [Bioperl-l] In silico Chromosome Walking
In-Reply-To: <4FC04CBA-390D-4FE0-A04E-11D323814B51@gmail.com>
Message-ID: <20050913160711.92292.qmail@web51609.mail.yahoo.com>

Hello Ferdi,
There is a software called PartiGene that may do this type analysis.  I
have never used this software but have heard from some of the researchers
here that it is able to construct gene sequences from EST fragments.  If
this is what you are trying to do, you may want to look at
http://www.nematodes.org/PartiGene/
Hope that helps.
Razi 


--- Ferdinand Marletaz  wrote:

> Hi,
> 
> I'd like to find a script to make a kind of chromosome walking in  
> matching pieces of cDNA on Traces of a Genome in order to find whole  
> gene sequence from a little degenerate PCR fragment (100-500 pb).   
> I've heard about  GenoTrace but it seems impossible to get it on the  
> internet (link doesn't work http://rat.niob.knaw.nl/GENOTRACE/)  and  
> I haven't understood if it requires full length cDNA or if it can  
> work with shorter sequences (it would be possible to run GenScan on  
> the previously obtained contig...)
> 
> Does anybody have the source of GenoTrace or an idea for my problem.
> 
> Thank you very much
> 
> Ferdi
> 
> 
> 
> 
> 
> ___________________________________________
> Ferdinand Marl?taz
> Structure and Evolution of Nuclear Hormone Receptors
> Laboratoire de Biologie Mol?culaire de la Cellule (UMR 5161)
> Ecole Normale Sup?rieure de Lyon
> 46, All?e d'Italie
> 69364 Lyon Cedex 07,  France
> Tel. (33) 04 72 72 82 85
> Port. 33 (0)6 30 35 58 49
> Fax. (33) 04 72 72 80 80
> Mail. Ferdinand.Marletaz@ens-lyon.fr
> 
> 
> 
> 
> 
> 
> 
> 
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
> 


/**
 * Razi Khaja, Bioinformatics Analyst
 * The Hospital for Sick Children, Toronto
 * The Centre for Applied Genomics, www.tcag.ca
 * Tel 416-813-7032, Fax 416-813-8319
 */
From palmeida at igc.gulbenkian.pt  Tue Sep 13 14:01:18 2005
From: palmeida at igc.gulbenkian.pt (Paulo Almeida)
Date: Tue Sep 13 14:16:29 2005
Subject: [Bioperl-l] Remote Blast addendum
Message-ID: <200509131901.18131.palmeida@igc.gulbenkian.pt>

I'm using BioPerl 1.4
From MEC at Stowers-Institute.org  Tue Sep 13 17:38:44 2005
From: MEC at Stowers-Institute.org (Cook, Malcolm)
Date: Tue Sep 13 18:27:42 2005
Subject: [Bioperl-l] In silico Chromosome Walking
Message-ID: <200509132227.j8DMRTAH025615@portal.open-bio.org>

Ferdinand,


You might email Edwin Cuppen  (cc:ed) for help with genotrace installs.  I have locally installed genotrace using distribs he provided me.  He was also willing to add my favorite organism du jour (Sea Urchin) to the list of organisms when i asked him nicely (back in August '04 when it mattered)....


Earlier he wrote me:

	Attached is genotrace distrib file. It contains both versions 1 and 2. V1 is 
	not supported anymore but well-documented. It is suitable for stand-alone 
	installation. Version 2 is a web version that uses sanger ssaha server. 
	Currently, there is no documentation for v2, so you'll have to figure out how 
	to use it by yourself. Some quick tips: 
	-There are differences in how traces are stored in v1. and v2. You need MySQL 
	for v2. 
	-Put files from "bin" directory to e.g. "/usr/local/bin/genotrace", and files 
	from "htdocs" directory into your apache tree. 
	-Check scripts in "cgi-bin" and modify $GHOME and $GBIN if necessary. 
	-Check scripts in "bin" directory and modify $mysqluser. 
	-Run genotrace_installDB. 
	-There is a long list of prerequisite software. You'll figure it out in the 
	process. 

If you don't get a rise from him, email me and I'll forward the (GPL'ed) source to you...

Sorry for the brevity of my earlier response.

--Malcolm

-----Original Message-----
From: bioperl-l-bounces@portal.open-bio.org [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Ferdinand Marletaz
Sent: Tuesday, September 13, 2005 4:59 AM
To: bioperl-l@portal.open-bio.org
Subject: [Bioperl-l] In silico Chromosome Walking


Hi,

I'd like to find a script to make a kind of chromosome walking in  
matching pieces of cDNA on Traces of a Genome in order to find whole  
gene sequence from a little degenerate PCR fragment (100-500 pb).   
I've heard about  GenoTrace but it seems impossible to get it on the  
internet (link doesn't work http://rat.niob.knaw.nl/GENOTRACE/)  and  
I haven't understood if it requires full length cDNA or if it can  
work with shorter sequences (it would be possible to run GenScan on  
the previously obtained contig...)

Does anybody have the source of GenoTrace or an idea for my problem.

Thank you very much

Ferdi





___________________________________________
Ferdinand Marl?taz
Structure and Evolution of Nuclear Hormone Receptors
Laboratoire de Biologie Mol?culaire de la Cellule (UMR 5161)
Ecole Normale Sup?rieure de Lyon
46, All?e d'Italie
69364 Lyon Cedex 07,  France
Tel. (33) 04 72 72 82 85
Port. 33 (0)6 30 35 58 49
Fax. (33) 04 72 72 80 80
Mail. Ferdinand.Marletaz@ens-lyon.fr









_______________________________________________
Bioperl-l mailing list
Bioperl-l@portal.open-bio.org
http://portal.open-bio.org/mailman/listinfo/bioperl-l

From bmoore at genetics.utah.edu  Wed Sep 14 20:53:00 2005
From: bmoore at genetics.utah.edu (Barry Moore)
Date: Thu Sep 15 17:26:04 2005
Subject: [Bioperl-l] query
Message-ID: 

Neeti,

I think that if you set the sequence format to fasta, it will pull
together the joins and give you the sequence you're after.  Maybe
someone can correct me on that if I'm wrong.  I haven't done that, I
think I remember reading something like that though.

Barry

-----Original Message-----
From: bioperl-l-bounces@portal.open-bio.org
[mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Neeti
Somaiya
Sent: Monday, September 12, 2005 5:56 AM
To: bioperl-l@portal.open-bio.org
Subject: [Bioperl-l] query

Barry,

I went through your code for parsing of GenBank files.It works perfectly

fine,but for GenBank files of contigs,as in,sequences with NT 
accessions.Could you help me in this regard.

Thanks,
Neeti.
_______________________________________________
Bioperl-l mailing list
Bioperl-l@portal.open-bio.org
http://portal.open-bio.org/mailman/listinfo/bioperl-l

From bmoore at genetics.utah.edu  Wed Sep 14 20:41:02 2005
From: bmoore at genetics.utah.edu (Barry Moore)
Date: Thu Sep 15 17:26:07 2005
Subject: [Bioperl-l] releasing next week
Message-ID: 

Brian-

Sorry for the slow reply - temporarily abandoned my e-mail due to a
deadline.  My mistake on the file error - I was running the test script
from within the t directory, so it couldn't create t/tmp.  When I moved
back to bioperl-live directory it works fine.  This was hiding the real
failure in my RestrictionIO.t which.  Test 10 is failing.  The error is:

# Test 10 got: '9' (t/RestrictionIO.t at line 53)
#    Expected: '11'

Test 10 reads rebase.withrefm file.  This file has a couple of multiple
site cutters.  It correctly reads the first multi site cutter, and adds
it to the object, but fails to add the last two rest enzymes in the file
(another multi-site cutter and a single site cutter).  Oddly, if I step
into  Bio::Restriction::IO::base::_make_multisites method with the
debugger while parsing the second multi site cutter (the one that is
failing to get parsed correctly)  - not changing anything, just stepping
one line into the method - it parses fine, the object contains all the
re's and the test passes just fine.  That one's got me stumped.  If
anyone has suggestions for debugging that let me know.

Barry

-----Original Message-----
From: Brian Osborne [mailto:brian_osborne@cognia.com] 
Sent: Friday, September 09, 2005 12:43 PM
To: Barry Moore; Jason Stajich; bioperl-l
Subject: Re: [Bioperl-l] releasing next week

Barry,

my $tmpdir = "t/tmp";
mkdir($tmpdir,0777);

So this fails for you? What about:

mkdir $tmpdir

?

Brian O.


On 9/9/05 12:16 AM, "Barry Moore"  wrote:

> Jason,
> 
> BioDBGFF.t failed cause I gave it the wrong Postgres login detail -
> can't remember my damn password!
> RemoteBlast.t passed when run individually.
> RestrictionIO.t failed to open an output file because the directory
> didn't exist, and it wasn't clear to me why it should.
> Didn't look into tutorial.t failures.
> 
> System is Debian Woody, Perl 5.6.1, and fresh live bioperl.
> 
> Failed Test       Stat Wstat Total Fail  Failed  List of Failed
>
------------------------------------------------------------------------
> -------
> t/BioDBGFF.t                   138  138 100.00%  1-138
> t/RemoteBlast.t      2   512     6    1  16.67%  2
> t/RestrictionIO.t               14    1   7.14%  10
> t/tutorial.t       255 65280    21    6  28.57%  19-21
> 122 subtests skipped.
> Failed 4/215 test scripts, 98.14% okay. 143/9892 subtests failed,
98.55%
> okay.
> 
> Barry
> 
> -----Original Message-----
> From: bioperl-l-bounces@portal.open-bio.org
> [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Jason
> Stajich
> Sent: Thursday, September 08, 2005 3:30 PM
> To: bioperl-l List
> Cc: Scott Cain
> Subject: [Bioperl-l] releasing next week
> 
> All tests pass for me on two different machines.
> 
> If you have any reason for the 1.5.1 release to not happen next week,
> please speak up now.  I'm trying to time it with the GMOD Gbrowse
> release so people can feel comfortable upgrading to bioperl 1.5 and
> the latest Gbrowse at the same time.
> 
> The only test failing for me to DBCUTG.t this seems  to be a
> webserver error - perhaps they have changed their interface?  This is
> rather minor so I won't let it hold up the release if no one looks at
> it before next week.
> 
> I'm choosing to ignore the "" overloading in SeqFeature/Annotation
> objects for 1.5.1.  Similarly, adding additional seqfeature tests are
> going to be on the backburner for this release but need to be done
> before the 1.6 release.
> 
> I'd like to see if we can help Brian with the SeqIO test overhaul.
> This seems like the only other outstanding issue.
> 
> My feeling is the TypedSeqFeature implementation can wait, perhaps in
> a future 1.5.x in prep for 1.6.
> 
> I'm thinking I will try and put a release candidate up by Monday and
> release as soon as a few people have tested it out.  Please do me a
> favor and do a fresh CVS checkout and run make test on your own
> machines to see what else still needs work.
> 
> 
> -jason
> --
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
> 
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l



From jimhu at TAMU.EDU  Wed Sep 14 21:31:49 2005
From: jimhu at TAMU.EDU (Jim Hu)
Date: Thu Sep 15 18:22:32 2005
Subject: [Bioperl-l] Problems with circular genomes
Message-ID: 

Most bacterial and many viral genomes are circular. Some, like T4 are  
physically linear but circularly permuted, giving a circular genetic  
map.

is_circular is a flag that is settable and gettable (I think) in  
BioPerlBio::PrimarySeqI. Although Lincoln emailed me that he thinks  
there is a workaround for this for GBrowse, I haven't been able to  
figure out how to be able to scroll the viewer around the circle.  
Worse, I have no clue about how to handle features that cross the  
circle junction.  It's not clear to me how it can be done within the  
current GFF3 format.

It's not enough to be able to specify a circular genome, one has to  
be able to specify which way a feature goes around the circle. Note  
that one can NOT assume that features will always go the short way  
around... the late mRNAs for many viruses are very, very long, and a   
transposon inserted in a small plasmid can be bigger than the parent  
plasmid.  It seems to me that either an additional column should be  
used for direction (right or left relative to start), or the  
constraints on start and end should be relaxed so that if start>end  
and is_circular is true the feature goes around the circle across the  
junction clockwise.

This is also a problem in the lightweight annotation file format for  
external uploads, where there are only three required columns and the  
start..end relationship is used to specify strand, not direction.

I suspect that this has been addressed before, but I wasn't able to  
figure it out from the archives or the docs...but then I'm not a  
programming wizard by a long shot. I did find this message on Bio-SQL  
archive (via Google) from Hilmar Lapp:

http://open-bio.org/pipermail/biosql-l/2005-June/000859.html

But I didn't see a resolution.
=====================================
Jim Hu
Associate Professor and Associate Head for Graduate Programs
Dept. of Biochemistry and Biophysics
2128 TAMU
Texas A&M Univ.
College Station, TX 77843-2128
979-862-4054


From Richard.Adams at ed.ac.uk  Wed Sep 14 08:36:05 2005
From: Richard.Adams at ed.ac.uk (Richard Adams)
Date: Thu Sep 15 21:10:17 2005
Subject: [Bioperl-l] Re: releasing next week
Message-ID: <43281935.809@ed.ac.uk>

Have tested DBCUTG.t and it seems OK, I don't think they have changed 
their interface

-- 
Dr Richard Adams
Psychiatric Genetics Group,
Medical Genetics,
Molecular Medicine Centre,
Western General Hospital,
Crewe Rd West,
Edinburgh UK
EH4 2XU

Tel: 44 131 651 1084
richard.adams@ed.ac.uk


From thechans at citiz.net  Fri Sep 16 06:24:27 2005
From: thechans at citiz.net (Zhe Chen)
Date: Fri Sep 16 06:35:28 2005
Subject: [Bioperl-l] Wrong MSG using clustalW
Message-ID: <200509161031.j8GAVTnq012787@portal.open-bio.org>

Pls Help: I want to append a new sequence to an existing MSF alignment profile. the following code is just copied from the tutorial. it still received a wrong msg. I am using WinXP system with ClustalW1.83.XP. How to solve it?
MSG:
ERROR: Could not open sequence file (-profile) 
No. of seqs. read = -1. No alignment!

#begin
use Bio::AlignIO;
use Bio::SeqIO;
use Bio::Seq;
use Bio::Tools::Run::Alignment::Clustalw;

my @params = ('ktuple' => 2, 'matrix' => 'BLOSUM');
my $factory = Bio::Tools::Run::Alignment::Clustalw->new(@params);
$str = Bio::AlignIO->new(-file=> 'cysprot1a.msf');
#$aln = $str->next_aln();
#$str1 = Bio::SeqIO->new(-file=> 'cysprot1b.fa');
#$seq = $str1->next_seq();
#$aln = $factory->profile_align($aln,$seq);
#end

From palmeida at igc.gulbenkian.pt  Wed Sep 14 09:36:47 2005
From: palmeida at igc.gulbenkian.pt (Paulo Almeida)
Date: Fri Sep 16 10:29:23 2005
Subject: [Bioperl-l] RemoteBlast - Can't call method "query_name" on an
	undefined value
Message-ID: <200509141436.48121.palmeida@igc.gulbenkian.pt>

Hi,

Remote blasts have been giving me this error:

Can't call method "query_name" on an undefined value at testblast.pl line 43,
 line 29

The ID of the BLAST search worked on the web (Retrieve results by ID on
 NCBI).

This is the result of running the debugger on the attached testblast.pl
 script with the attached amino.fa file (the script follows the synopsis
 closely):

------------

  DB<3> n
main::(testblast.pl:32):              foreach my $rid ( @rids ) {
  DB<3> x $rid
0  undef
  DB<4> n
main::(testblast.pl:33):                my $rc =
$factory->retrieve_blast($rid);
  DB<4> x $rid
0  '1126626136-15184-184931694060.BLASTQ3'
  DB<5> n
main::(testblast.pl:34):                if( !ref($rc) ) {
  DB<5> x $rc
0  Bio::SearchIO::blast=HASH(0x8df4484)
   '_file' => '/tmp/5A3aAj4SvD'
   '_filehandle' => GLOB(0x8d3b814)
      -> *Symbol::GEN4
            FileHandle({*Symbol::GEN4}) => fileno(8)
   '_flush_on_write' => 1
   '_handler' =>
Bio::SearchIO::IteratedSearchResultEventBuilder=HASH(0x8f23db0)
      '_factories' => HASH(0x8f2eb60)
         'hit' => Bio::Factory::ObjectFactory=HASH(0x8ee9754)
            '_loaded_types' => HASH(0x8f2ebe4)
               'Bio::Search::Hit::BlastHit' => 1
            '_root_verbose' => 0
            'interface' => 'Bio::Search::Hit::HitI'
            'type' => 'Bio::Search::Hit::BlastHit'
         'hsp' => Bio::Factory::ObjectFactory=HASH(0x8ee96f4)
            '_loaded_types' => HASH(0x8f2ebf0)
               'Bio::Search::HSP::GenericHSP' => 1
            '_root_verbose' => 0
            'interface' => 'Bio::Search::HSP::HSPI'
            'type' => 'Bio::Search::HSP::GenericHSP'
         'iteration' => Bio::Factory::ObjectFactory=HASH(0x8ee9694)
            '_loaded_types' => HASH(0x8f2eb6c)
               'Bio::Search::Iteration::GenericIteration' => 1
            '_root_verbose' => 0
            'interface' => 'Bio::Search::Iteration::IterationI'
            'type' => 'Bio::Search::Iteration::GenericIteration'
         'result' => Bio::Factory::ObjectFactory=HASH(0x8f1c07c)
            '_loaded_types' => HASH(0x8efae84)
               'Bio::Search::Result::BlastResult' => 1
            '_root_verbose' => 0
            'interface' => 'Bio::Search::Result::ResultI'
            'type' => 'Bio::Search::Result::BlastResult'
      '_inclusion_threshold' => 0.001
      '_root_verbose' => 0
   '_handler_cache' =>
Bio::SearchIO::IteratedSearchResultEventBuilder=HASH(0x8f23db0)
      -> REUSED_ADDRESS
   '_notfirsttime' => 0
   '_reporttype' => ''
   '_root_cleanup_methods' => ARRAY(0x8d3b7e4)
      0  CODE(0x845bb8c)
         -> &Bio::Root::IO::_io_cleanup
in /usr/share/perl5/Bio/Root/IO.pm:544-570
      1  CODE(0x845bb8c)
         -> REUSED_ADDRESS
   '_root_verbose' => 0
  DB<6> n
main::(testblast.pl:41):                  my $result = $rc->next_result();
  DB<6> n
main::(testblast.pl:43):                  my $filename =
$result->query_name()."\.out";
  DB<6> x $rc->next_result()
0  undef
  DB<7> n
Can't call method "query_name" on an undefined value at testblast.pl line 43,
 line 29.
Debugged program terminated.  Use q to quit or R to restart,

---------------------

What could be going on here?

-- 
Paulo Almeida
Tel: +351 21 4464635, Fax: +351 21 4407970
Instituto Gulbenkian de Ci?ncia
Rua da Quinta Grande, 6
P-2780-156 Oeiras
Portugal
http://www.igc.gulbenkian.pt
-------------- next part --------------
A non-text attachment was scrubbed...
Name: testblast.pl
Type: application/x-perl
Size: 1793 bytes
Desc: not available
Url : http://portal.open-bio.org/pipermail/bioperl-l/attachments/20050914/86456160/testblast.bin
-------------- next part --------------
>gi|44039|emb|CAA43547.1| Lys-aminopeptidase [Lactococcus lactis subsp. cremoris]
MAVKRLIETFVPENYKIFLDIDRKTKKIKGQVAITGEAKDTVVAFHAKGLHFNKVRAFSVDTNFIENEED
EEIVVKIGETGRVTVSFEYEAELTDNMMGIYPSYYEVNGEKKMLIGTQFESHFARQAFPSIDEPEAKATF
DLSVKFDEEEGDIIVSNMPELLNINGIHVFERTVKMSSYLLAFVFGELQYKKGKTKSGVEVGAFATKAHS
QAALDFPLDIAIRSIEFYEDYYQTPYPLPHSWHIALPDFSSGAMENWGCITYREVCMLVDPENATIQSKQ
YVATVIAHELAHQWFGDLVTMQWWDDLWLNESFANNMEYVCMDALEPSWNVWESFSISEANMALNRDATD
GVQSVHVEVTHPDEIGTLFDPAIVYAKGSRLMVMLRKWLGDEDFAAGLALYFKRHQYGNTVGDNLWDALA
EVSGKDVAAFMHSWVNQPGYPVVTAEVVDDTLILSQKQFFVGEGVDKGRLWNVPLNTNWTGLPDLLSSEK
VEIPGFAALKTKNNGKALFLNDANMAHYIIDYKGALLTDLLSEVESLENVTKFQILQDRKLLAKAGVISY
ADVVNILPSFTNEESYLVNTGLSQLISELELFVDEDSETEKAFQSLVGKLFAKNYARLGWDKVAGESAGD
ESLRGIVLSKTLYSENADAKTKASQIFATHKENLASIPADIRPIVLNNEIKTTNSAELVKTYRETYIKTS
LQEFKRELEGAVALIKDEKVIAELLESFKNADIVKPQDIAFSWFYLLRNDFSQDAAWAWEKANWASLEEK
LGGDMSYDKFVIYPGNTFKTADKLAEYKAFFEPKLENQGLKRSIEMAIKQITARVALIDSQKAAVDKAIT
DIAEKL
From jason.stajich at duke.edu  Fri Sep 16 10:34:21 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Fri Sep 16 10:33:58 2005
Subject: [Bioperl-l] Bio::Tree::Node set root_node
In-Reply-To: <4326A4A6.7050305@ub.edu>
References: <4326A4A6.7050305@ub.edu>
Message-ID: 

There is a reroot function you can use - documented in  
Bio::Tree::TreeFunctionsI

I believe it is covered in the HOWTO as well.

Let us know if you still have questions.
-jason

On Sep 13, 2005, at 6:06 AM, Filipe Garrett wrote:

> Hi all,
>
> I have a Bio::Tree object:
> ((GA11747-PA_dpse:0,(Obp8a-PA_dmel,SIM12665-PA_dsim:0):0):0);
> where the initial branch only has one descendant.
>
> How can I eliminate the first branch?
> Can I just re-set the descendant as root node?
>
> Thanks in advance,
>
> Best regards,
>
> FG
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From skirov at utk.edu  Fri Sep 16 15:02:52 2005
From: skirov at utk.edu (Stefan Kirov)
Date: Fri Sep 16 15:03:13 2005
Subject: [Bioperl-l] entrezgene binary ASN
Message-ID: <432B16DC.6040901@utk.edu>

NCBI provides now only the binary ASN format. Entrezgene parser will not 
parse it, but you can convert with gene2xml:

RT - Shiryayev, Sergey (NIH/NLM/NCBI) wrote:


>>Stefan,
>>
>>Try this:
>>
>>./gene2xml -i All_Data.ags.gz -c -x -b | more
>>
>> 
>>Sergey Shiryayev
>>NCBI Contractor 
>
Note that you shoul proceed the gzipped file.
Stefan
From jason.stajich at duke.edu  Fri Sep 16 13:03:09 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Fri Sep 16 16:54:33 2005
Subject: [Bioperl-l] RemoteBlast retrieve_blast cannot return
	Bio::SearchIO::blasttable
In-Reply-To: 
References: 
Message-ID: <5C32EB65-CEF3-415B-B11C-7541C9C30BCF@duke.edu>

This is committed as well as support for the XML format.  The  
blasttable stuff took some work because one has to parse out the  
 block from the result file so this is quite hacky, but  
appears to work.

The t/RemoteBlast.t illustrates how to use the XML format.  According  
to NCBI this is the only real "approved" way of getting alignments  
from the website that is guaranteed to be consistent.  We may want to  
change it to be the XML format as the default in the future.

Currently the user has to keep the readmethod and ALIGNMENT_VEW/ 
FORMAT_TYPE fields synchronized properly.  Maybe someone will want to  
work harder on this module in the future and control all of this with  
a single method.

Cut+Paste from t/RemoteBlast.t
Here is how I get BLASTXML back -- the '-readmethod' is now 'xml' and  
I set the FORMAT_TYPE retrieval header to 'XML'
my $remote_blastxml = Bio::Tools::Run::RemoteBlast->new
     ('-verbose'    => $v,
      '-prog'       => $prog,
      '-data'       => $db,
      '-readmethod' => 'xml',
      '-expect'     => $e_val,
      );
$remote_blast->submit_parameter('ENTREZ_QUERY',
                 'Escherichia coli[ORGN]');

$remote_blastxml->retrieve_parameter('FORMAT_TYPE', 'XML');
$inputfilename = Bio::Root::IO->catfile("t","data","ecolitst.fa");

Here is blasttable in action
my $remote_blast2 = Bio::Tools::Run::RemoteBlast->new
     ('-verbose'    => $v,
      '-prog'       => $prog,
      '-data'       => $db,
      '-readmethod' => 'blasttable',
      '-expect'     => $e_val,
      );
$remote_blast2->submit_parameter('ENTREZ_QUERY',
                 'Escherichia coli[ORGN]');

$remote_blast2->retrieve_parameter('ALIGNMENT_VIEW', 'Tabular');

$inputfilename = Bio::Root::IO->catfile("t","data","ecolitst.fa");


-jason
On Sep 1, 2005, at 3:52 PM, Paul G Cantalupo wrote:

> Hello,
>
> When using RemoteBlast with ALIGNMENT_VIEW = 'Tabular' (-m8 output)  
> the method 'retrieve_blast' should return a  
> Bio::SearchIO::blasttable object to handle the parsing of -m8  
> output. I think the easiest way to do this is by changing  
> 'retrieve_blast'
>
> FROM:
>
> if( $self->readmethod =~ /BPlite/ ) {
>    $blastobj = new Bio::Tools::BPlite(-file => $tempfile);
> } else {
>    $blastobj = new Bio::SearchIO( -file => $tempfile,
>                                   -format => 'blast');
> }
>
>
> TO:
>
>
> if( $self->readmethod =~ /BPlite/ ) {
>    $blastobj = new Bio::Tools::BPlite(-file => $tempfile);
> } elsif( $self->readmethod =~ /blasttable/ ) {
>    $blastobj = new Bio::SearchIO( -file => $tempfile,
>                                   -format => 'blasttable');
> } else {
>    $blastobj = new Bio::SearchIO( -file => $tempfile,
>                                   -format => 'blast');
> }
>
>
> Any suggestions/criticisms?
>
> Paul
>
>
> Paul Cantalupo
> Research Specialist/Systems Programmer
> 559 Crawford Hall
> Department of Biological Sciences
> University of Pittsburgh
> Pittsburgh, PA 15260
> Work: 412-624-4687
> Fax: 412-624-4759
>
> Ask me about Toastmasters: www.toastmasters.org
> Midday Club Treasurer
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From avilella at gmail.com  Mon Sep 19 07:00:38 2005
From: avilella at gmail.com (Albert Vilella)
Date: Mon Sep 19 08:54:18 2005
Subject: [Bioperl-l] Bio::Tree method - FixedTopo tree factory with random
	branchlengths
Message-ID: <1127127638.7449.1.camel@localhost.localdomain>

Dears,

I am looking to implement a method for a Bio::Tree object that will
generate a number of trees with the same topology as the input tree
but with random branch lengths for each branch given.

I would like to ask where do you think is the best place to implement
this: RandomFactory.pm ? Maybe this should go inside
DistanceFactory ? Maybe put in another module.

My idea is that one would call the method with something similar to
this:

my $treeio = new Bio::TreeIO(-format => 'newick', -file =>
'treefile.dnd');
my $tree = $treeio->next_tree;
my $out = Bio::TreeIO->new
    (
     -format => 'newick',
     -file   => ">$outfile"
    );
my $factory = new Bio::Tree::RandomFactory(
        -tree => $tree,
        -maxcount => $maxcount,
        -method => "fixedtopo",
        );

while(my $generatedtree = $factory->next_tree) {
    $out->write_tree($generatedtree);
}

There would be something like a "fixedtopo_maxlen" so that the random
lengths fall inside the (0..maxlen) range.

I would be glad to know how do you think this could be implemented, of
if there is an easier way to do so with the current methods.

Thanks in advance,

    Albert.


From skirov at utk.edu  Mon Sep 19 09:56:25 2005
From: skirov at utk.edu (Stefan Kirov)
Date: Mon Sep 19 09:56:46 2005
Subject: [Bioperl-l] Bio::Species validate_species_name
Message-ID: <432EC389.8010705@utk.edu>

NCBI and Bio::Species have very different views on what is the format of 
a species field. Is it possible to relax a bit the species regular 
expression? For example, 'Rhizophidium sp. 136' is a valid NCBI species 
name, but this is not the case in bioperl (species name in this case is 
starting with a number). There are other collisions as well, such as 
special characters found in the species name: ()'/
Any thoughts?
Stefan
From jason.stajich at duke.edu  Mon Sep 19 10:12:26 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Mon Sep 19 10:12:25 2005
Subject: [Bioperl-l] Bio::Tree method - FixedTopo tree factory with random
	branchlengths
In-Reply-To: <1127127638.7449.1.camel@localhost.localdomain>
References: <1127127638.7449.1.camel@localhost.localdomain>
Message-ID: <8D36636C-CDDF-4287-9B6F-360D179930D2@duke.edu>

That API looks great - I would prefer this to be in  
Tree::RandomFactory if possible.

You can just add code in next_tree to see if tree object is already  
stored and the method is 'fixedtopo', then return trees from that in  
the same fashion as the rest of the random topos are generated.

As for implementation - I think you need to decide how you want  the  
branch lengths to be distributed.  You can see how time is applied to  
each node in the rand_birthdeath_backwards_tree() function in the  
Tree::RandomFactory - but I think I assign brlens first and then  
build up the tree from that so the lengths are distributed properly  
on each level.

I took a lot of the tree generation code from Mike Sanderson's r8s  
package (based on his advice) - you may want to trawl around in the  
tree building literature to get a better sense of how to best  
generate branch lengths.  I'm sure smarter folks than I could point  
you to the right the literature but I don't know it off the top of my  
head.

-jason
On Sep 19, 2005, at 7:00 AM, Albert Vilella wrote:

> Dears,
>
> I am looking to implement a method for a Bio::Tree object that will
> generate a number of trees with the same topology as the input tree
> but with random branch lengths for each branch given.
>
> I would like to ask where do you think is the best place to implement
> this: RandomFactory.pm ? Maybe this should go inside
> DistanceFactory ? Maybe put in another module.
>
> My idea is that one would call the method with something similar to
> this:
>
> my $treeio = new Bio::TreeIO(-format => 'newick', -file =>
> 'treefile.dnd');
> my $tree = $treeio->next_tree;
> my $out = Bio::TreeIO->new
>     (
>      -format => 'newick',
>      -file   => ">$outfile"
>     );
> my $factory = new Bio::Tree::RandomFactory(
>         -tree => $tree,
>         -maxcount => $maxcount,
>         -method => "fixedtopo",
>         );
>
> while(my $generatedtree = $factory->next_tree) {
>     $out->write_tree($generatedtree);
> }
>
> There would be something like a "fixedtopo_maxlen" so that the random
> lengths fall inside the (0..maxlen) range.
>
> I would be glad to know how do you think this could be implemented, of
> if there is an easier way to do so with the current methods.
>
> Thanks in advance,
>
>     Albert.
>
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From hlapp at gmx.net  Mon Sep 19 12:25:37 2005
From: hlapp at gmx.net (Hilmar Lapp)
Date: Mon Sep 19 12:32:31 2005
Subject: [Bioperl-l] Bio::Species validate_species_name
In-Reply-To: <432EC389.8010705@utk.edu>
References: <432EC389.8010705@utk.edu>
Message-ID: <5cb416b63ac7506b0d2a49b89649e96e@gmx.net>

If you set the classification array and pass a second argument that 
eval's to true validation is turned off. See 
Bio::Species::classification. This is what the SeqIO parsers do (or 
should do).

	-hilmar

On Sep 19, 2005, at 6:56 AM, Stefan Kirov wrote:

> NCBI and Bio::Species have very different views on what is the format 
> of a species field. Is it possible to relax a bit the species regular 
> expression? For example, 'Rhizophidium sp. 136' is a valid NCBI 
> species name, but this is not the case in bioperl (species name in 
> this case is starting with a number). There are other collisions as 
> well, such as special characters found in the species name: ()'/
> Any thoughts?
> Stefan
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>
>
-- 
-------------------------------------------------------------
Hilmar Lapp                            email: lapp at gnf.org
GNF, San Diego, Ca. 92121              phone: +1-858-812-1757
-------------------------------------------------------------


From mseewald at gmail.com  Tue Sep 20 03:15:12 2005
From: mseewald at gmail.com (Michael Seewald)
Date: Tue Sep 20 03:40:45 2005
Subject: [Bioperl-l] entrezgene binary ASN
In-Reply-To: <432B16DC.6040901@utk.edu>
References: <432B16DC.6040901@utk.edu>
Message-ID: 

Hi Stefan,

The most convenient way would be to open it as a pipe:

my $parser = Bio::ASN1::EntrezGene->new('file' => "gene2xml -i 
Homo_sapiens.ags.gz -c -x -b | ");
while(my $result = $parser->next_seq) {
#...
}

It may be actually faster than before, because you save disk I/O. And even 
better, there is no need to rewrite the parsers.

Best wishes,
Michael


On 9/16/05, Stefan Kirov  wrote:
> 
> NCBI provides now only the binary ASN format. Entrezgene parser will not
> parse it, but you can convert with gene2xml:
> 
> RT - Shiryayev, Sergey (NIH/NLM/NCBI) wrote:
> 
> 
> >>Stefan,
> >>
> >>Try this:
> >>
> >>./gene2xml -i All_Data.ags.gz -c -x -b | more
> >>
> >>
> >>Sergey Shiryayev
> >>NCBI Contractor
> >
> Note that you shoul proceed the gzipped file.
> Stefan
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
> 

-- 
Dr. Michael Seewald
Bioinformatics
Bayer HealthCare AG

From iain.m.wallace at gmail.com  Tue Sep 20 05:28:19 2005
From: iain.m.wallace at gmail.com (Iain Wallace)
Date: Tue Sep 20 08:08:16 2005
Subject: [Bioperl-l] [Bioperl -l] Setting Sequence with nonstandard
	characters
Message-ID: <8cff3eb805092002287b3e89a3@mail.gmail.com>

Hi,

I wonder if anyone could tell me how to set a sequence with
non-standard characters?

I would like to use the string "???AGCTAGTAC" as a sequence string but
when I set it using
$string = "???AGCTAGTAC";
$seq->seq($string);

I get an exception complaining that the sequence doesn't look healthy.
Is there any way I can turn this check of?

Thanks for any help 

Iain

From ak at ebi.ac.uk  Tue Sep 20 08:24:35 2005
From: ak at ebi.ac.uk (Andreas Kahari)
Date: Tue Sep 20 08:43:43 2005
Subject: [Bioperl-l] [Bioperl -l] Setting Sequence with nonstandard
	characters
In-Reply-To: <8cff3eb805092002287b3e89a3@mail.gmail.com>
References: <8cff3eb805092002287b3e89a3@mail.gmail.com>
Message-ID: <20050920122435.GD13972@ebi.ac.uk>

On Tue, Sep 20, 2005 at 10:28:19AM +0100, Iain Wallace wrote:
> Hi,
> 
> I wonder if anyone could tell me how to set a sequence with
> non-standard characters?
> 
> I would like to use the string "???AGCTAGTAC" as a sequence string but
> when I set it using
> $string = "???AGCTAGTAC";
> $seq->seq($string);
> 
> I get an exception complaining that the sequence doesn't look healthy.
> Is there any way I can turn this check of?

Are your question marks supposed to convey some very different
information from what is ordinarily meant when using 'N'?

E.g., $string = "NNNAGCTAGTAC";


Andreas

-- 
Andreas K?h?ri
EMBL-EBI/ensembl

------{ www.embl.org }----{ www.ebi.ac.uk }----{ www.ensembl.org }------
From skirov at utk.edu  Tue Sep 20 08:55:10 2005
From: skirov at utk.edu (Stefan Kirov)
Date: Tue Sep 20 08:55:16 2005
Subject: [Bioperl-l] entrezgene binary ASN
In-Reply-To: 
References: <432B16DC.6040901@utk.edu>
	
Message-ID: <433006AE.5040406@utk.edu>

Michael,
What if gene2xml fails (incomplete downloads, etc.)? I would prefer to 
keep it separate, but I see some people would prefer your way. My 
intention was not to rewrite the parser- it should work fine on the 
converted ags file. Thanks for the contribution!
Stefan

Michael Seewald wrote:

>
> Hi Stefan,
>
> The most convenient way would be to open it as a pipe:
>
> my $parser = Bio::ASN1::EntrezGene->new('file' => "gene2xml -i 
> Homo_sapiens.ags.gz -c -x -b | ");
> while(my $result = $parser->next_seq) {
> #...
> }
>
> It may be actually faster than before, because you save disk I/O. And 
> even better, there is no need to rewrite the parsers.
>
> Best wishes,
> Michael
>
>
> On 9/16/05, *Stefan Kirov* > 
> wrote:
>
>     NCBI provides now only the binary ASN format. Entrezgene parser
>     will not
>     parse it, but you can convert with gene2xml:
>
>     RT - Shiryayev, Sergey (NIH/NLM/NCBI) wrote:
>
>
>     >>Stefan,
>     >>
>     >>Try this:
>     >>
>     >>./gene2xml -i All_Data.ags.gz -c -x -b | more
>     >>
>     >>
>     >>Sergey Shiryayev
>     >>NCBI Contractor
>     >
>     Note that you shoul proceed the gzipped file.
>     Stefan
>     _______________________________________________
>     Bioperl-l mailing list
>     Bioperl-l@portal.open-bio.org 
>     http://portal.open-bio.org/mailman/listinfo/bioperl-l
>     
>
>
> -- 
> Dr. Michael Seewald
> Bioinformatics
> Bayer HealthCare AG


-- 
Stefan Kirov, Ph.D.
University of Tennessee/Oak Ridge National Laboratory
5700 bldg, PO BOX 2008 MS6164
Oak Ridge TN 37831-6164
USA
tel +865 576 5120
fax +865-576-5332
e-mail: skirov@utk.edu
sao@ornl.gov

"And the wars go on with brainwashed pride
For the love of God and our human rights
And all these things are swept aside"

From iain.m.wallace at gmail.com  Tue Sep 20 09:25:02 2005
From: iain.m.wallace at gmail.com (Iain Wallace)
Date: Tue Sep 20 09:39:44 2005
Subject: [Bioperl-l] [Bioperl -l] Setting Sequence with nonstandard
	characters
In-Reply-To: <20050920122435.GD13972@ebi.ac.uk>
References: <8cff3eb805092002287b3e89a3@mail.gmail.com>
	<20050920122435.GD13972@ebi.ac.uk>
Message-ID: <8cff3eb8050920062528a3f524@mail.gmail.com>

Yes, it is just going to be a marker for that position in the sequence. 
Although. I could infact use N instead, thanks for pointing that out. 

However, it would be nice to know if it is possible to use arbitary
characters as a sequence

On 9/20/05, Andreas Kahari  wrote:
> On Tue, Sep 20, 2005 at 10:28:19AM +0100, Iain Wallace wrote:
> > Hi,
> >
> > I wonder if anyone could tell me how to set a sequence with
> > non-standard characters?
> >
> > I would like to use the string "???AGCTAGTAC" as a sequence string but
> > when I set it using
> > $string = "???AGCTAGTAC";
> > $seq->seq($string);
> >
> > I get an exception complaining that the sequence doesn't look healthy.
> > Is there any way I can turn this check of?
> 
> Are your question marks supposed to convey some very different
> information from what is ordinarily meant when using 'N'?
> 
> E.g., $string = "NNNAGCTAGTAC";
> 
> 
> Andreas
> 
> --
> Andreas K?h?ri
> EMBL-EBI/ensembl
> 
> ------{ www.embl.org }----{ www.ebi.ac.uk }----{ www.ensembl.org }------
>

From ushashankar2000 at yahoo.com  Mon Sep 19 23:31:34 2005
From: ushashankar2000 at yahoo.com (Usha)
Date: Tue Sep 20 10:54:11 2005
Subject: [Bioperl-l] overwriting results in bl2seq report
Message-ID: <20050920033134.71731.qmail@web34309.mail.mud.yahoo.com>

Skipped content of type multipart/alternative-------------- next part --------------
Query= gi|22536185|ref|NC_004116.1| Streptococcus agalactiae 2603V/R,
complete genome
         (2,160,267 letters)



>testquery2
          Length = 32

 Score = 63.9 bits (32), Expect = 2e-12
 Identities = 32/32 (100%)
 Strand = Plus / Plus


Query: 1  aattaacattgttgattttattcttcaacatc 32
          ||||||||||||||||||||||||||||||||
Sbjct: 1  aattaacattgttgattttattcttcaacatc 32



 Score = 28.2 bits (14), Expect = 0.13
 Identities = 14/14 (100%)
 Strand = Plus / Minus


Query: 1440112 atcaacaatgttaa 1440125
               ||||||||||||||
Sbjct: 16      atcaacaatgttaa 3



 Score = 28.2 bits (14), Expect = 0.13
 Identities = 14/14 (100%)
 Strand = Plus / Plus


Query: 692877 ttgttgattttatt 692890
              ||||||||||||||
Sbjct: 9      ttgttgattttatt 22



 Score = 28.2 bits (14), Expect = 0.13

Score = 28.2 bits (14), Expect = 0.13
 Identities = 14/14 (100%)
 Strand = Plus / Minus


Query: 1079469 gttgaagaataaaa 1079482
               ||||||||||||||
Sbjct: 29      gttgaagaataaaa 16



 Score = 26.3 bits (13), Expect = 0.51
 Identities = 13/13 (100%)
 Strand = Plus / Minus


Query: 1954368 aacaatgttaatt 1954380
               |||||||||||||
Sbjct: 13      aacaatgttaatt 1



 Score = 26.3 bits (13), Expect = 0.51
 Identities = 13/13 (100%)
 Strand = Plus / Plus


Query: 1721632 aattaacattgtt 1721644
               |||||||||||||
Sbjct: 1       aattaacattgtt 13



 Score = 26.3 bits (13), Expect = 0.51
 Identities = 13/13 (100%)
 Strand = Plus / Plus


Query: 554214 acattgttgattt 554226
              |||||||||||||
Sbjct: 6      acattgttgattt 18
Score = 26.3 bits (13), Expect = 0.51
 Identities = 13/13 (100%)
 Strand = Plus / Plus


Query: 1377395 cattgttgatttt 1377407
               |||||||||||||
Sbjct: 7       cattgttgatttt 19



 Score = 26.3 bits (13), Expect = 0.51
 Identities = 13/13 (100%)
 Strand = Plus / Minus


Query: 1614884 ataaaatcaacaa 1614896
               |||||||||||||
Sbjct: 21      ataaaatcaacaa 9



 Score = 26.3 bits (13), Expect = 0.51
 Identities = 13/13 (100%)
 Strand = Plus / Minus


Query: 1600827 ataaaatcaacaa 1600839
               |||||||||||||
Sbjct: 21      ataaaatcaacaa 9



 Score = 26.3 bits (13), Expect = 0.51
 Identities = 13/13 (100%)
 Strand = Plus / Plus


Query: 846753 tgttgattttatt 846765
              |||||||||||||
Sbjct: 10     tgttgattttatt 22
Score = 26.3 bits (13), Expect = 0.51
 Identities = 13/13 (100%)
 Strand = Plus / Plus


Query: 933822 ttgattttattct 933834
              |||||||||||||
Sbjct: 12     ttgattttattct 24



 Score = 26.3 bits (13), Expect = 0.51
 Identities = 13/13 (100%)
 Strand = Plus / Plus


Query: 521487 tgattttattctt 521499
              |||||||||||||
Sbjct: 13     tgattttattctt 25



 Score = 26.3 bits (13), Expect = 0.51
 Identities = 13/13 (100%)
 Strand = Plus / Plus


Query: 429120 tttattcttcaac 429132
              |||||||||||||
Sbjct: 17     tttattcttcaac 29



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 1137089 aattaacattgt 1137100
               ||||||||||||
Sbjct: 1       aattaacattgt 12
Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 1800360 cattgttgattt 1800371
               ||||||||||||
Sbjct: 7       cattgttgattt 18



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Minus


Query: 2063737 aaaatcaacaat 2063748
               ||||||||||||
Sbjct: 19      aaaatcaacaat 8



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 243857 attgttgatttt 243868
              ||||||||||||
Sbjct: 8      attgttgatttt 19



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Minus


Query: 1883050 aaaatcaacaat 1883061
               ||||||||||||
Sbjct: 19      aaaatcaacaat 8
Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Minus


Query: 1573828 aaaatcaacaat 1573839
               ||||||||||||
Sbjct: 19      aaaatcaacaat 8



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 378327 tgttgattttat 378338
              ||||||||||||
Sbjct: 10     tgttgattttat 21



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Minus


Query: 1448800 ataaaatcaaca 1448811
               ||||||||||||
Sbjct: 21      ataaaatcaaca 10



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 1492953 tgttgattttat 1492964
               ||||||||||||
Sbjct: 10      tgttgattttat 21

 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Minus


Query: 1579619 aataaaatcaac 1579630
               ||||||||||||
Sbjct: 22      aataaaatcaac 11



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 658751 gttgattttatt 658762
              ||||||||||||
Sbjct: 11     gttgattttatt 22



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Minus


Query: 1110879 aataaaatcaac 1110890
               ||||||||||||
Sbjct: 22      aataaaatcaac 11



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Minus


Query: 334763 aataaaatcaac 334774
              ||||||||||||
Sbjct: 22     aataaaatcaac 11
 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 134255 ttgattttattc 134266
              ||||||||||||
Sbjct: 12     ttgattttattc 23



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 247705 tgattttattct 247716
              ||||||||||||
Sbjct: 13     tgattttattct 24



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 609508 gattttattctt 609519
              ||||||||||||
Sbjct: 14     gattttattctt 25



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 756471 gattttattctt 756482
              ||||||||||||
Sbjct: 14     gattttattctt 25
Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Minus


Query: 1033051 aagaataaaatc 1033062
               ||||||||||||
Sbjct: 25      aagaataaaatc 14



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 1035188 ttttattcttca 1035199
               ||||||||||||
Sbjct: 16      ttttattcttca 27



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 1129234 ttttattcttca 1129245
               ||||||||||||
Sbjct: 16      ttttattcttca 27



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 1128429 tattcttcaaca 1128440
               ||||||||||||
Sbjct: 19      tattcttcaaca 30
Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 1434633 tattcttcaaca 1434644
               ||||||||||||
Sbjct: 19      tattcttcaaca 30



 Score = 24.3 bits (12), Expect = 2.0
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 1124502 ttcttcaacatc 1124513
               ||||||||||||
Sbjct: 21      ttcttcaacatc 32



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1202836 acaatgttaat 1202846
               |||||||||||
Sbjct: 12      acaatgttaat 2



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 1181703 attaacattgt 1181713
               |||||||||||
Sbjct: 2       attaacattgt 12
 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1060902 aacaatgttaa 1060912
               |||||||||||
Sbjct: 13      aacaatgttaa 3



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 224753 taacattgttg 224763
              |||||||||||
Sbjct: 4      taacattgttg 14



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 1961563 taacattgttg 1961573
               |||||||||||
Sbjct: 4       taacattgttg 14



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 866174 aacattgttga 866184
              |||||||||||
Sbjct: 5      aacattgttga 15
Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 585099 tcaacaatgtt 585109
              |||||||||||
Sbjct: 15     tcaacaatgtt 5



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 2136590 atcaacaatgt 2136600
               |||||||||||
Sbjct: 16      atcaacaatgt 6



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 706121 acattgttgat 706131
              |||||||||||
Sbjct: 6      acattgttgat 16



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1241831 atcaacaatgt 1241841
               |||||||||||
Sbjct: 16      atcaacaatgt 6
 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1049040 atcaacaatgt 1049050
               |||||||||||
Sbjct: 16      atcaacaatgt 6



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1677419 aatcaacaatg 1677429
               |||||||||||
Sbjct: 17      aatcaacaatg 7



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1297825 aatcaacaatg 1297835
               |||||||||||
Sbjct: 17      aatcaacaatg 7



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 38368 attgttgattt 38378
             |||||||||||
Sbjct: 8     attgttgattt 18
Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 358991 attgttgattt 359001
              |||||||||||
Sbjct: 8      attgttgattt 18



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1757703 aaatcaacaat 1757713
               |||||||||||
Sbjct: 18      aaatcaacaat 8



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 495597 attgttgattt 495607
              |||||||||||
Sbjct: 8      attgttgattt 18



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1541827 aaatcaacaat 1541837
               |||||||||||
Sbjct: 18      aaatcaacaat 8
Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1022497 aaatcaacaat 1022507
               |||||||||||
Sbjct: 18      aaatcaacaat 8



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 651482 aaatcaacaat 651492
              |||||||||||
Sbjct: 18     aaatcaacaat 8



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 241085 aaatcaacaat 241095
              |||||||||||
Sbjct: 18     aaatcaacaat 8



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1538020 aaaatcaacaa 1538030
               |||||||||||
Sbjct: 19      aaaatcaacaa 9
 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1452215 aaaatcaacaa 1452225
               |||||||||||
Sbjct: 19      aaaatcaacaa 9



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1427497 aaaatcaacaa 1427507
               |||||||||||
Sbjct: 19      aaaatcaacaa 9



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1166874 aaaatcaacaa 1166884
               |||||||||||
Sbjct: 19      aaaatcaacaa 9



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 948551 aaaatcaacaa 948561
              |||||||||||
Sbjct: 19     aaaatcaacaa 9


 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 1299221 ttgttgatttt 1299231
               |||||||||||
Sbjct: 9       ttgttgatttt 19



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 1445881 ttgttgatttt 1445891
               |||||||||||
Sbjct: 9       ttgttgatttt 19



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 387873 aaaatcaacaa 387883
              |||||||||||
Sbjct: 19     aaaatcaacaa 9



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1225643 taaaatcaaca 1225653
               |||||||||||
Sbjct: 20      taaaatcaaca 10
 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 988731 tgttgatttta 988741
              |||||||||||
Sbjct: 10     tgttgatttta 20



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 1033545 tgttgatttta 1033555
               |||||||||||
Sbjct: 10      tgttgatttta 20



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 109598 taaaatcaaca 109608
              |||||||||||
Sbjct: 20     taaaatcaaca 10



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 159566 ataaaatcaac 159576
              |||||||||||
Sbjct: 21     ataaaatcaac 11
Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1699447 aataaaatcaa 1699457
               |||||||||||
Sbjct: 22      aataaaatcaa 12



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1658995 aataaaatcaa 1659005
               |||||||||||
Sbjct: 22      aataaaatcaa 12



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1622012 aataaaatcaa 1622022
               |||||||||||
Sbjct: 22      aataaaatcaa 12



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1605728 aataaaatcaa 1605738
               |||||||||||
Sbjct: 22      aataaaatcaa 12

Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1590211 aataaaatcaa 1590221
               |||||||||||
Sbjct: 22      aataaaatcaa 12



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 754682 ttgattttatt 754692
              |||||||||||
Sbjct: 12     ttgattttatt 22



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 789992 ttgattttatt 790002
              |||||||||||
Sbjct: 12     ttgattttatt 22



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1358216 aataaaatcaa 1358226
               |||||||||||
Sbjct: 22      aataaaatcaa 12

 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 952297 ttgattttatt 952307
              |||||||||||
Sbjct: 12     ttgattttatt 22



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 1015262 ttgattttatt 1015272
               |||||||||||
Sbjct: 12      ttgattttatt 22



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 698859 aataaaatcaa 698869
              |||||||||||
Sbjct: 22     aataaaatcaa 12



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 684509 aataaaatcaa 684519
              |||||||||||
Sbjct: 22     aataaaatcaa 12
Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 216359 aataaaatcaa 216369
              |||||||||||
Sbjct: 22     aataaaatcaa 12



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1469332 gaataaaatca 1469342
               |||||||||||
Sbjct: 23      gaataaaatca 13



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1328838 gaataaaatca 1328848
               |||||||||||
Sbjct: 23      gaataaaatca 13



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 1721248 tgattttattc 1721258
               |||||||||||
Sbjct: 13      tgattttattc 23
Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 147481 gaataaaatca 147491
              |||||||||||
Sbjct: 23     gaataaaatca 13



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 289194 attttattctt 289204
              |||||||||||
Sbjct: 15     attttattctt 25



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 654632 attttattctt 654642
              |||||||||||
Sbjct: 15     attttattctt 25



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 1149811 attttattctt 1149821
               |||||||||||
Sbjct: 15      attttattctt 25
Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 682457 aagaataaaat 682467
              |||||||||||
Sbjct: 25     aagaataaaat 15



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 333994 aagaataaaat 334004
              |||||||||||
Sbjct: 25     aagaataaaat 15



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 2015203 attttattctt 2015213
               |||||||||||
Sbjct: 15      attttattctt 25



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1786838 gaagaataaaa 1786848
               |||||||||||
Sbjct: 26      gaagaataaaa 16
Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1115801 gaagaataaaa 1115811
               |||||||||||
Sbjct: 26      gaagaataaaa 16



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 907480 tttattcttca 907490
              |||||||||||
Sbjct: 17     tttattcttca 27



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 1440630 tttattcttca 1440640
               |||||||||||
Sbjct: 17      tttattcttca 27



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 155543 ttattcttcaa 155553
              |||||||||||
Sbjct: 18     ttattcttcaa 28

 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 180330 ttattcttcaa 180340
              |||||||||||
Sbjct: 18     ttattcttcaa 28



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1081696 ttgaagaataa 1081706
               |||||||||||
Sbjct: 28      ttgaagaataa 18



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 816592 ttgaagaataa 816602
              |||||||||||
Sbjct: 28     ttgaagaataa 18



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 931476 tattcttcaac 931486
              |||||||||||
Sbjct: 19     tattcttcaac 29
 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 844976 gttgaagaata 844986
              |||||||||||
Sbjct: 29     gttgaagaata 19



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 1855993 tgttgaagaat 1856003
               |||||||||||
Sbjct: 30      tgttgaagaat 20



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 758581 attcttcaaca 758591
              |||||||||||
Sbjct: 20     attcttcaaca 30



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 1153478 attcttcaaca 1153488
               |||||||||||
Sbjct: 20      attcttcaaca 30

Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 810368 tgttgaagaat 810378
              |||||||||||
Sbjct: 30     tgttgaagaat 20



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 1669608 attcttcaaca 1669618
               |||||||||||
Sbjct: 20      attcttcaaca 30



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 70059 tgttgaagaat 70069
             |||||||||||
Sbjct: 30    tgttgaagaat 20



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 1132162 ttcttcaacat 1132172
               |||||||||||
Sbjct: 21      ttcttcaacat 31

 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Plus


Query: 1380017 ttcttcaacat 1380027
               |||||||||||
Sbjct: 21      ttcttcaacat 31



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 492657 atgttgaagaa 492667
              |||||||||||
Sbjct: 31     atgttgaagaa 21



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 358577 atgttgaagaa 358587
              |||||||||||
Sbjct: 31     atgttgaagaa 21



 Score = 22.3 bits (11), Expect = 8.0
 Identities = 11/11 (100%)
 Strand = Plus / Minus


Query: 341438 atgttgaagaa 341448
              |||||||||||
Sbjct: 31     atgttgaagaa 21
Lambda     K      H
    1.37    0.711     1.31

Gapped
Lambda     K      H
    1.37    0.711     1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Sequences: 1
Number of Hits to DB: 2088
Number of extensions: 115
Number of successful extensions: 115
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's gapped: 115
Number of HSP's successfully gapped: 115
Length of query: 2160267
Length of database: 32
Length adjustment: 13
Effective length of query: 2160254
Effective length of database: 19
Effective search space: 41044826
Effective search space used: 41044826
X1: 7 (13.9 bits)
X2: 15 (29.7 bits)
X3: 25 (49.6 bits)
S1: 7 (14.4 bits)
S2: 11 (22.3 bits)

From jason.stajich at duke.edu  Tue Sep 20 11:05:42 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Tue Sep 20 11:11:27 2005
Subject: [Bioperl-l] overwriting results in bl2seq report
In-Reply-To: <20050920033134.71731.qmail@web34309.mail.mud.yahoo.com>
References: <20050920033134.71731.qmail@web34309.mail.mud.yahoo.com>
Message-ID: <0ACE3558-2BBD-4935-9D47-B94961189861@duke.edu>

If you only want the top hit in your report you can also just add the  
-v 1 option when you run bl2seq.

It would be more helpful if you provided the bioperl code you are  
using rather than the report.

You may also want to read other people's advice on how to best use  
BLAST to map probes to a genome:
   http://bioinformatics.org/pipermail/bioclusters/2005-April/ 
002473.html

-jason
On Sep 19, 2005, at 11:31 PM, Usha wrote:

> Hi,
> I am trying to align some probes with a Streptococcus genome using  
> local bl2seq. These probes are of 32 nucleotides in length. These  
> are matching at multiple positions in the whole genome, but I am  
> interseted only in the first match. Could any one help by telling  
> me where  I can find information about parsing the bl2seq output? I  
> want to get the only top hits in a tab delimited text output file.
> I have one problem with regard to my output(report), when I am  
> looping the probes I can see only the results for last probe. There  
> is a problem of overwrting results in the report. How can I avoid  
> this overwriting problem? Attached is my bl2seq output.
> Thanks
> Usha.
>
>
>
> ---------------------------------
> Yahoo! for Good
>  Click here to donate to the Hurricane Katrina relief effort.  
> Query= gi|22536185|ref|NC_004116.1| Streptococcus agalactiae 2603V/R,
> complete genome
>          (2,160,267 letters)
>
>
>
>
>> testquery2
>>
>           Length = 32
>
>  Score = 63.9 bits (32), Expect = 2e-12
>  Identities = 32/32 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1  aattaacattgttgattttattcttcaacatc 32
>           ||||||||||||||||||||||||||||||||
> Sbjct: 1  aattaacattgttgattttattcttcaacatc 32
>
>
>
>  Score = 28.2 bits (14), Expect = 0.13
>  Identities = 14/14 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1440112 atcaacaatgttaa 1440125
>                ||||||||||||||
> Sbjct: 16      atcaacaatgttaa 3
>
>
>
>  Score = 28.2 bits (14), Expect = 0.13
>  Identities = 14/14 (100%)
>  Strand = Plus / Plus
>
>
> Query: 692877 ttgttgattttatt 692890
>               ||||||||||||||
> Sbjct: 9      ttgttgattttatt 22
>
>
>
>  Score = 28.2 bits (14), Expect = 0.13
>
> Score = 28.2 bits (14), Expect = 0.13
>  Identities = 14/14 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1079469 gttgaagaataaaa 1079482
>                ||||||||||||||
> Sbjct: 29      gttgaagaataaaa 16
>
>
>
>  Score = 26.3 bits (13), Expect = 0.51
>  Identities = 13/13 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1954368 aacaatgttaatt 1954380
>                |||||||||||||
> Sbjct: 13      aacaatgttaatt 1
>
>
>
>  Score = 26.3 bits (13), Expect = 0.51
>  Identities = 13/13 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1721632 aattaacattgtt 1721644
>                |||||||||||||
> Sbjct: 1       aattaacattgtt 13
>
>
>
>  Score = 26.3 bits (13), Expect = 0.51
>  Identities = 13/13 (100%)
>  Strand = Plus / Plus
>
>
> Query: 554214 acattgttgattt 554226
>               |||||||||||||
> Sbjct: 6      acattgttgattt 18
> Score = 26.3 bits (13), Expect = 0.51
>  Identities = 13/13 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1377395 cattgttgatttt 1377407
>                |||||||||||||
> Sbjct: 7       cattgttgatttt 19
>
>
>
>  Score = 26.3 bits (13), Expect = 0.51
>  Identities = 13/13 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1614884 ataaaatcaacaa 1614896
>                |||||||||||||
> Sbjct: 21      ataaaatcaacaa 9
>
>
>
>  Score = 26.3 bits (13), Expect = 0.51
>  Identities = 13/13 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1600827 ataaaatcaacaa 1600839
>                |||||||||||||
> Sbjct: 21      ataaaatcaacaa 9
>
>
>
>  Score = 26.3 bits (13), Expect = 0.51
>  Identities = 13/13 (100%)
>  Strand = Plus / Plus
>
>
> Query: 846753 tgttgattttatt 846765
>               |||||||||||||
> Sbjct: 10     tgttgattttatt 22
> Score = 26.3 bits (13), Expect = 0.51
>  Identities = 13/13 (100%)
>  Strand = Plus / Plus
>
>
> Query: 933822 ttgattttattct 933834
>               |||||||||||||
> Sbjct: 12     ttgattttattct 24
>
>
>
>  Score = 26.3 bits (13), Expect = 0.51
>  Identities = 13/13 (100%)
>  Strand = Plus / Plus
>
>
> Query: 521487 tgattttattctt 521499
>               |||||||||||||
> Sbjct: 13     tgattttattctt 25
>
>
>
>  Score = 26.3 bits (13), Expect = 0.51
>  Identities = 13/13 (100%)
>  Strand = Plus / Plus
>
>
> Query: 429120 tttattcttcaac 429132
>               |||||||||||||
> Sbjct: 17     tttattcttcaac 29
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1137089 aattaacattgt 1137100
>                ||||||||||||
> Sbjct: 1       aattaacattgt 12
> Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1800360 cattgttgattt 1800371
>                ||||||||||||
> Sbjct: 7       cattgttgattt 18
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Minus
>
>
> Query: 2063737 aaaatcaacaat 2063748
>                ||||||||||||
> Sbjct: 19      aaaatcaacaat 8
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 243857 attgttgatttt 243868
>               ||||||||||||
> Sbjct: 8      attgttgatttt 19
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1883050 aaaatcaacaat 1883061
>                ||||||||||||
> Sbjct: 19      aaaatcaacaat 8
> Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1573828 aaaatcaacaat 1573839
>                ||||||||||||
> Sbjct: 19      aaaatcaacaat 8
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 378327 tgttgattttat 378338
>               ||||||||||||
> Sbjct: 10     tgttgattttat 21
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1448800 ataaaatcaaca 1448811
>                ||||||||||||
> Sbjct: 21      ataaaatcaaca 10
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1492953 tgttgattttat 1492964
>                ||||||||||||
> Sbjct: 10      tgttgattttat 21
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1579619 aataaaatcaac 1579630
>                ||||||||||||
> Sbjct: 22      aataaaatcaac 11
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 658751 gttgattttatt 658762
>               ||||||||||||
> Sbjct: 11     gttgattttatt 22
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1110879 aataaaatcaac 1110890
>                ||||||||||||
> Sbjct: 22      aataaaatcaac 11
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Minus
>
>
> Query: 334763 aataaaatcaac 334774
>               ||||||||||||
> Sbjct: 22     aataaaatcaac 11
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 134255 ttgattttattc 134266
>               ||||||||||||
> Sbjct: 12     ttgattttattc 23
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 247705 tgattttattct 247716
>               ||||||||||||
> Sbjct: 13     tgattttattct 24
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 609508 gattttattctt 609519
>               ||||||||||||
> Sbjct: 14     gattttattctt 25
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 756471 gattttattctt 756482
>               ||||||||||||
> Sbjct: 14     gattttattctt 25
> Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1033051 aagaataaaatc 1033062
>                ||||||||||||
> Sbjct: 25      aagaataaaatc 14
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1035188 ttttattcttca 1035199
>                ||||||||||||
> Sbjct: 16      ttttattcttca 27
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1129234 ttttattcttca 1129245
>                ||||||||||||
> Sbjct: 16      ttttattcttca 27
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1128429 tattcttcaaca 1128440
>                ||||||||||||
> Sbjct: 19      tattcttcaaca 30
> Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1434633 tattcttcaaca 1434644
>                ||||||||||||
> Sbjct: 19      tattcttcaaca 30
>
>
>
>  Score = 24.3 bits (12), Expect = 2.0
>  Identities = 12/12 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1124502 ttcttcaacatc 1124513
>                ||||||||||||
> Sbjct: 21      ttcttcaacatc 32
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1202836 acaatgttaat 1202846
>                |||||||||||
> Sbjct: 12      acaatgttaat 2
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1181703 attaacattgt 1181713
>                |||||||||||
> Sbjct: 2       attaacattgt 12
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1060902 aacaatgttaa 1060912
>                |||||||||||
> Sbjct: 13      aacaatgttaa 3
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 224753 taacattgttg 224763
>               |||||||||||
> Sbjct: 4      taacattgttg 14
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1961563 taacattgttg 1961573
>                |||||||||||
> Sbjct: 4       taacattgttg 14
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 866174 aacattgttga 866184
>               |||||||||||
> Sbjct: 5      aacattgttga 15
> Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 585099 tcaacaatgtt 585109
>               |||||||||||
> Sbjct: 15     tcaacaatgtt 5
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 2136590 atcaacaatgt 2136600
>                |||||||||||
> Sbjct: 16      atcaacaatgt 6
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 706121 acattgttgat 706131
>               |||||||||||
> Sbjct: 6      acattgttgat 16
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1241831 atcaacaatgt 1241841
>                |||||||||||
> Sbjct: 16      atcaacaatgt 6
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1049040 atcaacaatgt 1049050
>                |||||||||||
> Sbjct: 16      atcaacaatgt 6
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1677419 aatcaacaatg 1677429
>                |||||||||||
> Sbjct: 17      aatcaacaatg 7
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1297825 aatcaacaatg 1297835
>                |||||||||||
> Sbjct: 17      aatcaacaatg 7
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 38368 attgttgattt 38378
>              |||||||||||
> Sbjct: 8     attgttgattt 18
> Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 358991 attgttgattt 359001
>               |||||||||||
> Sbjct: 8      attgttgattt 18
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1757703 aaatcaacaat 1757713
>                |||||||||||
> Sbjct: 18      aaatcaacaat 8
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 495597 attgttgattt 495607
>               |||||||||||
> Sbjct: 8      attgttgattt 18
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1541827 aaatcaacaat 1541837
>                |||||||||||
> Sbjct: 18      aaatcaacaat 8
> Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1022497 aaatcaacaat 1022507
>                |||||||||||
> Sbjct: 18      aaatcaacaat 8
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 651482 aaatcaacaat 651492
>               |||||||||||
> Sbjct: 18     aaatcaacaat 8
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 241085 aaatcaacaat 241095
>               |||||||||||
> Sbjct: 18     aaatcaacaat 8
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1538020 aaaatcaacaa 1538030
>                |||||||||||
> Sbjct: 19      aaaatcaacaa 9
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1452215 aaaatcaacaa 1452225
>                |||||||||||
> Sbjct: 19      aaaatcaacaa 9
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1427497 aaaatcaacaa 1427507
>                |||||||||||
> Sbjct: 19      aaaatcaacaa 9
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1166874 aaaatcaacaa 1166884
>                |||||||||||
> Sbjct: 19      aaaatcaacaa 9
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 948551 aaaatcaacaa 948561
>               |||||||||||
> Sbjct: 19     aaaatcaacaa 9
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1299221 ttgttgatttt 1299231
>                |||||||||||
> Sbjct: 9       ttgttgatttt 19
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1445881 ttgttgatttt 1445891
>                |||||||||||
> Sbjct: 9       ttgttgatttt 19
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 387873 aaaatcaacaa 387883
>               |||||||||||
> Sbjct: 19     aaaatcaacaa 9
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1225643 taaaatcaaca 1225653
>                |||||||||||
> Sbjct: 20      taaaatcaaca 10
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 988731 tgttgatttta 988741
>               |||||||||||
> Sbjct: 10     tgttgatttta 20
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1033545 tgttgatttta 1033555
>                |||||||||||
> Sbjct: 10      tgttgatttta 20
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 109598 taaaatcaaca 109608
>               |||||||||||
> Sbjct: 20     taaaatcaaca 10
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 159566 ataaaatcaac 159576
>               |||||||||||
> Sbjct: 21     ataaaatcaac 11
> Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1699447 aataaaatcaa 1699457
>                |||||||||||
> Sbjct: 22      aataaaatcaa 12
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1658995 aataaaatcaa 1659005
>                |||||||||||
> Sbjct: 22      aataaaatcaa 12
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1622012 aataaaatcaa 1622022
>                |||||||||||
> Sbjct: 22      aataaaatcaa 12
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1605728 aataaaatcaa 1605738
>                |||||||||||
> Sbjct: 22      aataaaatcaa 12
>
> Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1590211 aataaaatcaa 1590221
>                |||||||||||
> Sbjct: 22      aataaaatcaa 12
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 754682 ttgattttatt 754692
>               |||||||||||
> Sbjct: 12     ttgattttatt 22
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 789992 ttgattttatt 790002
>               |||||||||||
> Sbjct: 12     ttgattttatt 22
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1358216 aataaaatcaa 1358226
>                |||||||||||
> Sbjct: 22      aataaaatcaa 12
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 952297 ttgattttatt 952307
>               |||||||||||
> Sbjct: 12     ttgattttatt 22
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1015262 ttgattttatt 1015272
>                |||||||||||
> Sbjct: 12      ttgattttatt 22
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 698859 aataaaatcaa 698869
>               |||||||||||
> Sbjct: 22     aataaaatcaa 12
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 684509 aataaaatcaa 684519
>               |||||||||||
> Sbjct: 22     aataaaatcaa 12
> Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 216359 aataaaatcaa 216369
>               |||||||||||
> Sbjct: 22     aataaaatcaa 12
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1469332 gaataaaatca 1469342
>                |||||||||||
> Sbjct: 23      gaataaaatca 13
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1328838 gaataaaatca 1328848
>                |||||||||||
> Sbjct: 23      gaataaaatca 13
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1721248 tgattttattc 1721258
>                |||||||||||
> Sbjct: 13      tgattttattc 23
> Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 147481 gaataaaatca 147491
>               |||||||||||
> Sbjct: 23     gaataaaatca 13
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 289194 attttattctt 289204
>               |||||||||||
> Sbjct: 15     attttattctt 25
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 654632 attttattctt 654642
>               |||||||||||
> Sbjct: 15     attttattctt 25
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1149811 attttattctt 1149821
>                |||||||||||
> Sbjct: 15      attttattctt 25
> Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 682457 aagaataaaat 682467
>               |||||||||||
> Sbjct: 25     aagaataaaat 15
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 333994 aagaataaaat 334004
>               |||||||||||
> Sbjct: 25     aagaataaaat 15
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 2015203 attttattctt 2015213
>                |||||||||||
> Sbjct: 15      attttattctt 25
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1786838 gaagaataaaa 1786848
>                |||||||||||
> Sbjct: 26      gaagaataaaa 16
> Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1115801 gaagaataaaa 1115811
>                |||||||||||
> Sbjct: 26      gaagaataaaa 16
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 907480 tttattcttca 907490
>               |||||||||||
> Sbjct: 17     tttattcttca 27
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1440630 tttattcttca 1440640
>                |||||||||||
> Sbjct: 17      tttattcttca 27
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 155543 ttattcttcaa 155553
>               |||||||||||
> Sbjct: 18     ttattcttcaa 28
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 180330 ttattcttcaa 180340
>               |||||||||||
> Sbjct: 18     ttattcttcaa 28
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1081696 ttgaagaataa 1081706
>                |||||||||||
> Sbjct: 28      ttgaagaataa 18
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 816592 ttgaagaataa 816602
>               |||||||||||
> Sbjct: 28     ttgaagaataa 18
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 931476 tattcttcaac 931486
>               |||||||||||
> Sbjct: 19     tattcttcaac 29
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 844976 gttgaagaata 844986
>               |||||||||||
> Sbjct: 29     gttgaagaata 19
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 1855993 tgttgaagaat 1856003
>                |||||||||||
> Sbjct: 30      tgttgaagaat 20
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 758581 attcttcaaca 758591
>               |||||||||||
> Sbjct: 20     attcttcaaca 30
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1153478 attcttcaaca 1153488
>                |||||||||||
> Sbjct: 20      attcttcaaca 30
>
> Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 810368 tgttgaagaat 810378
>               |||||||||||
> Sbjct: 30     tgttgaagaat 20
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1669608 attcttcaaca 1669618
>                |||||||||||
> Sbjct: 20      attcttcaaca 30
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 70059 tgttgaagaat 70069
>              |||||||||||
> Sbjct: 30    tgttgaagaat 20
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1132162 ttcttcaacat 1132172
>                |||||||||||
> Sbjct: 21      ttcttcaacat 31
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Plus
>
>
> Query: 1380017 ttcttcaacat 1380027
>                |||||||||||
> Sbjct: 21      ttcttcaacat 31
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 492657 atgttgaagaa 492667
>               |||||||||||
> Sbjct: 31     atgttgaagaa 21
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 358577 atgttgaagaa 358587
>               |||||||||||
> Sbjct: 31     atgttgaagaa 21
>
>
>
>  Score = 22.3 bits (11), Expect = 8.0
>  Identities = 11/11 (100%)
>  Strand = Plus / Minus
>
>
> Query: 341438 atgttgaagaa 341448
>               |||||||||||
> Sbjct: 31     atgttgaagaa 21
> Lambda     K      H
>     1.37    0.711     1.31
>
> Gapped
> Lambda     K      H
>     1.37    0.711     1.31
>
>
> Matrix: blastn matrix:1 -3
> Gap Penalties: Existence: 5, Extension: 2
> Number of Sequences: 1
> Number of Hits to DB: 2088
> Number of extensions: 115
> Number of successful extensions: 115
> Number of sequences better than 10.0: 1
> Number of HSP's better than 10.0 without gapping: 1
> Number of HSP's gapped: 115
> Number of HSP's successfully gapped: 115
> Length of query: 2160267
> Length of database: 32
> Length adjustment: 13
> Effective length of query: 2160254
> Effective length of database: 19
> Effective search space: 41044826
> Effective search space used: 41044826
> X1: 7 (13.9 bits)
> X2: 15 (29.7 bits)
> X3: 25 (49.6 bits)
> S1: 7 (14.4 bits)
> S2: 11 (22.3 bits)
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From heikki at ebi.ac.uk  Tue Sep 20 12:18:26 2005
From: heikki at ebi.ac.uk (Heikki Lehvaslaiho)
Date: Tue Sep 20 12:31:18 2005
Subject: [Bioperl-l] [Bioperl -l] Setting Sequence with nonstandard
	characters
In-Reply-To: <8cff3eb8050920062528a3f524@mail.gmail.com>
References: <8cff3eb805092002287b3e89a3@mail.gmail.com>
	<20050920122435.GD13972@ebi.ac.uk>
	<8cff3eb8050920062528a3f524@mail.gmail.com>
Message-ID: <200509201718.27249.heikki@ebi.ac.uk>

Ian,

You can not use arbitrary characters. You'll get a warning  and an exception 
(why both? ... code could be cleaned a bit, maybe) when you try to put any 
other character into seq() than these:

$MATCHPATTERN = 'A-Za-z\-\.\*\?'; # see Bio::PrimarySeq code

'?' in sequence should be fine. Could you post a short sample code that causes 
the exception and say which version of perl and bioperl you are using, 
please.


These are fine (perl v5.8.4, bioperl-live):
perl -MBio::PrimarySeq -e  '$s=Bio::PrimarySeq->new(); $s->seq("??tg");'
perl -MBio::Seq  -e '$s=Bio::Seq->new(); $s->seq("??tg");'


 -Heikki



On Tuesday 20 September 2005 14:25, Iain Wallace wrote:
> Yes, it is just going to be a marker for that position in the sequence.
> Although. I could infact use N instead, thanks for pointing that out.
>
> However, it would be nice to know if it is possible to use arbitary
> characters as a sequence
>
> On 9/20/05, Andreas Kahari  wrote:
> > On Tue, Sep 20, 2005 at 10:28:19AM +0100, Iain Wallace wrote:
> > > Hi,
> > >
> > > I wonder if anyone could tell me how to set a sequence with
> > > non-standard characters?
> > >
> > > I would like to use the string "???AGCTAGTAC" as a sequence string but
> > > when I set it using
> > > $string = "???AGCTAGTAC";
> > > $seq->seq($string);
> > >
> > > I get an exception complaining that the sequence doesn't look healthy.
> > > Is there any way I can turn this check of?
> >
> > Are your question marks supposed to convey some very different
> > information from what is ordinarily meant when using 'N'?
> >
> > E.g., $string = "NNNAGCTAGTAC";
> >
> >
> > Andreas
> >
> > --
> > Andreas K?h?ri
> > EMBL-EBI/ensembl
> >
> > ------{ www.embl.org }----{ www.ebi.ac.uk }----{ www.ensembl.org }------
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l

-- 
______ _/      _/_____________________________________________________
      _/      _/                      http://www.ebi.ac.uk/mutations/
     _/  _/  _/  Heikki Lehvaslaiho    heikki at_ebi _ac _uk
    _/_/_/_/_/  EMBL Outstation, European Bioinformatics Institute
   _/  _/  _/  Wellcome Trust Genome Campus, Hinxton
  _/  _/  _/  Cambridge, CB10 1SD, United Kingdom
     _/      Phone: +44 (0)1223 494 644   FAX: +44 (0)1223 494 468
___ _/_/_/_/_/________________________________________________________

From jason.stajich at duke.edu  Tue Sep 20 10:50:35 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Tue Sep 20 12:49:55 2005
Subject: [Bioperl-l] [Bioperl -l] Setting Sequence with nonstandard
	characters
In-Reply-To: <8cff3eb8050920062528a3f524@mail.gmail.com>
References: <8cff3eb805092002287b3e89a3@mail.gmail.com>
	<20050920122435.GD13972@ebi.ac.uk>
	<8cff3eb8050920062528a3f524@mail.gmail.com>
Message-ID: 

You can also specifically override validate_seq in your code if you like

Here I am specifically allowing numbers in my alignments to code for  
intron phases, the ? is also allowed for LocatableSeqs.

sub Bio::LocatableSeq::validate_seq {
     my ($self,$seqstr) = @_;
     if( ! defined $seqstr ){ $seqstr = $self->seq(); }
     return 0 unless( defined $seqstr);
     if((CORE::length($seqstr) > 0) && ($seqstr !~ /^([A-Za-z\-\.\*\? 
\d]+)$/)) {
         $self->warn("seq doesn't validate, mismatch is " .
                     ($seqstr =~ /([^A-Za-z\-\.\*\?\d]+)/g));
         return 0;
     }
     return 1;
}

On Sep 20, 2005, at 9:25 AM, Iain Wallace wrote:

> Yes, it is just going to be a marker for that position in the  
> sequence.
> Although. I could infact use N instead, thanks for pointing that out.
>
> However, it would be nice to know if it is possible to use arbitary
> characters as a sequence
>
> On 9/20/05, Andreas Kahari  wrote:
>
>> On Tue, Sep 20, 2005 at 10:28:19AM +0100, Iain Wallace wrote:
>>
>>> Hi,
>>>
>>> I wonder if anyone could tell me how to set a sequence with
>>> non-standard characters?
>>>
>>> I would like to use the string "???AGCTAGTAC" as a sequence  
>>> string but
>>> when I set it using
>>> $string = "???AGCTAGTAC";
>>> $seq->seq($string);
>>>
>>> I get an exception complaining that the sequence doesn't look  
>>> healthy.
>>> Is there any way I can turn this check of?
>>>
>>
>> Are your question marks supposed to convey some very different
>> information from what is ordinarily meant when using 'N'?
>>
>> E.g., $string = "NNNAGCTAGTAC";
>>
>>
>> Andreas
>>
>> --
>> Andreas K?h?ri
>> EMBL-EBI/ensembl
>>
>> ------{ www.embl.org }----{ www.ebi.ac.uk }---- 
>> { www.ensembl.org }------
>>
>>
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12



From skirov at utk.edu  Tue Sep 20 13:06:21 2005
From: skirov at utk.edu (Stefan Kirov)
Date: Tue Sep 20 13:06:39 2005
Subject: [Bioperl-l] Bio::Species validate_species_name
In-Reply-To: <5cb416b63ac7506b0d2a49b89649e96e@gmx.net>
References: <432EC389.8010705@utk.edu>
	<5cb416b63ac7506b0d2a49b89649e96e@gmx.net>
Message-ID: <4330418D.2010909@utk.edu>

Hilmar,
Before I modify entrezgene to override the classification verification I 
have a question - what's the reason to do that? What about the danger of 
inconsistencies down the road? One can imagine a situation, where the 
parser having passed a bad classification creates invalid binomial name, 
which then breaks the user's code (for example database queries, file 
structure, etc.).
Thanks!
Stefan

Hilmar Lapp wrote:

> If you set the classification array and pass a second argument that 
> eval's to true validation is turned off. See 
> Bio::Species::classification. This is what the SeqIO parsers do (or 
> should do).
>
>     -hilmar
>
> On Sep 19, 2005, at 6:56 AM, Stefan Kirov wrote:
>
>> NCBI and Bio::Species have very different views on what is the format 
>> of a species field. Is it possible to relax a bit the species regular 
>> expression? For example, 'Rhizophidium sp. 136' is a valid NCBI 
>> species name, but this is not the case in bioperl (species name in 
>> this case is starting with a number). There are other collisions as 
>> well, such as special characters found in the species name: ()'/
>> Any thoughts?
>> Stefan
>> _______________________________________________
>> Bioperl-l mailing list
>> Bioperl-l@portal.open-bio.org
>> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>>
>>

-

From hlapp at gmx.net  Wed Sep 21 03:40:04 2005
From: hlapp at gmx.net (Hilmar Lapp)
Date: Wed Sep 21 03:41:00 2005
Subject: [Bioperl-l] Bio::Species validate_species_name
In-Reply-To: <4330418D.2010909@utk.edu>
References: <432EC389.8010705@utk.edu>
	<5cb416b63ac7506b0d2a49b89649e96e@gmx.net>
	<4330418D.2010909@utk.edu>
Message-ID: <875b9a45a2b43100b171875885b65d44@gmx.net>

Sure this is even likely once Entrez Gene comprises of as many species 
as e.g. UniProt does - which is not imminent AFAIK but may be the case 
one day.

I like to take the position that throwing an exception is always better 
than silently making a mistake, but in the case of stream parsers 
typically for most users an exception isn't helpful because 1) they 
can't fix the datasource, 2) often they can't fix the responsible 
Bioperl code either, and 3) most often they don't care about the fringe 
species anyway and would have screened out that record anyway.

You could throw a warning if the species name doesn't look like it fits 
your expected pattern, but even detecting that isn't easy.

	-hilmar

On Sep 20, 2005, at 10:06 AM, Stefan Kirov wrote:

> Hilmar,
> Before I modify entrezgene to override the classification verification 
> I have a question - what's the reason to do that? What about the 
> danger of inconsistencies down the road? One can imagine a situation, 
> where the parser having passed a bad classification creates invalid 
> binomial name, which then breaks the user's code (for example database 
> queries, file structure, etc.).
> Thanks!
> Stefan
>
> Hilmar Lapp wrote:
>
>> If you set the classification array and pass a second argument that 
>> eval's to true validation is turned off. See 
>> Bio::Species::classification. This is what the SeqIO parsers do (or 
>> should do).
>>
>>     -hilmar
>>
>> On Sep 19, 2005, at 6:56 AM, Stefan Kirov wrote:
>>
>>> NCBI and Bio::Species have very different views on what is the 
>>> format of a species field. Is it possible to relax a bit the species 
>>> regular expression? For example, 'Rhizophidium sp. 136' is a valid 
>>> NCBI species name, but this is not the case in bioperl (species name 
>>> in this case is starting with a number). There are other collisions 
>>> as well, such as special characters found in the species name: ()'/
>>> Any thoughts?
>>> Stefan
>>> _______________________________________________
>>> Bioperl-l mailing list
>>> Bioperl-l@portal.open-bio.org
>>> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>>>
>>>
>
> -
>
>
-- 
-------------------------------------------------------------
Hilmar Lapp                            email: lapp at gnf.org
GNF, San Diego, Ca. 92121              phone: +1-858-812-1757
-------------------------------------------------------------


From skirov at utk.edu  Wed Sep 21 08:46:05 2005
From: skirov at utk.edu (Stefan Kirov)
Date: Wed Sep 21 08:46:33 2005
Subject: [Bioperl-l] Bio::Species validate_species_name
In-Reply-To: <875b9a45a2b43100b171875885b65d44@gmx.net>
References: <432EC389.8010705@utk.edu>
	<5cb416b63ac7506b0d2a49b89649e96e@gmx.net>
	<4330418D.2010909@utk.edu>
	<875b9a45a2b43100b171875885b65d44@gmx.net>
Message-ID: <4331560D.5010804@utk.edu>

Thanks for the great answer Hilmar!
I would prefer to have some kind of a check if the user wishes so. For 
example Entrezgene file contains some HTML tags in some entries species 
names which is good to know.
I will put an option -validate_species in the constructor to turn the 
check on and off. Maybe a species filter can be of some use as well. 
though you can just select the correct file from the NCBI site....
Thanks again!
Stefan

Hilmar Lapp wrote:

> Sure this is even likely once Entrez Gene comprises of as many species 
> as e.g. UniProt does - which is not imminent AFAIK but may be the case 
> one day.
>
> I like to take the position that throwing an exception is always 
> better than silently making a mistake, but in the case of stream 
> parsers typically for most users an exception isn't helpful because 1) 
> they can't fix the datasource, 2) often they can't fix the responsible 
> Bioperl code either, and 3) most often they don't care about the 
> fringe species anyway and would have screened out that record anyway.
>
> You could throw a warning if the species name doesn't look like it 
> fits your expected pattern, but even detecting that isn't easy.
>
>     -hilmar
>
> On Sep 20, 2005, at 10:06 AM, Stefan Kirov wrote:
>
>> Hilmar,
>> Before I modify entrezgene to override the classification 
>> verification I have a question - what's the reason to do that? What 
>> about the danger of inconsistencies down the road? One can imagine a 
>> situation, where the parser having passed a bad classification 
>> creates invalid binomial name, which then breaks the user's code (for 
>> example database queries, file structure, etc.).
>> Thanks!
>> Stefan
>>
>> Hilmar Lapp wrote:
>>
>>> If you set the classification array and pass a second argument that 
>>> eval's to true validation is turned off. See 
>>> Bio::Species::classification. This is what the SeqIO parsers do (or 
>>> should do).
>>>
>>>     -hilmar
>>>
>>> On Sep 19, 2005, at 6:56 AM, Stefan Kirov wrote:
>>>
>>>> NCBI and Bio::Species have very different views on what is the 
>>>> format of a species field. Is it possible to relax a bit the 
>>>> species regular expression? For example, 'Rhizophidium sp. 136' is 
>>>> a valid NCBI species name, but this is not the case in bioperl 
>>>> (species name in this case is starting with a number). There are 
>>>> other collisions as well, such as special characters found in the 
>>>> species name: ()'/
>>>> Any thoughts?
>>>> Stefan
>>>> _______________________________________________
>>>> Bioperl-l mailing list
>>>> Bioperl-l@portal.open-bio.org
>>>> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>>>>
>>>>
>>
>> -
>>
>>

-- 
Stefan Kirov, Ph.D.
University of Tennessee/Oak Ridge National Laboratory
5700 bldg, PO BOX 2008 MS6164
Oak Ridge TN 37831-6164
USA
tel +865 576 5120
fax +865-576-5332
e-mail: skirov@utk.edu
sao@ornl.gov

"And the wars go on with brainwashed pride
For the love of God and our human rights
And all these things are swept aside"

From jesper at krogh.cc  Wed Sep 21 08:28:05 2005
From: jesper at krogh.cc (Jesper Krogh)
Date: Wed Sep 21 09:07:43 2005
Subject: [Bioperl-l] Parser for Geneseq and PDBfinder?
Message-ID: 

Does anyone use bioperl for parsing geneseq's embl-like-flat-file format
and the PDBfinder databases? 

Jesper
-- 
./Jesper Krogh, jesper@krogh.cc, Jabber ID: jesper@jabbernet.dk


From avilella at gmail.com  Wed Sep 21 09:23:59 2005
From: avilella at gmail.com (Albert Vilella)
Date: Wed Sep 21 09:32:43 2005
Subject: [Bioperl-l] bioperl object for GO annotation entries?
Message-ID: <1127309040.9531.0.camel@localhost.localdomain>

Dears,

I would like to know if there is an object in Bioperl to contain the
fields of GO annotation files:

http://www.geneontology.org/GO.annotation.shtml#fields

Or if this fields are meant to be accessed by Bioperl in any way.

Apologies for my ignorance about this topic,

Thanks in advance,

Bests,

    Albert.


From avilella at gmail.com  Wed Sep 21 05:42:00 2005
From: avilella at gmail.com (Albert Vilella)
Date: Wed Sep 21 11:36:26 2005
Subject: [Bioperl-l] bioperl object for GO annotation entries?
Message-ID: <1127295720.7467.5.camel@localhost.localdomain>

Dears,

I would like to know if there is an object in Bioperl to contain the
fields of GO annotation files:

http://www.geneontology.org/GO.annotation.shtml#fields

Or if this fields are meant to be accessed by Bioperl in any way.

Apologies for my ignorance about this topic,

Thanks in advance,

Bests,

    Albert.


From hlapp at gmx.net  Wed Sep 21 11:57:17 2005
From: hlapp at gmx.net (Hilmar Lapp)
Date: Wed Sep 21 11:57:34 2005
Subject: [Bioperl-l] bioperl object for GO annotation entries?
In-Reply-To: <1127295720.7467.5.camel@localhost.localdomain>
References: <1127295720.7467.5.camel@localhost.localdomain>
Message-ID: 

We don't parse this file (yet). You could write a parser but then you'd 
also want an indexed database represented by some Bio::DB::* instance 
to resolve the sequence record being referenced.

	-hilmar

On Sep 21, 2005, at 2:42 AM, Albert Vilella wrote:

> Dears,
>
> I would like to know if there is an object in Bioperl to contain the
> fields of GO annotation files:
>
> http://www.geneontology.org/GO.annotation.shtml#fields
>
> Or if this fields are meant to be accessed by Bioperl in any way.
>
> Apologies for my ignorance about this topic,
>
> Thanks in advance,
>
> Bests,
>
>     Albert.
>
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>
>
-- 
-------------------------------------------------------------
Hilmar Lapp                            email: lapp at gnf.org
GNF, San Diego, Ca. 92121              phone: +1-858-812-1757
-------------------------------------------------------------


From sdavis2 at mail.nih.gov  Wed Sep 21 13:28:59 2005
From: sdavis2 at mail.nih.gov (Sean Davis)
Date: Wed Sep 21 13:49:26 2005
Subject: [Bioperl-l] 
Message-ID: 

#!/usr/bin/perl
use strict;

use Bio::ASN1::EntrezGene;
use YAML;
my $parser = Bio::ASN1::EntrezGene->new('file' => "gene2xml -I
Homo_sapiens.ags.gz -c -x -b | ");

while (my $res = $parser->next_seq) {
  print "#######################################################\n";
#  print Dump($res) . "\n";
}

Output is:
#######################################################
[NULL_Caption] FATAL ERROR: Input
Entrezgene-Set.E.track-info.update-date
Unable to match element in track-info.
[NULL_Caption] FATAL ERROR: NULL value passed to object loader for
Entrezgene
[NULL_Caption] FATAL ERROR: Input
Entrezgene-Set.E.track-info.update-date
element status out of order in SEQUENCE Gene-track
#######################################################
#######################################################

Is this a known issue, or a change in format from NCBI, or something else?

Thanks,
Sean

From skirov at utk.edu  Wed Sep 21 14:04:16 2005
From: skirov at utk.edu (Stefan Kirov)
Date: Wed Sep 21 14:05:49 2005
Subject: [Bioperl-l] 
In-Reply-To: 
References: 
Message-ID: <4331A0A0.30301@utk.edu>

Sean,
I think this is the gene2xml converter. Try to run in it from command 
line and if you see an error parsing the resulting file let me know.
Stefan

Sean Davis wrote:

>#!/usr/bin/perl
>use strict;
>
>use Bio::ASN1::EntrezGene;
>use YAML;
>my $parser = Bio::ASN1::EntrezGene->new('file' => "gene2xml -I
>Homo_sapiens.ags.gz -c -x -b | ");
>
>while (my $res = $parser->next_seq) {
>  print "#######################################################\n";
>#  print Dump($res) . "\n";
>}
>
>Output is:
>#######################################################
>[NULL_Caption] FATAL ERROR: Input
>Entrezgene-Set.E.track-info.update-date
>Unable to match element in track-info.
>[NULL_Caption] FATAL ERROR: NULL value passed to object loader for
>Entrezgene
>[NULL_Caption] FATAL ERROR: Input
>Entrezgene-Set.E.track-info.update-date
>element status out of order in SEQUENCE Gene-track
>#######################################################
>#######################################################
>
>Is this a known issue, or a change in format from NCBI, or something else?
>
>Thanks,
>Sean
>
>_______________________________________________
>Bioperl-l mailing list
>Bioperl-l@portal.open-bio.org
>http://portal.open-bio.org/mailman/listinfo/bioperl-l
>  
>

From mingyi.liu at gpc-biotech.com  Wed Sep 21 13:59:11 2005
From: mingyi.liu at gpc-biotech.com (Mingyi Liu)
Date: Wed Sep 21 14:11:17 2005
Subject: [Bioperl-l] 
In-Reply-To: 
References: 
Message-ID: <43319F6F.1080500@gpc-biotech.com>

The output error message should be gene2xml's error message 
(Bio::ASN1::EntrezGene does not depends on other modules and does not 
produce such error message).  It's either gene2xml did not work as 
called or the way the pipe was opened caused trouble.  I'll investigated 
it further.

Mingyi

Sean Davis wrote:

>#!/usr/bin/perl
>use strict;
>
>use Bio::ASN1::EntrezGene;
>use YAML;
>my $parser = Bio::ASN1::EntrezGene->new('file' => "gene2xml -I
>Homo_sapiens.ags.gz -c -x -b | ");
>
>while (my $res = $parser->next_seq) {
>  print "#######################################################\n";
>#  print Dump($res) . "\n";
>}
>
>Output is:
>#######################################################
>[NULL_Caption] FATAL ERROR: Input
>Entrezgene-Set.E.track-info.update-date
>Unable to match element in track-info.
>[NULL_Caption] FATAL ERROR: NULL value passed to object loader for
>Entrezgene
>[NULL_Caption] FATAL ERROR: Input
>Entrezgene-Set.E.track-info.update-date
>element status out of order in SEQUENCE Gene-track
>#######################################################
>#######################################################
>
>Is this a known issue, or a change in format from NCBI, or something else?
>
>Thanks,
>Sean
>
>_______________________________________________
>Bioperl-l mailing list
>Bioperl-l@portal.open-bio.org
>http://portal.open-bio.org/mailman/listinfo/bioperl-l
>  
>


From sdavis2 at mail.nih.gov  Wed Sep 21 14:11:18 2005
From: sdavis2 at mail.nih.gov (Sean Davis)
Date: Wed Sep 21 14:11:30 2005
Subject: [Bioperl-l] 
In-Reply-To: <43319F6F.1080500@gpc-biotech.com>
Message-ID: 

On 9/21/05 1:59 PM, "Mingyi Liu"  wrote:

> The output error message should be gene2xml's error message
> (Bio::ASN1::EntrezGene does not depends on other modules and does not
> produce such error message).  It's either gene2xml did not work as
> called or the way the pipe was opened caused trouble.  I'll investigated
> it further.

You're right.  It was gene2xml.  Typical simple mistake--my path included an
early version of gene2xml.  Looks like problem solved.

Sean

From skirov at utk.edu  Wed Sep 21 14:29:39 2005
From: skirov at utk.edu (Stefan Kirov)
Date: Wed Sep 21 14:32:40 2005
Subject: [Bioperl-l] 
In-Reply-To: 
References: 
Message-ID: <4331A693.2060508@utk.edu>

Sean,
One more thing- there HTML leftovers in All_Data, I an not sure about H. 
sapiens though. Also there are only 10K genes GO annotated for H sapiens 
vs 15K in the previous file. I am sending this to NCBI, but I am not 
user if it is their problem or GO. It seems just to be change in the 
mapping algorith.
Hope all is well with you.
Stefan

Sean Davis wrote:

>On 9/21/05 1:59 PM, "Mingyi Liu"  wrote:
>
>  
>
>>The output error message should be gene2xml's error message
>>(Bio::ASN1::EntrezGene does not depends on other modules and does not
>>produce such error message).  It's either gene2xml did not work as
>>called or the way the pipe was opened caused trouble.  I'll investigated
>>it further.
>>    
>>
>
>You're right.  It was gene2xml.  Typical simple mistake--my path included an
>early version of gene2xml.  Looks like problem solved.
>
>Sean
>
>_______________________________________________
>Bioperl-l mailing list
>Bioperl-l@portal.open-bio.org
>http://portal.open-bio.org/mailman/listinfo/bioperl-l
>  
>

From mayagao1999 at yahoo.com  Wed Sep 21 16:40:20 2005
From: mayagao1999 at yahoo.com (Alex Zhang)
Date: Wed Sep 21 16:46:58 2005
Subject: [Bioperl-l] About the location of the microRNAs 
Message-ID: <20050921204020.13264.qmail@web53509.mail.yahoo.com>

Hello! This is Alex.
My current ongoing research project is about the discovery of the expression of all
human microRNAs. 
 
In particular, I need to gain the information about the location of each Homo sapiens
microRNA on the chromosomes. For example, I need the information like:
 
Id                   Chromosome       Start     End 
hsa-mir-200b           1             1142407   1142501 
hsa-mir-200a           1             1143166   1143255 
hsa-mir-429             1             1144308   1144390 
hsa-mir-34a             1             9145993   9146102 
hsa-mir-30e             1             40889120  40889211 
 .......
 
Is there a convenient way to get this automatically instead of manually? 
 
Thank you very much and look forward to your reply!
 
Sincerely,
    Alex
micrornalist","4:39 pm (0 minutes ago)",["micrornalist@sanger.ac.uk"],[],[],["Gao Zhang "],"Sep 21, 2005 4:39 PM","Fwd: About the location of the microRNAs","",[],1,,,"Wed Sep 21 2005_4:39 PM","On 9/21/05, Gao Zhang  wrote:","On 9/21/05, Gao Zhang  wrote:","gmail.com",,["","",1],""]);//-->

__________________________________________________
Do You Yahoo!?
Tired of spam?  Yahoo! Mail has the best spam protection around 
http://mail.yahoo.com 
From sdavis2 at mail.nih.gov  Wed Sep 21 17:24:19 2005
From: sdavis2 at mail.nih.gov (Sean Davis)
Date: Wed Sep 21 17:28:30 2005
Subject: [Bioperl-l] About the location of the microRNAs 
In-Reply-To: <20050921204020.13264.qmail@web53509.mail.yahoo.com>
Message-ID: 

On 9/21/05 4:40 PM, "Alex Zhang"  wrote:

> Hello! This is Alex.
> My current ongoing research project is about the discovery of the expression
> of all
> human microRNAs. 
> 
> In particular, I need to gain the information about the location of each Homo
> sapiens
> microRNA on the chromosomes. For example, I need the information like:
> 
> Id                   Chromosome       Start     End
> hsa-mir-200b           1             1142407   1142501
> hsa-mir-200a           1             1143166   1143255
> hsa-mir-429             1             1144308   1144390
> hsa-mir-34a             1             9145993   9146102
> hsa-mir-30e             1             40889120  40889211
> .......
> 
> Is there a convenient way to get this automatically instead of manually?

Go to the UCSC table browser and just grab the miRNA (hg16) or sno/miRNA
(hg17) table.  The link is here:

http://genome.ucsc.edu/cgi-bin/hgTables

Alternatively, you can download the mysql table from them, as well.

Sean

From mbeisen at lbl.gov  Wed Sep 21 18:00:24 2005
From: mbeisen at lbl.gov (Michael Eisen)
Date: Wed Sep 21 18:20:13 2005
Subject: [Bioperl-l] flybase release 4.2 gff 
In-Reply-To: 
References: 
Message-ID: <4331D7F8.3020903@lbl.gov>

Has anyone written a script to convert flybases release 4.2 Drosophila 
melanogaster annotations to gff suitable for bioperl?

From jason.stajich at duke.edu  Wed Sep 21 23:44:14 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Wed Sep 21 23:43:43 2005
Subject: [Bioperl-l] bioperl 1.5.1 RC1 up
Message-ID: <73AFAD77-4C69-4D1A-AD0A-5D598A19A241@duke.edu>

Release candidates for Bioperl 1.5.1 is up -I've not tagged anything  
in CVS so commits should continue to be made to the repository HEAD:

http://bioperl.org/DIST/bioperl-1.5.1-rc1.tar.gz
http://bioperl.org/DIST/bioperl-1.5.1-rc1.zip

Tests pass for me on OSX with some, but not all dependancies installed.

I do see this for t/OntologyStore.t and a failed test --
MSG: [5/5] tried to fetch http://cvs.sourceforge.net/viewcvs.py/ 
*checkout*/song/ontology/so.definition?rev=HEAD, but server threw  
500.  re

------------------------------------------------------------------------ 
-------
t/OntologyStore.t                6    4  66.67%  3-6
125 subtests skipped.
Failed 1/220 test scripts, 99.55% okay. 4/9916 subtests failed,  
99.96% okay.

I believe aspects of this test should be disabled without  
BIOPERLDEBUG=1.

I think the Changes file and README will need to be checked over and  
corrected for this release.

Can folks check over for any test failures.  I believe RestrictionIO  
is going to fail on perl 5.6.x but I don't know exactly what the  
workaround is - other than detect perl version and skip tests where  
appropriate.

Can anyone speak up for bioperl-run and bioperl-ext as to whether or  
not we can tag and put these out as developer release as well?  I  
need someone to help out with testing these packages and getting them  
ship-shape for a release too.

-jason
--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From Marc.Logghe at DEVGEN.com  Thu Sep 22 02:36:03 2005
From: Marc.Logghe at DEVGEN.com (Marc Logghe)
Date: Thu Sep 22 02:49:01 2005
Subject: [Bioperl-l] RE: [Gmod-gbrowse] Translation glyph
Message-ID: <0C528E3670D8CE4B8E013F6749231AA62F559E@ANTARESIA.be.devgen.com>

> -----Original Message-----
> From: gmod-gbrowse-admin@lists.sourceforge.net 
> [mailto:gmod-gbrowse-admin@lists.sourceforge.net] On Behalf 
> Of Smithies, Russell
> Sent: Thursday, September 22, 2005 4:21 AM
> To: gmod-gbrowse@lists.sourceforge.net
> Subject: [Gmod-gbrowse] Translation glyph
> 
> Is it possible to show 3-letter names for 3-frame and 6-frame 
> translation glyphs at high magnification?
> E.g.  'Phe' instead of 'F'
I am afraid this is currently not possible AFAIK. B::G::G::translation
is depending on Bio::Tools::CodonTable. The translate() method of the
latter only returns single amino acid codes. However, B::T::CodonTable
*is* aware of threeletter codes but only in the context of
revtranslate().
One could change the behaviour of B::T::CodonTable, though. But I don't
know whether the resulting Bio::PrimarySeq will be valid for bioperl.

Marc

From heikki at ebi.ac.uk  Thu Sep 22 05:05:32 2005
From: heikki at ebi.ac.uk (Heikki Lehvaslaiho)
Date: Thu Sep 22 05:05:33 2005
Subject: [Bioperl-l] bioperl 1.5.1 RC1 up
In-Reply-To: <73AFAD77-4C69-4D1A-AD0A-5D598A19A241@duke.edu>
References: <73AFAD77-4C69-4D1A-AD0A-5D598A19A241@duke.edu>
Message-ID: <200509221005.32481.heikki@ebi.ac.uk>


bioperl-live
============

This is perl, v5.8.4 built for i386-linux-thread-multi
All tests successful, 125 subtests skipped.


bioperl-run
===========

We've usually released bioperl run at the same time as the live without 
separate testing cycle. It would be great to have some one to do that but as 
it is now, we could fix obvious errors and release it.

Not having almost any binaries on my path I detected only two errors when 
running 'make test':

Failed Test   Stat Wstat Total Fail  Failed  List of Failed
-------------------------------------------------------------------------------
t/Exonerate.t    2   512     5   10 200.00%  1-5
t/Probcons.t   255 65280     7    0   0.00%  ??
372 subtests skipped.
Failed 2/45 test scripts, 95.56% okay. 5/466 subtests failed, 98.93% okay.


The Exonerate error seems to be caused by script looking for 
Bio::SearchIO::Exonerate when it is in Bio::Tool::Run::Alignment::Exonerate




Probcons:
------------- EXCEPTION  -------------
MSG: Unallowed parameter: QUIET !
STACK 
Bio::Tools::Run::Alignment::Probcons::AUTOLOAD /home/heikki/src/bioperl/run/blib/lib/Bio/Tools/Run/Alignment/Probcons.pm:220
STACK 
Bio::Tools::Run::Alignment::Probcons::new /home/heikki/src/bioperl/run/blib/lib/Bio/Tools/Run/Alignment/Probcons.pm:209
STACK toplevel t/Probcons.t:33


 -Heikki



On Thursday 22 September 2005 04:44, Jason Stajich wrote:
> Release candidates for Bioperl 1.5.1 is up -I've not tagged anything
> in CVS so commits should continue to be made to the repository HEAD:
>
> http://bioperl.org/DIST/bioperl-1.5.1-rc1.tar.gz
> http://bioperl.org/DIST/bioperl-1.5.1-rc1.zip
>
> Tests pass for me on OSX with some, but not all dependancies installed.
>
> I do see this for t/OntologyStore.t and a failed test --
> MSG: [5/5] tried to fetch http://cvs.sourceforge.net/viewcvs.py/
> *checkout*/song/ontology/so.definition?rev=HEAD, but server threw
> 500.  re
>
> ------------------------------------------------------------------------
> -------
> t/OntologyStore.t                6    4  66.67%  3-6
> 125 subtests skipped.
> Failed 1/220 test scripts, 99.55% okay. 4/9916 subtests failed,
> 99.96% okay.
>
> I believe aspects of this test should be disabled without
> BIOPERLDEBUG=1.
>
> I think the Changes file and README will need to be checked over and
> corrected for this release.
>
> Can folks check over for any test failures.  I believe RestrictionIO
> is going to fail on perl 5.6.x but I don't know exactly what the
> workaround is - other than detect perl version and skip tests where
> appropriate.
>
> Can anyone speak up for bioperl-run and bioperl-ext as to whether or
> not we can tag and put these out as developer release as well?  I
> need someone to help out with testing these packages and getting them
> ship-shape for a release too.
>
> -jason
> --
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
>
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l

-- 
______ _/      _/_____________________________________________________
      _/      _/                      http://www.ebi.ac.uk/mutations/
     _/  _/  _/  Heikki Lehvaslaiho    heikki at_ebi _ac _uk
    _/_/_/_/_/  EMBL Outstation, European Bioinformatics Institute
   _/  _/  _/  Wellcome Trust Genome Campus, Hinxton
  _/  _/  _/  Cambridge, CB10 1SD, United Kingdom
     _/      Phone: +44 (0)1223 494 644   FAX: +44 (0)1223 494 468
___ _/_/_/_/_/________________________________________________________
From amackey at pcbi.upenn.edu  Thu Sep 22 08:56:56 2005
From: amackey at pcbi.upenn.edu (Aaron J. Mackey)
Date: Thu Sep 22 09:34:24 2005
Subject: [Bioperl-l] bioperl 1.5.1 RC1 up
In-Reply-To: <73AFAD77-4C69-4D1A-AD0A-5D598A19A241@duke.edu>
References: <73AFAD77-4C69-4D1A-AD0A-5D598A19A241@duke.edu>
Message-ID: <94C66084-CDB7-4605-BC15-E6BA04B00396@pcbi.upenn.edu>

bioperl-ext should definitely be co-released, as there are  
corresponding changes in Bio::Tools::dpAlign that should be  
synchronized.  It's as ready to go as it ever is (i.e. "works for me").

-Aaron

On Sep 21, 2005, at 11:44 PM, Jason Stajich wrote:

> Can anyone speak up for bioperl-run and bioperl-ext as to whether  
> or not we can tag and put these out as developer release as well?   
> I need someone to help out with testing these packages and getting  
> them ship-shape for a release too.

--
Aaron J. Mackey, Ph.D.
Project Manager, ApiDB Bioinformatics Resource Center
Penn Genomics Institute, University of Pennsylvania
email:  amackey@pcbi.upenn.edu
office: 215-898-1205 (Goddard) / 215-746-7018 (PCBI)
fax:    215-746-6697
postal: Penn Genomics Institute
         Goddard Labs 212
         415 S. University Avenue
         Philadelphia, PA  19104-6017


From amackey at pcbi.upenn.edu  Thu Sep 22 08:55:30 2005
From: amackey at pcbi.upenn.edu (Aaron J. Mackey)
Date: Thu Sep 22 09:34:30 2005
Subject: [Bioperl-l] Re: [Gmod-gbrowse] Translation glyph
In-Reply-To: <0C528E3670D8CE4B8E013F6749231AA62F559E@ANTARESIA.be.devgen.com>
References: <0C528E3670D8CE4B8E013F6749231AA62F559E@ANTARESIA.be.devgen.com>
Message-ID: 


But the translation glyph code could easily do the necessary  
substitutions.  I agree it should not be done from  
Bio::Tools::CodonTable

I just checked in the patch to bioperl for translation.pm to enable  
"triletter_code" as an option (defaults to 0).  Give it a try.  I'm  
happy to back it out if there are problems.

-Aaron

On Sep 22, 2005, at 2:36 AM, Marc Logghe wrote:

>> -----Original Message-----
>> From: gmod-gbrowse-admin@lists.sourceforge.net
>> [mailto:gmod-gbrowse-admin@lists.sourceforge.net] On Behalf
>> Of Smithies, Russell
>> Sent: Thursday, September 22, 2005 4:21 AM
>> To: gmod-gbrowse@lists.sourceforge.net
>> Subject: [Gmod-gbrowse] Translation glyph
>>
>> Is it possible to show 3-letter names for 3-frame and 6-frame
>> translation glyphs at high magnification?
>> E.g.  'Phe' instead of 'F'
>>
> I am afraid this is currently not possible AFAIK. B::G::G::translation
> is depending on Bio::Tools::CodonTable. The translate() method of the
> latter only returns single amino acid codes. However, B::T::CodonTable
> *is* aware of threeletter codes but only in the context of
> revtranslate().
> One could change the behaviour of B::T::CodonTable, though. But I  
> don't
> know whether the resulting Bio::PrimarySeq will be valid for bioperl.
>
> Marc
>
>
> -------------------------------------------------------
> SF.Net email is sponsored by:
> Tame your development challenges with Apache's Geronimo App Server.
> Download it for free - -and be entered to win a 42" plasma tv or  
> your very
> own Sony(tm)PSP.  Click here to play: http://sourceforge.net/ 
> geronimo.php
> _______________________________________________
> Gmod-gbrowse mailing list
> Gmod-gbrowse@lists.sourceforge.net
> https://lists.sourceforge.net/lists/listinfo/gmod-gbrowse
>

--
Aaron J. Mackey, Ph.D.
Project Manager, ApiDB Bioinformatics Resource Center
Penn Genomics Institute, University of Pennsylvania
email:  amackey@pcbi.upenn.edu
office: 215-898-1205 (Goddard) / 215-746-7018 (PCBI)
fax:    215-746-6697
postal: Penn Genomics Institute
         Goddard Labs 212
         415 S. University Avenue
         Philadelphia, PA  19104-6017


From jason.stajich at duke.edu  Thu Sep 22 09:45:51 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Thu Sep 22 09:45:06 2005
Subject: [Bioperl-l] bioperl 1.5.1 RC1 up
In-Reply-To: <94C66084-CDB7-4605-BC15-E6BA04B00396@pcbi.upenn.edu>
References: <73AFAD77-4C69-4D1A-AD0A-5D598A19A241@duke.edu>
	<94C66084-CDB7-4605-BC15-E6BA04B00396@pcbi.upenn.edu>
Message-ID: <78EAD448-BFAA-435F-9429-6E4FD09CAD6D@duke.edu>


Okay EXT RC1 is up -- note it require Inline::C to be installed.
  http://bioperl.org/DIST/bioperl-ext-1.5.1-rc1.tar.gz
  http://bioperl.org/DIST/bioperl-ext-1.5.1-rc1.zip

-jason
On Sep 22, 2005, at 8:56 AM, Aaron J. Mackey wrote:

> bioperl-ext should definitely be co-released, as there are  
> corresponding changes in Bio::Tools::dpAlign that should be  
> synchronized.  It's as ready to go as it ever is (i.e. "works for  
> me").
>
> -Aaron
>
> On Sep 21, 2005, at 11:44 PM, Jason Stajich wrote:
>
>
>> Can anyone speak up for bioperl-run and bioperl-ext as to whether  
>> or not we can tag and put these out as developer release as well?   
>> I need someone to help out with testing these packages and getting  
>> them ship-shape for a release too.
>>
>
> --
> Aaron J. Mackey, Ph.D.
> Project Manager, ApiDB Bioinformatics Resource Center
> Penn Genomics Institute, University of Pennsylvania
> email:  amackey@pcbi.upenn.edu
> office: 215-898-1205 (Goddard) / 215-746-7018 (PCBI)
> fax:    215-746-6697
> postal: Penn Genomics Institute
>         Goddard Labs 212
>         415 S. University Avenue
>         Philadelphia, PA  19104-6017
>
>
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From pleo at mail.nih.gov  Thu Sep 22 11:02:52 2005
From: pleo at mail.nih.gov (Leo, Paul (NIH/NHGRI))
Date: Thu Sep 22 11:18:33 2005
Subject: [Bioperl-l] Broken RemoteBlast fixes
Message-ID: 

So I come back from a "bio-perl break" and my code is spitting the dummy.

 

RemoteBlast was DOA.

 

I see there is some discussion about this in Septembers mailing list
archives; the fixes that worked for me were changing:

Scott Markel : ( $size > 1000 ) to ( $size > 2000 ) in RemoteBlast.pm

AND 

paul.boutros : line 1145 of Bio\SearchIO\blast.pm this way:
-1145:        if( /^((Query|Sbjct):\s+(\-?\d+)\s*)(\S+)\s+(\-?\d+)/ ) {
+1145:        if( /^((Query|Sbjct):{0,1}\s+(\-?\d+)\s*)(\S+)\s+(\-?\d+)/ ) {
 
I had to make BOTH changes for it to work. 
 
Note that BioPerl 1.4 form ActiveState does not have these changes and does
not work which I'm sure will confuse the hell out of any new users!
 

Question: are these the best fixes to use, are these modules working in 1.5?

 

Thanks

Paul

From jason.stajich at duke.edu  Thu Sep 22 12:02:35 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Thu Sep 22 12:02:18 2005
Subject: [Bioperl-l] Broken RemoteBlast fixes
In-Reply-To: 
References: 
Message-ID: <728ACBBD-328B-4902-9C2D-8215E9217403@duke.edu>

I think I have answered this query at least 5 times privately as well  
as there has been list traffic about it.  We'll need to post a news  
item about it and/or add this to the FAQ.


Everything has been updated to work with the latest NCBI changes -  
you can get working code from Bioperl CVS.  It requires SearchIO/ 
blast.pm patch and RemoteBlast.pm fix.

Bioperl 1.5.1 (RC 1 is up, I just posted about it) will be released  
soon and has these fixes incorporated.

There may well still be problems with the resulting text file that  
NCBI sends back in the future -- they say there is no guarantee that  
it will always be parseable.  The solution is you can always revert  
to the XML output from them and the blastxml SearchIO parser to get  
this data.  Please see my mailing list post from last week about how  
to request the XML format from them.

-jason
On Sep 22, 2005, at 11:02 AM, Leo, Paul (NIH/NHGRI) wrote:

> So I come back from a "bio-perl break" and my code is spitting the  
> dummy.
>
>
>
> RemoteBlast was DOA.
>
>
>
> I see there is some discussion about this in Septembers mailing list
> archives; the fixes that worked for me were changing:
>
> Scott Markel : ( $size > 1000 ) to ( $size > 2000 ) in RemoteBlast.pm
>
> AND
>
> paul.boutros : line 1145 of Bio\SearchIO\blast.pm this way:
> -1145:        if( /^((Query|Sbjct):\s+(\-?\d+)\s*)(\S+)\s+(\-?\d 
> +)/ ) {
> +1145:        if( /^((Query|Sbjct):{0,1}\s+(\-?\d+)\s*)(\S+)\s+(\-? 
> \d+)/ ) {
>
> I had to make BOTH changes for it to work.
>
> Note that BioPerl 1.4 form ActiveState does not have these changes  
> and does
> not work which I'm sure will confuse the hell out of any new users!
>
>
> Question: are these the best fixes to use, are these modules  
> working in 1.5?
>
>
>
> Thanks
>
> Paul
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From amackey at pcbi.upenn.edu  Thu Sep 22 11:30:27 2005
From: amackey at pcbi.upenn.edu (Aaron J. Mackey)
Date: Thu Sep 22 12:34:07 2005
Subject: [Bioperl-l] Broken RemoteBlast fixes
In-Reply-To: 
References: 
Message-ID: <139F4202-8A25-4840-BE34-17A956784679@pcbi.upenn.edu>

Nitpicky point:

   /:{0,1}/ is equivalent to (and overkill for) /:?/

-Aaron

On Sep 22, 2005, at 11:02 AM, Leo, Paul (NIH/NHGRI) wrote:

> So I come back from a "bio-perl break" and my code is spitting the  
> dummy.
>
>
>
> RemoteBlast was DOA.
>
>
>
> I see there is some discussion about this in Septembers mailing list
> archives; the fixes that worked for me were changing:
>
> Scott Markel : ( $size > 1000 ) to ( $size > 2000 ) in RemoteBlast.pm
>
> AND
>
> paul.boutros : line 1145 of Bio\SearchIO\blast.pm this way:
> -1145:        if( /^((Query|Sbjct):\s+(\-?\d+)\s*)(\S+)\s+(\-?\d 
> +)/ ) {
> +1145:        if( /^((Query|Sbjct):{0,1}\s+(\-?\d+)\s*)(\S+)\s+(\-? 
> \d+)/ ) {
>
> I had to make BOTH changes for it to work.
>
> Note that BioPerl 1.4 form ActiveState does not have these changes  
> and does
> not work which I'm sure will confuse the hell out of any new users!
>
>
> Question: are these the best fixes to use, are these modules  
> working in 1.5?
>
>
>
> Thanks
>
> Paul
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Aaron J. Mackey, Ph.D.
Project Manager, ApiDB Bioinformatics Resource Center
Penn Genomics Institute, University of Pennsylvania
email:  amackey@pcbi.upenn.edu
office: 215-898-1205 (Goddard) / 215-746-7018 (PCBI)
fax:    215-746-6697
postal: Penn Genomics Institute
         Goddard Labs 212
         415 S. University Avenue
         Philadelphia, PA  19104-6017


From bmoore at genetics.utah.edu  Thu Sep 22 12:51:55 2005
From: bmoore at genetics.utah.edu (Barry Moore)
Date: Thu Sep 22 13:01:23 2005
Subject: [Bioperl-l] bioperl 1.5.1 RC1 up
Message-ID: 

Debian Woody, Perl 5.6.1

Failed Test       Stat Wstat Total Fail  Failed  List of Failed
------------------------------------------------------------------------
-------
t/RestrictionIO.t               14    1   7.14%  10
t/tutorial.t       255 65280    21    6  28.57%  19-21
123 subtests skipped.
Failed 2/220 test scripts, 99.09% okay. 4/9916 subtests failed, 99.96%
okay.

Same RestrictionIO error I've been getting.  Still not sure why.
Haven't looked into the tutorial failures.

Barry

-----Original Message-----
From: bioperl-l-bounces@portal.open-bio.org
[mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Jason
Stajich
Sent: Wednesday, September 21, 2005 9:44 PM
To: Bioperl list
Subject: [Bioperl-l] bioperl 1.5.1 RC1 up

Release candidates for Bioperl 1.5.1 is up -I've not tagged anything  
in CVS so commits should continue to be made to the repository HEAD:

http://bioperl.org/DIST/bioperl-1.5.1-rc1.tar.gz
http://bioperl.org/DIST/bioperl-1.5.1-rc1.zip

Tests pass for me on OSX with some, but not all dependancies installed.

I do see this for t/OntologyStore.t and a failed test --
MSG: [5/5] tried to fetch http://cvs.sourceforge.net/viewcvs.py/ 
*checkout*/song/ontology/so.definition?rev=HEAD, but server threw  
500.  re

------------------------------------------------------------------------

-------
t/OntologyStore.t                6    4  66.67%  3-6
125 subtests skipped.
Failed 1/220 test scripts, 99.55% okay. 4/9916 subtests failed,  
99.96% okay.

I believe aspects of this test should be disabled without  
BIOPERLDEBUG=1.

I think the Changes file and README will need to be checked over and  
corrected for this release.

Can folks check over for any test failures.  I believe RestrictionIO  
is going to fail on perl 5.6.x but I don't know exactly what the  
workaround is - other than detect perl version and skip tests where  
appropriate.

Can anyone speak up for bioperl-run and bioperl-ext as to whether or  
not we can tag and put these out as developer release as well?  I  
need someone to help out with testing these packages and getting them  
ship-shape for a release too.

-jason
--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


_______________________________________________
Bioperl-l mailing list
Bioperl-l@portal.open-bio.org
http://portal.open-bio.org/mailman/listinfo/bioperl-l

From heikki.lehvaslaiho at gmail.com  Thu Sep 22 15:52:33 2005
From: heikki.lehvaslaiho at gmail.com (Heikki Lehvaslaiho)
Date: Thu Sep 22 20:07:35 2005
Subject: [Bioperl-l] bioperl 1.5.1 RC1 up
In-Reply-To: <200509221005.32481.heikki@ebi.ac.uk>
References: <73AFAD77-4C69-4D1A-AD0A-5D598A19A241@duke.edu>
	<200509221005.32481.heikki@ebi.ac.uk>
Message-ID: <200509222052.34055.heikki.lehvaslaiho@gmail.com>

After Jason and Albert's fixes on tests and run modules today, all tests pass.

I'd say that bioperl-run 1.5.1 RC1 is ready for release.

  -Heikki 

On Thursday 22 September 2005 10:05, Heikki Lehvaslaiho wrote:
> bioperl-run
> ===========
>
> We've usually released bioperl run at the same time as the live without
> separate testing cycle. It would be great to have some one to do that but
> as it is now, we could fix obvious errors and release it.
>
> Not having almost any binaries on my path I detected only two errors when
> running 'make test':
>
> Failed Test   Stat Wstat Total Fail  Failed  List of Failed
> ---------------------------------------------------------------------------
>---- t/Exonerate.t    2   512     5   10 200.00%  1-5
> t/Probcons.t   255 65280     7    0   0.00%  ??
> 372 subtests skipped.
> Failed 2/45 test scripts, 95.56% okay. 5/466 subtests failed, 98.93% okay.
>
>
> The Exonerate error seems to be caused by script looking for
> Bio::SearchIO::Exonerate when it is in Bio::Tool::Run::Alignment::Exonerate
>
>
>
>
> Probcons:
> ------------- EXCEPTION  -------------
> MSG: Unallowed parameter: QUIET !
> STACK
> Bio::Tools::Run::Alignment::Probcons::AUTOLOAD
> /home/heikki/src/bioperl/run/blib/lib/Bio/Tools/Run/Alignment/Probcons.pm:2
>20 STACK
> Bio::Tools::Run::Alignment::Probcons::new
> /home/heikki/src/bioperl/run/blib/lib/Bio/Tools/Run/Alignment/Probcons.pm:2
>09 STACK toplevel t/Probcons.t:33
>
>
>  -Heikki
>
> On Thursday 22 September 2005 04:44, Jason Stajich wrote:
> > Release candidates for Bioperl 1.5.1 is up -I've not tagged anything
> > in CVS so commits should continue to be made to the repository HEAD:
> >
> > http://bioperl.org/DIST/bioperl-1.5.1-rc1.tar.gz
> > http://bioperl.org/DIST/bioperl-1.5.1-rc1.zip
> >
> > Tests pass for me on OSX with some, but not all dependancies installed.
> >
> > I do see this for t/OntologyStore.t and a failed test --
> > MSG: [5/5] tried to fetch http://cvs.sourceforge.net/viewcvs.py/
> > *checkout*/song/ontology/so.definition?rev=HEAD, but server threw
> > 500.  re
> >
> > ------------------------------------------------------------------------
> > -------
> > t/OntologyStore.t                6    4  66.67%  3-6
> > 125 subtests skipped.
> > Failed 1/220 test scripts, 99.55% okay. 4/9916 subtests failed,
> > 99.96% okay.
> >
> > I believe aspects of this test should be disabled without
> > BIOPERLDEBUG=1.
> >
> > I think the Changes file and README will need to be checked over and
> > corrected for this release.
> >
> > Can folks check over for any test failures.  I believe RestrictionIO
> > is going to fail on perl 5.6.x but I don't know exactly what the
> > workaround is - other than detect perl version and skip tests where
> > appropriate.
> >
> > Can anyone speak up for bioperl-run and bioperl-ext as to whether or
> > not we can tag and put these out as developer release as well?  I
> > need someone to help out with testing these packages and getting them
> > ship-shape for a release too.
> >
> > -jason
> > --
> > Jason Stajich
> > Duke University
> > http://www.duke.edu/~jes12
> >
> >
> > _______________________________________________
> > Bioperl-l mailing list
> > Bioperl-l@portal.open-bio.org
> > http://portal.open-bio.org/mailman/listinfo/bioperl-l

-- 
______ _/      _/_____________________________________________________
      _/      _/                      http://www.ebi.ac.uk/mutations/
     _/  _/  _/  Heikki Lehvaslaiho    heikki at_ebi _ac _uk
    _/_/_/_/_/  EMBL Outstation, European Bioinformatics Institute
   _/  _/  _/  Wellcome Trust Genome Campus, Hinxton
  _/  _/  _/  Cambridge, CB10 1SD, United Kingdom
     _/      Phone: +44 (0)1223 494 644   FAX: +44 (0)1223 494 468
___ _/_/_/_/_/________________________________________________________
From amackey at pcbi.upenn.edu  Thu Sep 22 21:11:33 2005
From: amackey at pcbi.upenn.edu (Aaron J. Mackey)
Date: Thu Sep 22 21:13:46 2005
Subject: [Bioperl-l] Re: [Gmod-gbrowse] Translation glyph
In-Reply-To: 
References: 
Message-ID: <6718BF4E-9E55-422B-BF78-2F0C040A02D2@pcbi.upenn.edu>

Somehow, even though I sing the alphabet song to my son nearly every  
day, I couldn't remember V.  It's been fixed.

Thanks,

-Aaron

On Sep 22, 2005, at 9:04 PM, Smithies, Russell wrote:

> Looks really good but seems to have a problem with Valine?
>
> -----Original Message-----
> From: Aaron J. Mackey [mailto:amackey@pcbi.upenn.edu]
> Sent: Friday, 23 September 2005 12:56 a.m.
> To: Marc Logghe
> Cc: Smithies, Russell; gmod-gbrowse@lists.sourceforge.net;
> bioperl-l@portal.open-bio.org
> Subject: Re: [Gmod-gbrowse] Translation glyph
>
>
> But the translation glyph code could easily do the necessary
> substitutions.  I agree it should not be done from
> Bio::Tools::CodonTable
>
> I just checked in the patch to bioperl for translation.pm to enable
> "triletter_code" as an option (defaults to 0).  Give it a try.  I'm
> happy to back it out if there are problems.
>
> -Aaron
>
> On Sep 22, 2005, at 2:36 AM, Marc Logghe wrote:
>
>
>>> -----Original Message-----
>>> From: gmod-gbrowse-admin@lists.sourceforge.net
>>> [mailto:gmod-gbrowse-admin@lists.sourceforge.net] On Behalf
>>> Of Smithies, Russell
>>> Sent: Thursday, September 22, 2005 4:21 AM
>>> To: gmod-gbrowse@lists.sourceforge.net
>>> Subject: [Gmod-gbrowse] Translation glyph
>>>
>>> Is it possible to show 3-letter names for 3-frame and 6-frame
>>> translation glyphs at high magnification?
>>> E.g.  'Phe' instead of 'F'
>>>
>>>
>> I am afraid this is currently not possible AFAIK.  
>> B::G::G::translation
>> is depending on Bio::Tools::CodonTable. The translate() method of the
>> latter only returns single amino acid codes. However,  
>> B::T::CodonTable
>> *is* aware of threeletter codes but only in the context of
>> revtranslate().
>> One could change the behaviour of B::T::CodonTable, though. But I
>> don't
>> know whether the resulting Bio::PrimarySeq will be valid for bioperl.
>>
>> Marc
>>
>>
>> -------------------------------------------------------
>> SF.Net email is sponsored by:
>> Tame your development challenges with Apache's Geronimo App Server.
>> Download it for free - -and be entered to win a 42" plasma tv or
>> your very
>> own Sony(tm)PSP.  Click here to play: http://sourceforge.net/
>> geronimo.php
>> _______________________________________________
>> Gmod-gbrowse mailing list
>> Gmod-gbrowse@lists.sourceforge.net
>> https://lists.sourceforge.net/lists/listinfo/gmod-gbrowse
>>
>>
>
> --
> Aaron J. Mackey, Ph.D.
> Project Manager, ApiDB Bioinformatics Resource Center
> Penn Genomics Institute, University of Pennsylvania
> email:  amackey@pcbi.upenn.edu
> office: 215-898-1205 (Goddard) / 215-746-7018 (PCBI)
> fax:    215-746-6697
> postal: Penn Genomics Institute
>          Goddard Labs 212
>          415 S. University Avenue
>          Philadelphia, PA  19104-6017
>
>
> ====================================================================== 
> =
> Attention: The information contained in this message and/or  
> attachments
> from AgResearch Limited is intended only for the persons or entities
> to which it is addressed and may contain confidential and/or  
> privileged
> material. Any review, retransmission, dissemination or other use  
> of, or
> taking of any action in reliance upon, this information by persons or
> entities other than the intended recipients is prohibited by  
> AgResearch
> Limited. If you have received this message in error, please notify the
> sender immediately.
> ====================================================================== 
> =
>

--
Aaron J. Mackey, Ph.D.
Project Manager, ApiDB Bioinformatics Resource Center
Penn Genomics Institute, University of Pennsylvania
email:  amackey@pcbi.upenn.edu
office: 215-898-1205 (Goddard) / 215-746-7018 (PCBI)
fax:    215-746-6697
postal: Penn Genomics Institute
         Goddard Labs 212
         415 S. University Avenue
         Philadelphia, PA  19104-6017


From wes.barris at csiro.au  Thu Sep 22 21:19:50 2005
From: wes.barris at csiro.au (Wes Barris)
Date: Thu Sep 22 21:30:58 2005
Subject: [Bioperl-l] Assembly error when parsing .ace files
Message-ID: <43335836.9050809@csiro.au>

Hi,

I have a .ace (and associated files) that I want to parse with bioperl.
The following code produces the displayed error when run:

#!/usr/bin/perl -w
use strict;
use Bio::Assembly::IO;
my $usage = "Usage: $0 \n";
my $infile = shift or die $usage;
my $io = new Bio::Assembly::IO(-file=>$infile, -format=>'ace');
my $assembly = $io->next_assembly();

Use of uninitialized value in concatenation (.) or string at /usr/lib/perl5/site_perl/5.8.5/Bio/Assembly/IO/ace.pm line 392,  line 1.
Use of uninitialized value in concatenation (.) or string at /usr/lib/perl5/site_perl/5.8.5/Bio/Assembly/IO/ace.pm line 392,  line 2.

The problem is in the following code fragment from ace.pm:

           my ($phdfilename,$chromatfilename);
           if ($seq->desc() =~ /PHD_FILE: (\S+)/) {
               $phdfilename = $1;
           }
           if ($seq->desc() =~ /CHROMAT_FILE: (\S+)/)  {
                $chromatfilename = $1;
           }
           (my $phdfile = $singletsfilename) =~ s/edit_dir.*//;
           $phdfile .= "phd_dir/$phdfilename";

The above code is reading the .singlets file and looking for the string
"PHD_FILE:" in the defline.  That string does not exist in my singlets
deflines.  My .ace (and associated files) are created using the cap3
application.

Perhaps ace.pm should be modified to gracefully handle the case where
singlet deflines do not contain the "PHD_FILE:" string.

I am running a CVS version of bioperl updated on Sep 22 on a Linux
RHEL 4.1 system.  Perl version 5.8.5.  The defline of my singlet file
is:

 >BF654941 11920073 | BF654941.1 CLONE: unknown CLONE_LIB: MARC 3BOV LEN: 491 bp FILE: 284.fa 5-PRIME DEFN: 279305 MARC 3BOV Bos taurus cDNA 5', mRNA sequence. tissuetype=[pooled] organism=[Bos taurus]

-- 
Wes Barris
E-Mail: Wes.Barris@csiro.au
From jason.stajich at duke.edu  Thu Sep 22 21:43:36 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Thu Sep 22 21:43:59 2005
Subject: [Bioperl-l] Bio::Tools::Run::TribeMCL
In-Reply-To: <1126276875.7420.29.camel@localhost.localdomain>
References: <4627846405090904585951f015@mail.gmail.com>
	<1126276875.7420.29.camel@localhost.localdomain>
Message-ID: 


On Sep 9, 2005, at 10:41 AM, Albert Vilella wrote:

>> How
>> can I make it put the output in the directory the program was  
>> called -
>> is there a flag I can add to the @params ??
>>
>
> Hi all,
>
> Jason and myself were considering to convert the tempdir method in
> Bio::Tools::Run::WrapperBase in a setter/getter, so that instead of
> getting a random tempdir, one could set the tempdir to a defined  
> value:
>
> Something like:
>
> sub tempdir{
>    my ($self) = @_;
>
> ## Add the setter part here
>     return $self->{'_tmpdir'} = shift if @_;
> ##
>    unless( $self->{'_tmpdir'} ) {
>        $self->{'_tmpdir'} = $self->io->tempdir(CLEANUP => !
> $self->save_tempfiles );
>    }
>    unless( -d $self->{'_tmpdir'} ) {
>        mkdir($self->{'_tmpdir'},0777);
>    }
>    $self->{'_tmpdir'};
> }
>
> Jason: How do you want the CLEANUP part to behave if the tempdir is
> setted? The same way as save_tempfiles?

[oops this got buried in the mail...]

Hmm - I think if the user requests a specific tempdir then we are not  
obligated to clean it up.  That would be my feeling.  Do the folks  
who want this functionality have an opinion about it?

It will be a bit of a pain to go back and try and cleanup a user  
specified dir as this is currently handled by the tempdir function  
already,  so I think a good reason has to be made for when a user  
wants to specify a particular tempdir but ALSO wants the tempfiles  
cleaned up afterwards.

In general  Albert - this sound good  - please feel free to make the  
changes at least about the setting of tempfile.

If it is just a simple added feature we can sneak it into bioperl  
1.5.1 this week before the release.

>
> Bests,
>
>     Albert.
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12/


From jason.stajich at duke.edu  Thu Sep 22 21:36:11 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Thu Sep 22 21:51:25 2005
Subject: [Bioperl-l] Assembly error when parsing .ace files
In-Reply-To: <43335836.9050809@csiro.au>
References: <43335836.9050809@csiro.au>
Message-ID: 

Maybe you can make the changes locally, get it to work , then post a  
patch?  Assuming the authors were writing it for phrap ace assemblies  
and coded it as such.

-jason

On Sep 22, 2005, at 9:19 PM, Wes Barris wrote:

> Hi,
>
> I have a .ace (and associated files) that I want to parse with  
> bioperl.
> The following code produces the displayed error when run:
>
> #!/usr/bin/perl -w
> use strict;
> use Bio::Assembly::IO;
> my $usage = "Usage: $0 \n";
> my $infile = shift or die $usage;
> my $io = new Bio::Assembly::IO(-file=>$infile, -format=>'ace');
> my $assembly = $io->next_assembly();
>
> Use of uninitialized value in concatenation (.) or string at /usr/ 
> lib/perl5/site_perl/5.8.5/Bio/Assembly/IO/ace.pm line 392,   
> line 1.
> Use of uninitialized value in concatenation (.) or string at /usr/ 
> lib/perl5/site_perl/5.8.5/Bio/Assembly/IO/ace.pm line 392,   
> line 2.
>
> The problem is in the following code fragment from ace.pm:
>
>           my ($phdfilename,$chromatfilename);
>           if ($seq->desc() =~ /PHD_FILE: (\S+)/) {
>               $phdfilename = $1;
>           }
>           if ($seq->desc() =~ /CHROMAT_FILE: (\S+)/)  {
>                $chromatfilename = $1;
>           }
>           (my $phdfile = $singletsfilename) =~ s/edit_dir.*//;
>           $phdfile .= "phd_dir/$phdfilename";
>
> The above code is reading the .singlets file and looking for the  
> string
> "PHD_FILE:" in the defline.  That string does not exist in my singlets
> deflines.  My .ace (and associated files) are created using the cap3
> application.
>
> Perhaps ace.pm should be modified to gracefully handle the case where
> singlet deflines do not contain the "PHD_FILE:" string.
>
> I am running a CVS version of bioperl updated on Sep 22 on a Linux
> RHEL 4.1 system.  Perl version 5.8.5.  The defline of my singlet file
> is:
>
> >BF654941 11920073 | BF654941.1 CLONE: unknown CLONE_LIB: MARC 3BOV  
> LEN: 491 bp FILE: 284.fa 5-PRIME DEFN: 279305 MARC 3BOV Bos taurus  
> cDNA 5', mRNA sequence. tissuetype=[pooled] organism=[Bos taurus]
>
> -- 
> Wes Barris
> E-Mail: Wes.Barris@csiro.au
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12/


From wes.barris at csiro.au  Thu Sep 22 22:14:54 2005
From: wes.barris at csiro.au (Wes Barris)
Date: Thu Sep 22 22:15:55 2005
Subject: [Bioperl-l] Cannot guess alphabet error
Message-ID: <4333651E.3070602@csiro.au>

Hi,

The following code produces the error shown.  What is the correct way
to set the alphabet of a primary (or locatable) seq?

#!/usr/bin/perl -w
use strict;
use Bio::PrimarySeq;
my $myseq = new Bio::PrimarySeq(-seq=>'AGCT', -id=>'myseq', -alphabet=>'dna');
$myseq->alphabet('dna');
$myseq->seq('----');


------------- EXCEPTION  -------------
MSG: Got a sequence with no letters in it cannot guess alphabet []
STACK Bio::PrimarySeq::_guess_alphabet /usr/lib/perl5/site_perl/5.8.5/Bio/PrimarySeq.pm:837
STACK Bio::PrimarySeq::seq /usr/lib/perl5/site_perl/5.8.5/Bio/PrimarySeq.pm:279
STACK toplevel /home/wes/soft/ace/test.pl:6

It might seem to be a silly thing to want to do (setting a sequences to
a series of dashes).  My reason for wanting to do this is involves the
creation of an alighment (msf) file.

I am using a fresh version of bioperl-live, perl 5.8.5, Linux RHEL 4.1.
-- 
Wes Barris
E-Mail: Wes.Barris@csiro.au
From wes.barris at csiro.au  Thu Sep 22 22:43:17 2005
From: wes.barris at csiro.au (Wes Barris)
Date: Thu Sep 22 22:43:47 2005
Subject: [Bioperl-l] Assembly error when parsing .ace files
In-Reply-To: 
References: <43335836.9050809@csiro.au>
	
Message-ID: <43336BC5.9090304@csiro.au>

Jason Stajich wrote:

> Maybe you can make the changes locally, get it to work , then post a  
> patch?  Assuming the authors were writing it for phrap ace assemblies  
> and coded it as such.

Ok.  I'm not sure about how you want this formated but here is my fix:

Bio/Assembly/IO/ace.pm line 384
Old:
           my ($phdfilename,$chromatfilename);
New:
           my ($phdfilename,$chromatfilename) = qw(unset unset);

> 
> -jason
> 
> On Sep 22, 2005, at 9:19 PM, Wes Barris wrote:
> 
>> Hi,
>>
>> I have a .ace (and associated files) that I want to parse with  bioperl.
>> The following code produces the displayed error when run:
>>
>> #!/usr/bin/perl -w
>> use strict;
>> use Bio::Assembly::IO;
>> my $usage = "Usage: $0 \n";
>> my $infile = shift or die $usage;
>> my $io = new Bio::Assembly::IO(-file=>$infile, -format=>'ace');
>> my $assembly = $io->next_assembly();
>>
>> Use of uninitialized value in concatenation (.) or string at /usr/ 
>> lib/perl5/site_perl/5.8.5/Bio/Assembly/IO/ace.pm line 392,   
>> line 1.
>> Use of uninitialized value in concatenation (.) or string at /usr/ 
>> lib/perl5/site_perl/5.8.5/Bio/Assembly/IO/ace.pm line 392,   
>> line 2.
>>
>> The problem is in the following code fragment from ace.pm:
>>
>>           my ($phdfilename,$chromatfilename);
>>           if ($seq->desc() =~ /PHD_FILE: (\S+)/) {
>>               $phdfilename = $1;
>>           }
>>           if ($seq->desc() =~ /CHROMAT_FILE: (\S+)/)  {
>>                $chromatfilename = $1;
>>           }
>>           (my $phdfile = $singletsfilename) =~ s/edit_dir.*//;
>>           $phdfile .= "phd_dir/$phdfilename";
>>
>> The above code is reading the .singlets file and looking for the  string
>> "PHD_FILE:" in the defline.  That string does not exist in my singlets
>> deflines.  My .ace (and associated files) are created using the cap3
>> application.
>>
>> Perhaps ace.pm should be modified to gracefully handle the case where
>> singlet deflines do not contain the "PHD_FILE:" string.
>>
>> I am running a CVS version of bioperl updated on Sep 22 on a Linux
>> RHEL 4.1 system.  Perl version 5.8.5.  The defline of my singlet file
>> is:
>>
>> >BF654941 11920073 | BF654941.1 CLONE: unknown CLONE_LIB: MARC 3BOV  
>> LEN: 491 bp FILE: 284.fa 5-PRIME DEFN: 279305 MARC 3BOV Bos taurus  
>> cDNA 5', mRNA sequence. tissuetype=[pooled] organism=[Bos taurus]
>>
>> -- 
>> Wes Barris
>> E-Mail: Wes.Barris@csiro.au
>> _______________________________________________
>> Bioperl-l mailing list
>> Bioperl-l@portal.open-bio.org
>> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>>
> 
> -- 
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12/
> 


-- 
Wes Barris
E-Mail: Wes.Barris@csiro.au
From wes.barris at csiro.au  Thu Sep 22 22:35:02 2005
From: wes.barris at csiro.au (Wes Barris)
Date: Thu Sep 22 22:46:14 2005
Subject: [Bioperl-l] Cannot guess alphabet error
In-Reply-To: <9E640D96-E03A-4E23-A3F5-0677DE908C4E@duke.edu>
References: <4333651E.3070602@csiro.au>
	<9E640D96-E03A-4E23-A3F5-0677DE908C4E@duke.edu>
Message-ID: <433369D6.9030204@csiro.au>

Jason Stajich wrote:

> use Bio::LocatableSeq for building alignments - these can be '---'  
> seqs.  You'll see these are required when adding sequences to a  
> BIo::SimpleAlign object for writing out to msf.

Actually, I am.  In order to make the sample code a simple as possible,
I changed it to PrimarySeq.  This code also produces the error:

#!/usr/bin/perl -w
use strict;
use Bio::LocatableSeq;
my $myseq = new Bio::LocatableSeq(-seq=>'AGCT', -id=>'myseq', -alphabet=>'dna');
$myseq->alphabet('dna');
$myseq->seq('----');



> 
> On Sep 22, 2005, at 10:14 PM, Wes Barris wrote:
> 
>> Hi,
>>
>> The following code produces the error shown.  What is the correct way
>> to set the alphabet of a primary (or locatable) seq?
>>
>> #!/usr/bin/perl -w
>> use strict;
>> use Bio::PrimarySeq;
>> my $myseq = new Bio::PrimarySeq(-seq=>'AGCT', -id=>'myseq', - 
>> alphabet=>'dna');
>> $myseq->alphabet('dna');
>> $myseq->seq('----');
>>
>>
>> ------------- EXCEPTION  -------------
>> MSG: Got a sequence with no letters in it cannot guess alphabet []
>> STACK Bio::PrimarySeq::_guess_alphabet /usr/lib/perl5/site_perl/ 
>> 5.8.5/Bio/PrimarySeq.pm:837
>> STACK Bio::PrimarySeq::seq /usr/lib/perl5/site_perl/5.8.5/Bio/ 
>> PrimarySeq.pm:279
>> STACK toplevel /home/wes/soft/ace/test.pl:6
>>
>> It might seem to be a silly thing to want to do (setting a  sequences to
>> a series of dashes).  My reason for wanting to do this is involves the
>> creation of an alighment (msf) file.
>>
>> I am using a fresh version of bioperl-live, perl 5.8.5, Linux RHEL  4.1.
>> -- 
>> Wes Barris
>> E-Mail: Wes.Barris@csiro.au
>> _______________________________________________
>> Bioperl-l mailing list
>> Bioperl-l@portal.open-bio.org
>> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>>
> 
> -- 
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
> 


-- 
Wes Barris
E-Mail: Wes.Barris@csiro.au
From jason.stajich at duke.edu  Thu Sep 22 23:12:21 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Thu Sep 22 23:13:46 2005
Subject: [Bioperl-l] Cannot guess alphabet error
In-Reply-To: <433369D6.9030204@csiro.au>
References: <4333651E.3070602@csiro.au>
	<9E640D96-E03A-4E23-A3F5-0677DE908C4E@duke.edu>
	<433369D6.9030204@csiro.au>
Message-ID: 

 From Bio::PrimarySeq

Title   : seq
Usage   : $string    = $obj->seq()
Function: Returns the sequence as a string of letters. The
            case of the letters is left up to the implementer.
            Suggested cases are upper case for proteins and lower  
case for
            DNA sequence (IUPAC standard), but you should not rely on  
this.
Returns : A scalar
Args    : Optionally on set the new value (a string). An optional second
            argument presets the alphabet (otherwise it will be  
guessed).
            Both parameters may also be given in named paramater style
            with -seq and -alphabet being the names.

You can pass in the alphabet as a second option:
$myseq->seq('---','dna');


On Sep 22, 2005, at 10:35 PM, Wes Barris wrote:

> Jason Stajich wrote:
>
>
>> use Bio::LocatableSeq for building alignments - these can be  
>> '---'  seqs.  You'll see these are required when adding sequences  
>> to a  BIo::SimpleAlign object for writing out to msf.
>>
>
> Actually, I am.  In order to make the sample code a simple as  
> possible,
> I changed it to PrimarySeq.  This code also produces the error:
>
> #!/usr/bin/perl -w
> use strict;
> use Bio::LocatableSeq;
> my $myseq = new Bio::LocatableSeq(-seq=>'AGCT', -id=>'myseq', - 
> alphabet=>'dna');
> $myseq->alphabet('dna');
> $myseq->seq('----');
>
>
>
>
>> On Sep 22, 2005, at 10:14 PM, Wes Barris wrote:
>>
>>> Hi,
>>>
>>> The following code produces the error shown.  What is the correct  
>>> way
>>> to set the alphabet of a primary (or locatable) seq?
>>>
>>> #!/usr/bin/perl -w
>>> use strict;
>>> use Bio::PrimarySeq;
>>> my $myseq = new Bio::PrimarySeq(-seq=>'AGCT', -id=>'myseq', -  
>>> alphabet=>'dna');
>>> $myseq->alphabet('dna');
>>> $myseq->seq('----');
>>>
>>>
>>> ------------- EXCEPTION  -------------
>>> MSG: Got a sequence with no letters in it cannot guess alphabet []
>>> STACK Bio::PrimarySeq::_guess_alphabet /usr/lib/perl5/site_perl/  
>>> 5.8.5/Bio/PrimarySeq.pm:837
>>> STACK Bio::PrimarySeq::seq /usr/lib/perl5/site_perl/5.8.5/Bio/  
>>> PrimarySeq.pm:279
>>> STACK toplevel /home/wes/soft/ace/test.pl:6
>>>
>>> It might seem to be a silly thing to want to do (setting a   
>>> sequences to
>>> a series of dashes).  My reason for wanting to do this is  
>>> involves the
>>> creation of an alighment (msf) file.
>>>
>>> I am using a fresh version of bioperl-live, perl 5.8.5, Linux  
>>> RHEL  4.1.
>>> -- 
>>> Wes Barris
>>> E-Mail: Wes.Barris@csiro.au
>>> _______________________________________________
>>> Bioperl-l mailing list
>>> Bioperl-l@portal.open-bio.org
>>> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>>>
>>>
>> -- 
>> Jason Stajich
>> Duke University
>> http://www.duke.edu/~jes12
>>
>
>
> -- 
> Wes Barris
> E-Mail: Wes.Barris@csiro.au
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From wes.barris at csiro.au  Thu Sep 22 23:43:50 2005
From: wes.barris at csiro.au (Wes Barris)
Date: Thu Sep 22 23:44:12 2005
Subject: [Bioperl-l] get_nof_contigs returns undef
Message-ID: <433379F6.4000306@csiro.au>

Hi,

The "get_nof_contigs" function does not appear to work.  The following code
results in an error when trying to print the number of contigs in the
assembly.

#!/usr/bin/perl -w
use strict;
use Bio::Assembly::IO;
my $usage = "Usage: $0   [cn#]\n";
my $infile = shift or die $usage;
my $io = new Bio::Assembly::IO(-file=>$infile, -format=>'ace');
my $assembly = $io->next_assembly();    # Bio::Assembly::ScaffoldI
my @contigIds = $assembly->get_contig_ids;
my $nContigs = $assembly->get_nof_contigs;
print("Contig IDs: @contigIds\n");
print("N contigs: $nContigs\n");


wes@bioserver> ~/soft/ace/test.pl fasta/cl.00001.fa.cap.ace
Contig IDs: 1
Use of uninitialized value in concatenation (.) or string at /home/wes/soft/ace/test.pl line 11,  line 243.
N contigs:

-- 
Wes Barris
E-Mail: Wes.Barris@csiro.au
From jason.stajich at duke.edu  Thu Sep 22 22:28:24 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Thu Sep 22 23:58:08 2005
Subject: [Bioperl-l] Cannot guess alphabet error
In-Reply-To: <4333651E.3070602@csiro.au>
References: <4333651E.3070602@csiro.au>
Message-ID: <9E640D96-E03A-4E23-A3F5-0677DE908C4E@duke.edu>

use Bio::LocatableSeq for building alignments - these can be '---'  
seqs.  You'll see these are required when adding sequences to a  
BIo::SimpleAlign object for writing out to msf.

On Sep 22, 2005, at 10:14 PM, Wes Barris wrote:

> Hi,
>
> The following code produces the error shown.  What is the correct way
> to set the alphabet of a primary (or locatable) seq?
>
> #!/usr/bin/perl -w
> use strict;
> use Bio::PrimarySeq;
> my $myseq = new Bio::PrimarySeq(-seq=>'AGCT', -id=>'myseq', - 
> alphabet=>'dna');
> $myseq->alphabet('dna');
> $myseq->seq('----');
>
>
> ------------- EXCEPTION  -------------
> MSG: Got a sequence with no letters in it cannot guess alphabet []
> STACK Bio::PrimarySeq::_guess_alphabet /usr/lib/perl5/site_perl/ 
> 5.8.5/Bio/PrimarySeq.pm:837
> STACK Bio::PrimarySeq::seq /usr/lib/perl5/site_perl/5.8.5/Bio/ 
> PrimarySeq.pm:279
> STACK toplevel /home/wes/soft/ace/test.pl:6
>
> It might seem to be a silly thing to want to do (setting a  
> sequences to
> a series of dashes).  My reason for wanting to do this is involves the
> creation of an alighment (msf) file.
>
> I am using a fresh version of bioperl-live, perl 5.8.5, Linux RHEL  
> 4.1.
> -- 
> Wes Barris
> E-Mail: Wes.Barris@csiro.au
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From wes.barris at csiro.au  Fri Sep 23 01:16:57 2005
From: wes.barris at csiro.au (Wes Barris)
Date: Fri Sep 23 01:20:03 2005
Subject: [Bioperl-l] get_nof_contigs returns undef
In-Reply-To: <433379F6.4000306@csiro.au>
References: <433379F6.4000306@csiro.au>
Message-ID: <43338FC9.3030208@csiro.au>

Wes Barris wrote:

> Hi,
> 
> The "get_nof_contigs" function does not appear to work.  The following code
> results in an error when trying to print the number of contigs in the
> assembly.
> 
> #!/usr/bin/perl -w
> use strict;
> use Bio::Assembly::IO;
> my $usage = "Usage: $0   [cn#]\n";
> my $infile = shift or die $usage;
> my $io = new Bio::Assembly::IO(-file=>$infile, -format=>'ace');
> my $assembly = $io->next_assembly();    # Bio::Assembly::ScaffoldI
> my @contigIds = $assembly->get_contig_ids;
> my $nContigs = $assembly->get_nof_contigs;
> print("Contig IDs: @contigIds\n");
> print("N contigs: $nContigs\n");
> 
> 
> wes@bioserver> ~/soft/ace/test.pl fasta/cl.00001.fa.cap.ace
> Contig IDs: 1
> Use of uninitialized value in concatenation (.) or string at 
> /home/wes/soft/ace/test.pl line 11,  line 243.
> N contigs:

I don't know enough about scalars and array refs to explain this, but
a fix for the above problem is:

Old Bio/Assembly/Scaffold.pm code:

sub get_nof_contigs {
     my $self = shift;
     return scalar( $self->get_contig_ids() );
}

New Bio/Assembly/Scaffold.pm code:

sub get_nof_contigs {
     my $self = shift;
     my @junk = $self->get_contig_ids;
     return scalar( @junk );
#   return scalar( $self->get_contig_ids() );
}

-- 
Wes Barris
E-Mail: Wes.Barris@csiro.au
From daniel at kagsaa.dk  Thu Sep 22 12:26:49 2005
From: daniel at kagsaa.dk (Daniel Hansen)
Date: Fri Sep 23 13:26:36 2005
Subject: [Bioperl-l] dead link on bioperl.org
Message-ID: <000601c5bf92$6fd52fe0$611010ac@intern>

Hi

There's a dead link on the HOWTO page on bioperl.org:
http://bioperl.org/HOWTOs/

The link to the PDF of the Beginners HOWTO is dead:
http://bioperl.org/HOWTOs/pdf/Beginners.pdf

Best regards,

Daniel

From sachbinfo at gmail.com  Wed Sep 21 09:40:38 2005
From: sachbinfo at gmail.com (Sachin Pundhir)
Date: Fri Sep 23 13:31:37 2005
Subject: [Bioperl-l] RemoteBlast by Bio::Perl Through proxy
Message-ID: <932ed26e050921064073bc5936@mail.gmail.com>

Hi
 I have a problem regarding performing remote blast through
RemoteBlast.pmmodule if Bioperl. I am getting the error
 500 Can't connect to www.ncbi.nlm.nih.gov:80
(Bad hostname '
www.ncbi.nlm.nih.gov ')
 I am not able to set the proxy setting, which i have done successfully to
retrieve a sequence from the genbank.
 It will be great help from your side.
 waiting for ur timely help.
 Sachin

From toniher at bioinf.uab.es  Thu Sep 22 11:35:30 2005
From: toniher at bioinf.uab.es (Toni Hermoso Pulido)
Date: Fri Sep 23 13:31:39 2005
Subject: [Bioperl-l] PDB XML Libray
Message-ID: <4332CF42.1080305@bioinf.uab.es>

Hello,

Is there any XML PDB module in Bioperl?
Do you know some open source licensed library specifically for this?

Best regards,

-- 
000000000000 Toni Hermoso Pulido 111111111111

  Unitat de Bioinform?tica
  Institut de Biotecnologia i Biomedicina
  Universitat Aut?noma de Barcelona
  08193 Bellaterra - Cerdanyola del Vall?s
  (Barcelona) - Catalunya - Europa

@ email: toniher@bioinf.uab.es
& pgp_public_key_id: 11749A26
% tel: (0034) 93 581 28 07

111111111111 ATG <-LINRLS-> STOP 000000000000
From mayagao1999 at yahoo.com  Fri Sep 23 00:15:18 2005
From: mayagao1999 at yahoo.com (Alex Zhang)
Date: Fri Sep 23 13:31:45 2005
Subject: [Bioperl-l] Seek advice on programming of miRNA problem 
Message-ID: <20050923041518.4318.qmail@web53503.mail.yahoo.com>

Dear all,

I am doing something about miRNA mapping. Please
suggest me on this question. Thank you very much ahead
of time. 

Sincerely,
   Alex



Basically, 

1.	There are two files to be processed. The first one
is ?HuBACmap_OG1_4x4_Bld35v1_Mar8-05? which contains
the array information about Bacteria Artificial
Chromosomes. The other one is called ?miRNA maps?
which holds the information about the microRNAs gained
from UCSC Genome Center.  
2.	?HuBACmap_OG1_4x4_Bld35v1_Mar8-05? file holds 8
columns and 9575 rows. The first row looks like:

ID   Block    Column   Row	  Chrom	    Start	   End	  
 Mid

>From the 2nd row to the last row, the information
about each BAC is listed block by block (there are 16
blocks from Block 1 to Block 16). A snapshot would be
like:

RP11-125P20	 1	18	 1	01	 88031403    88194307  
88112855
RP11-72M14	 1	19	 1	01	112869186   112904105 112886645
RP11-130B18	 1	20	 1		NA	NA	NA
RP11-192J8	 1	21	 1	01	118214732   118215022 118214877




The features for this file are:
(1)	The important information which will be used are:
?ID? which identify the individual BAC on each
chromosome.
?Chrom? which stands for each chromosome. There are 23
chromosomes.
?Start? and ?End? which specify the location of each
BAC on each chromosome. 
(2)	This file includes some unknown information which
is designated by ?NA?. If in this case, the row
including ?NA? should be ignored.
(3)	There are duplicate data for some BACs. For
example, you may find:
       RP11-192J8	 1	21	 1	01	118214732   118215022 
118214877
       RP11-192J8	 2	45	 1	01	118214732   118215022 
118214877
       Which means that these two rows hold the same
information at least for ID, Chrom, Start, End and Mid
even though the values for Block or Column are
different. If in this case, the program should be able
to recognize the duplicate information and pick any
row for further processing. 
(4) The length of the site which each BAC occupies
ranges from 100bps-350bps.
3.	 ?miRNA maps? file holds 10 columns and 325 rows.
The first row looks like:

#bin chrom  chromStart  chromEnd   name   score  
strand   thickStart   thickEnd   type

>From the 2nd row to the last row, the information
about each microRNA is listed chromosome by chromosome
(there are 23 chromosomes from Ch 1 to Ch X). A
snapshot would be like:

      593	chr1	1142406	1142501     hsa-mir-200b	960	+
1142459	1142483	miRna
      593	chr1	1143165	1143255     hsa-mir-200a	960	+
1143180	1143202	miRna




The features for this file are:
(1) The important information which will be used are:
?chrom? which identify the chromosome occupied by
microRNA.
 ?name? which is the unique name for each microRNA.
?thickStart? and ?thickEnd? specify the site which
microRNA occupies. 
(2) Usually the length for each site is around 22.
      4.    The task is to identify on each chromosome
the flanking BACs for each microRNA and which one is
much closer to the microRNA. To make it easy to
understand, we use a figure to illustrate:

_________________*   miRNA  
*_____________________________________
 *BAC0* *  BAC1*___|                  |____________*  
    BAC2          *   *  BAC3  *
                              D1                      
        D2
Note: 

"*" defines the boundary for miRNA or BAC.
BAC1 is one of the flanking BACs for miRNA because it
is much closer than BAC0;
BAC2 is another flanking BAC for miRNA because it is
much closer than BAC3;

After determining the sites of flanking BACs, we will
calculate the distance between each flanking BAC and
miRNA, which will be D1 and D2. If D1 is greater than
D2, we could say BAC2 is much closer to miRNA than
BAC1.

Then we will end up with a list like:

Chrom        name      ID1     ID2     ID3    D1    D2
 thickStart   thickEnd   

?Chrom? for each chromosome;
?name?   for each miRNA;
?ID1? for the left flanking BAC for each miRNA;
?ID2? for the right flanking BAC for each each miRNA;
?ID3? for the flanking BAC which is closer to miRNA;
?D1?  for the distance between the left flanking BAC
and miRNA;
?D2? for the distance between the right flanking BAC
and miRNA;
?thickStart? and ?thickEnd? specify the site which
microRNA occupies

5. We also can imagine some special cases which might
exist. For example, there is a possiblity that a miRNA
shares a common region with its flanking BAC,which
looks like:
 
_________________*   miRNA   *____________________
                 *    BAC             *
It is simple to say that this BAC is a flanking one
for this miRNA. 
Besides, there is another possibilty that a miRNA is
within a BAC, which looks like:
 
_________________*   miRNA   *____________________
                 *          BAC                       
         *
This may happen because the length for a miRNA is
around 22 and the length for a BAC is more than 100. 

If in this case, we will suggest that this miRNA has
only one BAC and the distance is 0.  For example,

Chrom        name               ID1       ID2     ID3 
   D1    D2   thickStart   thickEnd   
  1            hsa-mir-200     RP12    RP12   RP12   0
      0      116677     116699






             


	
		
______________________________________________________ 
Yahoo! for Good 
Donate to the Hurricane Katrina relief effort. 
http://store.yahoo.com/redcross-donate3/ 
-------------- next part --------------
ID	     Block	Column Row	Chrom	    Start	   End	    Mid
RP11-82D16	 1	 1	 1	01	  2171400	  2171718	  2171559
RP11-111O5	 1	 2	 1	01	  4418595	  4548595	  4483595
RP11-60J11	 1	 3	 1	01	  7041726	  7232439	  7137082
RP11-188F7	 1	 4	 1	01	 12266459	 12266824	 12266641
RP11-219F4	 1	 5	 1	01	 14774025	 14774291	 14774158
RP11-145C4	 1	 6	 1	01	 18753014	 18883014	 18818014
RP11-161A11	 1	 7	 1	01	 34184152	 34348134	 34266143
RP11-118E3	 1	 8	 1	01	 34886841	 34887196	 34887018
RP11-207P5	 1	 9	 1	01	 37176445	 37176819	 37176632
RP11-88O2	 1	10	 1	01	 42142387	 42272387	 42207387
RP11-253M24	 1	11	 1	01	 45426353	 45426660	 45426506
RP11-195G13	 1	12	 1	01	 54039750	 54231973	 54135861
RP11-114K16	 1	13	 1	01	 75425075	 75597284	 75511179
RP11-198H14	 1	14	 1	01	 78696115	 78696467	 78696291
RP11-89A19	 1	15	 1	01	 80866079	 81035538	 80950808
RP11-78E18	 1	16	 1	01	 82980744	 83149325	 83065034
RP11-246O4	 1	17	 1	01	 82952756	 83112098	 83032427
RP11-125P20	 1	18	 1	01	 88031403	 88194307	 88112855
RP11-72M14	 1	19	 1	01	112869186	112904105	112886645
RP11-130B18	 1	20	 1		NA	NA	NA
RP11-192J8	 1	21	 1	01	118214732	118215022	118214877
RP11-105E14	 1	22	 1	01	142963201	143125095	143044148
RP11-71L20	 1	23	 1	01	148093425	148238405	148165915
RP11-137M19	 1	24	 1	01	155878272	156013976	155946124
RP11-90K5	 1	25	 1	02	147516654	147680156	147598405
RP11-90O3	 1	 1	 2	02	209613836	209775939	209694887
RP11-90J9	 1	 2	 2	02	100715498	100878157	100796827
RP11-91F23	 1	 3	 2	02	 77252173	 77411800	 77331986
RP11-91L3	 1	 4	 2	02	171871854	172030977	171951415
RP11-91N7	 1	 5	 2	02	130018504	130193883	130106193
RP11-91C14	 1	 6	 2	02	230698105	230854329	230776217
RP11-91C22	 1	 7	 2	02	115940761	116121071	116030916
RP11-91G10	 1	 8	 2	02	119505080	119703340	119604210
RP11-200F14_2	 1	 9	 2	02	  6608798	  6609100	  6608949
RP11-87J7_2	 1	10	 2	02	 10494129	 10494340	 10494234
RP11-71J7_2	 1	11	 2	02	 31327626	 31515961	 31421793
RP11-8C18_2	 1	12	 2	02	105912073	106042073	105977073
RP11-218F21_2	 1	13	 2	02	112714665	112714965	112714815
RP11-1L22_2	 1	14	 2	02	133003528	133183138	133093333
RP11-119N3_2	 1	15	 2	02	137321669	137484246	137402957
RP11-67J2_2	 1	16	 2	02	145247715	145410543	145329129
RP11-13C20_2	 1	17	 2	02	151506658	151636658	151571658
RP11-225L15_2	 1	18	 2	02	207216188	207216506	207216347
RP11-53G6_2	 1	19	 2	02	220617776	220618102	220617939
RP11-247E23_2	 1	20	 2	02	223503065	223633065	223568065
RP11-188B21_2	 1	21	 2	02	233533279	233533666	233533472
RP11-176L22_2	 1	22	 2	02	233261162	233411463	233336312
RP11-21K1_2	 1	23	 2	02	235359842	235560352	235460097
RP11-14N24	 1	24	 2	04	131050236	131221437	131135836
RP11-53C1	 1	25	 2	04	139539118	139669118	139604118
RP11-94J9	 1	 1	 3	04	134472730	134624523	134548626
RP11-26D15	 1	 2	 3	04	141088482	141088687	141088584
RP11-89I24_1	 1	 3	 3	04	140215007	140355384	140285195
RP11-5K16	 1	 4	 3	04	141804542	141970884	141887713
RP11-139E16	 1	 5	 3	04	152504191	152672713	152588452
RP11-73G16	 1	 6	 3	04	153185832	153386551	153286191
RP11-119B13_2	 1	 7	 3	04	154907191	155056506	154981848
RP11-84M15_2	 1	 8	 3	04	155606072	155696244	155651158
RP11-90K3	 1	 9	 3	04	157806979	157981161	157894070
RP11-231J7	 1	10	 3	04	158509491	158639491	158574491
RP11-119J20_2	 1	11	 3	04	173378777	173548334	173463555
RP11-110O14	 1	12	 3	04	174631197	174819435	174725316
RP11-140M13	 1	13	 3	04	178969859	179135979	179052919
RP11-78A18	 1	14	 3	10	123408484	123567566	123488025
RP11-177D19	 1	15	 3	04	179453819	179583819	179518819
RP11-279J22	 1	16	 3	04	182126407	182256407	182191407
RP11-203L17	 1	17	 3	04	186644649	186788298	186716473
RP11-213A19	 1	18	 3	04	187496517	187657800	187577158
RP11-262I1	 1	19	 3	04	187382661	187519098	187450879
RP11-178C12	 1	20	 3	04	187883253	187883563	187883408
RP11-194A21	 1	21	 3	04	190081221	190081531	190081376
CTD-2151I22	 1	22	 3	04	 47975175	 48078702	 48026938
RP11-284E1	 1	23	 3	06	 53823776	 53824135	 53823955
RP11-146B10	 1	24	 3	06	 55286965	 55416965	 55351965
RP11-277K21	 1	25	 3	06	 64152187	 64152526	 64152356
RP11-2M9	 1	 1	 4	06	 71773310	 71937123	 71855216
RP11-28P18	 1	 2	 4	06	 75016060	 75175127	 75095593
RP11-44C7	 1	 3	 4	06	 84686114	 84686494	 84686304
RP11-171J20	 1	 4	 4	06	118309615	118309974	118309794
RP11-24F12	 1	 5	 4	06	115387632	115536550	115462091
RP11-28K19	 1	 6	 4	06	119490519	119669016	119579767
RP11-59D10	 1	 7	 4	06	120850055	121030474	120940264
RP11-12C21	 1	 8	 4	06	125434156	125434508	125434332
RP11-139O22	 1	 9	 4	06	131661838	131824949	131743393
CTD-2104E23	 1	10	 4	06	 24516606	 24646606	 24581606
RP11-79G3	 1	11	 4	06	 85101717	 85276297	 85189007
RP11-79I1	 1	12	 4	06	 33123932	 33253932	 33188932
RP11-79J23	 1	13	 4	06	 34858550	 35001765	 34930157
RP11-79C16	 1	14	 4	06	  9462760	  9646352	  9554556
RP11-79G12	 1	15	 4	06	 44649064	 44815783	 44732423
RP11-79L3	 1	16	 4	06	 12534760	 12683918	 12609339
RP11-79L15	 1	17	 4	06	 78576155	 78750684	 78663419
RP11-80L16	 1	18	 4	06	 67140845	 67270845	 67205845
RP11-81F7	 1	19	 4	06	 43872289	 44037150	 43954719
RP11-88B24	 1	20	 4	06	159454947	159626202	159540574
RP11-88H8	 1	21	 4	06	102875955	103063942	102969948
RP11-65J24	 1	22	 4	08	 76806925	 76936925	 76871925
RP11-117N14	 1	23	 4	08	 74754218	 74913326	 74833772
RP11-93J13	 1	24	 4	08	 78120972	 78298633	 78209802
RP11-195P3	 1	25	 4	08	 80321858	 80451858	 80386858
RP11-80C11	 1	 1	 5	08	 82276812	 82420044	 82348428
RP11-3J21	 1	 2	 5	08	 93160310	 93308385	 93234347
RP11-229L23	 1	 3	 5	08	125634080	125646244	125640162
RP11-142P5	 1	 4	 5	08	126655187	126818105	126736646
RP11-145G10	 1	 5	 5	08	128612329	128612662	128612495
RP11-227F7	 1	 6	 5	08	131125876	131126185	131126030
RP11-184M21	 1	 7	 5	08	134076075	134219266	134147670
RP11-189E11	 1	 8	 5	08	135275350	135405350	135340350
RP11-79C18	 1	 9	 5	08	110867345	111034993	110951169
RP11-79G22	 1	10	 5	08	 70420100	 70592979	 70506539
RP11-79F7	 1	11	 5	08	107820463	107973244	107896853
RP11-79H23_1	 1	12	 5	08	 79784798	 79950902	 79867850
RP11-79J9	 1	13	 5	08	104732281	104899546	104815913
RP11-80F24	 1	14	 5	08	 78697706	 78850615	 78774160
RP11-89K10	 1	15	 5	08	127636646	127799456	127718051
RP11-89M20	 1	16	 5	08	 35973575	 36172217	 36072896
RP11-89H1	 1	17	 5	08	 77816701	 77969743	 77893222
RP11-89P9	 1	18	 5	08	125709031	125866269	125787650
RP11-89P19	 1	19	 5	08	119107247	119260516	119183881
RP11-90G23	 1	20	 5	08	 86745316	 86900084	 86822700
RP11-101J13	 1	21	 5	10	106042573	106198260	106120416
RP11-128H11	 1	22	 5	10	107510663	107511002	107510832
RP11-49H17	 1	23	 5	10	109092539	109275992	109184265
RP11-3G2	 1	24	 5	10	111115012	111257771	111186391
RP11-182P7	 1	25	 5	10	111869168	111869510	111869339
RP11-31O24	 1	 1	 6	10	114511397	114511748	114511572
RP11-162A23	 1	 2	 6	10	124795479	124978916	124887197
RP11-5M6	 1	 3	 6	10	126664844	126665243	126665043
RP11-16P8	 1	 4	 6	10	128180749	128326334	128253541
RP11-42K2	 1	 5	 6	10	129210994	129365276	129288135
RP11-48A2	 1	 6	 6	10	129686061	129851191	129768626
RP11-35C24	 1	 7	 6	10	134299489	134299794	134299641
RP11-79M9	 1	 8	 6	10	 77718483	 77873148	 77795815
RP11-79M19	 1	 9	 6	10	120971958	121130800	121051379
RP11-79C22	 1	10	 6	10	  7344843	  7501356	  7423099
RP11-79D7	 1	11	 6	10	 26714040	 26871562	 26792801
RP11-79H15	 1	12	 6	10	 62550598	 62706766	 62628682
RP11-80D10	 1	13	 6	10	  2621298	  2772533	  2696915
RP11-89D1	 1	14	 6	10	 27245816	 27301872	 27273844
RP11-89J3	 1	15	 6	10	  4036843	  4229881	  4133362
RP11-89J6	 1	16	 6	10	 23631726	 23761726	 23696726
RP11-90E17	 1	17	 6	10	 63955366	 64119462	 64037414
RP11-90B19	 1	18	 6	10	131365090	131534266	131449678
RP11-90D9	 1	19	 6	10	 76138287	 76303495	 76220891
RP11-16M7	 1	20	 6	12	 63300097	 63460890	 63380493
RP11-109L8	 1	21	 6	12	 65016040	 65016412	 65016226
RP11-5J6	 1	22	 6	12	 66705892	 66882015	 66793953
RP11-56G10	 1	23	 6	12	 73193532	 73335540	 73264536
RP11-96F19	 1	24	 6	12	 75751877	 75929524	 75840700
RP11-114G18	 1	25	 6	12	 80359308	 80542456	 80450882
RP11-18J7	 1	 1	 7	12	100203407	100203755	100203581
RP11-74J4	 1	 2	 7	12	 27911336	 28041336	 27976336
RP11-83G24	 1	 3	 7	12	103738957	103739284	103739120
RP11-3E7	 1	 4	 7	12	105578303	105579711	105579007
RP11-141F8	 1	 5	 7	12	105025090	105210456	105117773
RP11-138G1	 1	 6	 7	12	108239372	108369372	108304372
RP11-79K8	 1	 7	 7	12	 96873548	 97050927	 96962237
RP11-79B17	 1	 8	 7	12	 85746724	 85924714	 85835719
RP11-80D18	 1	 9	 7	12	 60508425	 60652543	 60580484
RP11-81D15	 1	10	 7	12	 97184455	 97349757	 97267106
RP11-81H17	 1	11	 7	12	 88373646	 88557615	 88465630
RP11-88D16	 1	12	 7	12	  3295577	  3473577	  3384577
RP11-90E9	 1	13	 7	12	 97654948	 97828493	 97741720
RP11-90D13	 1	14	 7	12	110966984	111143652	111055318
RP11-90H7	 1	15	 7	12	 30461853	 30640667	 30551260
RP11-90I23	 1	16	 7	12	 98001054	 98165571	 98083312
RP11-90N7	 1	17	 7	12	 11321259	 11480343	 11400801
RP11-91B1	 1	18	 7	12	127573996	127703996	127638996
RP11-7P8	 1	19	 7	15	 77001166	 77001503	 77001334
RP11-60J21	 1	20	 7	15	 78566480	 78736343	 78651411
RP11-68P22	 1	21	 7	15	 82874917	 83034380	 82954648
RP11-116L7	 1	22	 7	15	 83671081	 83830509	 83750795
RP11-131K19	 1	23	 7	15	 85959354	 85959587	 85959470
RP11-57P19	 1	24	 7	15	 92786171	 92985799	 92885985
RP11-79J15	 1	25	 7	15	 58407071	 58555838	 58481454
RP11-79O13	 1	 1	 8	15	 41373464	 41536588	 41455026
RP11-80H14	 1	 2	 8	15	 20406973	 20536973	 20471973
RP11-80N16	 1	 3	 8	15	 53535622	 53690603	 53613112
RP11-81J11	 1	 4	 8	15	 32555943	 32714490	 32635216
RP11-81N9	 1	 5	 8	15	 31693555	 31848963	 31771259
RP11-91E10	 1	 6	 8	15	 86312118	 86472154	 86392136
RP11-24M13	 1	 7	 8	16	  8078793	  8240986	  8159889
RP11-51P23	 1	 8	 8	16	  8655342	  8785342	  8720342
RP11-51O5	 1	 9	 8	16	  9648974	  9815267	  9732120
RP11-49M6	 1	10	 8	16	 11549348	 11549689	 11549518
RP11-170O16	 1	11	 8	16	 12717842	 12718226	 12718034
RP11-61I15	 1	12	 8	16	 53821998	 53984819	 53903408
RP11-109J21	 1	13	 8	16	 54786913	 54962800	 54874856
RP11-132M21	 1	14	 8	16	 56749375	 56751528	 56750451
RP11-246M14	 1	15	 8	16	 59250997	 59380997	 59315997
RP11-110A13	 1	16	 8	16	 60811618	 60961494	 60886556
RP11-25K3	 1	17	 8	16	 62918968	 63074498	 62996733
RP11-89P20	 1	18	 8	19	 57626929	 57756929	 57691929
RP11-91L5	 1	19	 8	19	 19747489	 19877489	 19812489
RP11-451E20	 1	20	 8	19	 16258566	 16424349	 16341457
RP11-622A12	 1	21	 8	19	 14986365	 15116365	 15051365
RP11-24E15	 1	22	 8	20	   427419	   557419	   492419
RP11-153M12	 1	23	 8	20	   893801	  1085086	   989443
RP11-287E11	 1	24	 8	20	 11471794	 11472027	 11471910
RP11-134G22	 1	25	 8	20	 15121444	 15251444	 15186444
RP11-65G18	 1	 1	 9	20	 15271769	 15401769	 15336769
RP11-16N16	 1	 2	 9	20	 16895224	 17041670	 16968447
RP11-110C10	 1	 3	 9	20	 18138676	 18293440	 18216058
RP11-77C2	 1	 4	 9	20	 23046120	 23176120	 23111120
RP11-17F3	 1	 5	 9	20	 40108403	 40290980	 40199691
RP11-29H19	 1	 6	 9	20	 41956477	 42086477	 42021477
RP11-30F23	 1	 7	 9	20	 42577940	 42755184	 42666562
RP11-75C17	 1	 8	 9	20	 44373450	 44550339	 44461894
RP11-51K19	 1	 9	 9	20	 46708206	 46838206	 46773206
RP11-72F10	 1	10	 9	20	 48468540	 48598540	 48533540
CTD-2163H11	 1	11	 9	20	  1216145	  1366233	  1291189
RP11-79E16	 1	12	 9	20	  8537585	  8704168	  8620876
RP11-79G10	 1	13	 9	20	 38517477	 38678165	 38597821
RP11-80N12	 1	14	 9	20	 16723470	 16896316	 16809893
RP11-88P14	 1	15	 9	20	 12157185	 12314383	 12235784
RP11-89J18	 1	16	 9	20	 23018358	 23148358	 23083358
RP11-67N18	 1	17	 9	15	 63276823	 63454934	 63365878
RP11-69I8	 1	18	 9	06	132249162	132410700	132329931
RP11-69L16	 1	19	 9	06	  7184567	  7351773	  7268170
RP11-74E23	 1	20	 9	16	 29550781	 29724963	 29637872
RP11-79H23_2	 1	21	 9	08	 79784798	 79950902	 79867850
RP11-81F3_2	 1	22	 9	02	 86778860	 86947122	 86862991
RP11-93F3	 1	23	 9	06	 32985079	 33166882	 33075980
RP11-94L15	 1	24	 9	17	 35065334	 35227135	 35146234
RP11-96A1	 1	25	 9	04	121207825	121383454	121295639
RP11-97L2	 1	 1	10	05	 73817310	 73968588	 73892949
RP11-98L5	 1	 2	10	09	135676587	135849288	135762937
RP11-100G15	 1	 3	10	09	 91902880	 92097996	 92000438
RP11-115K6	 1	 4	10	01	236204361	236383330	236293845
RP11-117B7	 1	 5	10	12	107893211	107995711	107944461
RP11-117J13	 1	 6	10	04	  8218695	  8382648	  8300671
RP11-121A8	 1	 7	10	07	 37991942	 38163758	 38077850
RP11-122C21	 1	 8	10	08	 92904408	 93055796	 92980102
RP11-125I23	 1	 9	10	13	 26843890	 27010031	 26926960
RP11-139D23	 1	10	10	01	148624563	148810010	148717286
RP11-141I24	 1	11	10	14	 76021219	 76198194	 76109706
RP11-142B17	 1	12	10	17	 54021957	 54195763	 54108860
RP11-145A4	 1	13	10	12	 55617592	 55804698	 55711145
RP11-148K1	 1	14	10	07	150117824	150340429	150229126
RP11-149I2	 1	15	10	09	 21899258	 22000413	 21949835
RP11-439A17	 1	16	10	01	120459198	120648737	120553967
RP11-441B20	 1	17	10	15	 22905049	 23073407	 22989228
RP11-442N24	 1	18	10	01	 28627660	 28806550	 28717105
RP11-444A4	 1	19	10	03	 19905910	 20089026	 19997468
RP11-447A21	 1	20	10	03	 52556261	 52743025	 52649643
RP11-452O22	 1	21	10	01	155366507	155496507	155431507
RP11-466A19	 1	22	10	17	 27772334	 27941957	 27857145
RP11-467L20	 1	23	10	11	 61203044	 61391832	 61297438
RP11-468J21	 1	24	10	09	 76003987	 76195837	 76099912
RP11-473C18	 1	25	10	15	 41139954	 41330681	 41235317
RP11-475N22	 1	 1	11	03	129634295	129803878	129719086
RP11-480A20	 1	 2	11	06	161056018	161225228	161140623
RP11-493G17	 1	 3	11	14	 76749117	 76959159	 76854138
RP11-494H5	 1	 4	11	02	 55854375	 56054738	 55954556
RP11-495L18	 1	 5	11	04	 30260074	 30424872	 30342473
RP11-496O3	 1	 6	11	13	 26149371	 26355813	 26252592
RP11-498C11	 1	 7	11	08	 95764729	 95978780	 95871754
RP11-499N1	 1	 8	11	04	 72212731	 72413705	 72313218
RP11-515C16	 1	 9	11	05	139904056	140124593	140014324
RP11-517L23	 1	10	11	01	214875597	215050882	214963239
RP11-520H16	 1	11	11	01	155685992	155866737	155776364
RP11-522G20	 1	12	11	15	 49175520	 49356242	 49265881
RP11-523G16	 1	13	11	07	106082719	106268386	106175552
RP11-525A16	 1	14	11	10	112075319	112275104	112175211
RP11-21M24	 1	15	11	16	 22201600	 22344731	 22273165
RP11-22M5_2	 1	16	11	22	 20564314	 20719548	 20641931
RP11-23E3	 1	17	11	13	 94942979	 95095773	 95019376
RP11-23J16	 1	18	11	03	113048744	113221211	113134977
RP11-24F11	 1	19	11	03	 46359964	 46545403	 46452683
RP11-27I1	 1	20	11	09	120599736	120708912	120654324
RP11-37E23	 1	21	11	13	 31703949	 31870606	 31787277
RP11-42A2	 1	22	11	01	147889452	147893446	147891449
RP11-44B19	 1	23	11	05	148167121	148348907	148258014
RP11-44O1	 1	24	11	18	 12610289	 12811851	 12711070
RP11-48L3	 1	25	11	05	141147064	141277064	141212064
RP11-50D9	 1	 1	12	04	128966573	129133816	129050194
RP11-66L22	 1	 2	12	04	 78804167	 78962136	 78883151
RP11-69M1	 1	 3	12	12	  7987952	  8174285	  8081118
RP11-72J7	 1	 4	12	13	 97465156	 97495769	 97480462
RP11-75L1	 1	 5	12	12	  9728771	  9907378	  9818074
RP11-80H8_2	 1	 6	12	03	144202927	144394401	144298664
RP11-81M8	 1	 7	12	19	  1510575	  1686828	  1598701
RP11-93O14	 1	 8	12	16	 45114468	 45275991	 45195229
RP11-96D1	 1	 9	12	16	 66768170	 66932459	 66850314
RP11-97E23	 1	10	12	13	 28069094	 28199094	 28134094
RP11-101K10	 1	11	12	09	124167653	124330492	124249072
RP11-104H15	 1	12	12	17	  7193986	  7378309	  7286147
RP11-105H19_2	 1	13	12	03	 11245296	 11402240	 11323768
RP11-566E18	 1	14	12	02	216811074	216976009	216893541
RP11-568L16	 1	15	12	19	 50386820	 50563607	 50475213
RP11-570C16	 1	16	12	02	171378206	171571418	171474812
RP11-572K18	 1	17	12	01	159383784	159500824	159442304
RP11-574F21	 1	18	12	01	156996925	157049118	157023021
RP11-582M4	 1	19	12	03	 69088955	 69270158	 69179556
RP11-71C11	 1	20	12	01	184555718	184724137	184639927
RP11-4D2	 1	21	12	Y	  2957346	  2957835	  2957590
RP11-82L3	 1	22	12	Y	 10572771	 10573221	 10572996
RP11-71M14	 1	23	12	Y	 14972336	 15102336	 15037336
RP11-236J18	 1	24	12	Y	 19145805	 19315336	 19230570
RP11-256K9	 1	25	12	Y	 21069127	 21178300	 21123713
RP11-82D16	 1	13	13	01	  2171400	  2171718	  2171559
RP11-111O5	 1	14	13	01	  4418595	  4548595	  4483595
RP11-60J11	 1	15	13	01	  7041726	  7232439	  7137082
RP11-188F7	 1	16	13	01	 12266459	 12266824	 12266641
RP11-219F4	 1	17	13	01	 14774025	 14774291	 14774158
RP11-145C4	 1	18	13	01	 18753014	 18883014	 18818014
RP11-161A11	 1	19	13	01	 34184152	 34348134	 34266143
RP11-118E3	 1	20	13	01	 34886841	 34887196	 34887018
RP11-207P5	 1	21	13	01	 37176445	 37176819	 37176632
RP11-88O2	 1	22	13	01	 42142387	 42272387	 42207387
RP11-253M24	 1	23	13	01	 45426353	 45426660	 45426506
RP11-195G13	 1	24	13	01	 54039750	 54231973	 54135861
RP11-114K16	 1	25	13	01	 75425075	 75597284	 75511179
RP11-198H14	 1	 1	14	01	 78696115	 78696467	 78696291
RP11-89A19	 1	 2	14	01	 80866079	 81035538	 80950808
RP11-78E18	 1	 3	14	01	 82980744	 83149325	 83065034
RP11-246O4	 1	 4	14	01	 82952756	 83112098	 83032427
RP11-125P20	 1	 5	14	01	 88031403	 88194307	 88112855
RP11-72M14	 1	 6	14	01	112869186	112904105	112886645
RP11-130B18	 1	 7	14		NA	NA	NA
RP11-192J8	 1	 8	14	01	118214732	118215022	118214877
RP11-105E14	 1	 9	14	01	142963201	143125095	143044148
RP11-71L20	 1	10	14	01	148093425	148238405	148165915
RP11-137M19	 1	11	14	01	155878272	156013976	155946124
RP11-90K5	 1	12	14	02	147516654	147680156	147598405
RP11-90O3	 1	13	14	02	209613836	209775939	209694887
RP11-90J9	 1	14	14	02	100715498	100878157	100796827
RP11-91F23	 1	15	14	02	 77252173	 77411800	 77331986
RP11-91L3	 1	16	14	02	171871854	172030977	171951415
RP11-91N7	 1	17	14	02	130018504	130193883	130106193
RP11-91C14	 1	18	14	02	230698105	230854329	230776217
RP11-91C22	 1	19	14	02	115940761	116121071	116030916
RP11-91G10	 1	20	14	02	119505080	119703340	119604210
RP11-200F14_2	 1	21	14	02	  6608798	  6609100	  6608949
RP11-87J7_2	 1	22	14	02	 10494129	 10494340	 10494234
RP11-71J7_2	 1	23	14	02	 31327626	 31515961	 31421793
RP11-8C18_2	 1	24	14	02	105912073	106042073	105977073
RP11-218F21_2	 1	25	14	02	112714665	112714965	112714815
RP11-1L22_2	 1	 1	15	02	133003528	133183138	133093333
RP11-119N3_2	 1	 2	15	02	137321669	137484246	137402957
RP11-67J2_2	 1	 3	15	02	145247715	145410543	145329129
RP11-13C20_2	 1	 4	15	02	151506658	151636658	151571658
RP11-225L15_2	 1	 5	15	02	207216188	207216506	207216347
RP11-53G6_2	 1	 6	15	02	220617776	220618102	220617939
RP11-247E23_2	 1	 7	15	02	223503065	223633065	223568065
RP11-188B21_2	 1	 8	15	02	233533279	233533666	233533472
RP11-176L22_2	 1	 9	15	02	233261162	233411463	233336312
RP11-21K1_2	 1	10	15	02	235359842	235560352	235460097
RP11-14N24	 1	11	15	04	131050236	131221437	131135836
RP11-53C1	 1	12	15	04	139539118	139669118	139604118
RP11-94J9	 1	13	15	04	134472730	134624523	134548626
RP11-26D15	 1	14	15	04	141088482	141088687	141088584
RP11-89I24_1	 1	15	15	04	140215007	140355384	140285195
RP11-5K16	 1	16	15	04	141804542	141970884	141887713
RP11-139E16	 1	17	15	04	152504191	152672713	152588452
RP11-73G16	 1	18	15	04	153185832	153386551	153286191
RP11-119B13_2	 1	19	15	04	154907191	155056506	154981848
RP11-84M15_2	 1	20	15	04	155606072	155696244	155651158
RP11-90K3	 1	21	15	04	157806979	157981161	157894070
RP11-231J7	 1	22	15	04	158509491	158639491	158574491
RP11-119J20_2	 1	23	15	04	173378777	173548334	173463555
RP11-110O14	 1	24	15	04	174631197	174819435	174725316
RP11-140M13	 1	25	15	04	178969859	179135979	179052919
RP11-78A18	 1	 1	16	10	123408484	123567566	123488025
RP11-177D19	 1	 2	16	04	179453819	179583819	179518819
RP11-279J22	 1	 3	16	04	182126407	182256407	182191407
RP11-203L17	 1	 4	16	04	186644649	186788298	186716473
RP11-213A19	 1	 5	16	04	187496517	187657800	187577158
RP11-262I1	 1	 6	16	04	187382661	187519098	187450879
RP11-178C12	 1	 7	16	04	187883253	187883563	187883408
RP11-194A21	 1	 8	16	04	190081221	190081531	190081376
CTD-2151I22	 1	 9	16	04	 47975175	 48078702	 48026938
RP11-284E1	 1	10	16	06	 53823776	 53824135	 53823955
RP11-146B10	 1	11	16	06	 55286965	 55416965	 55351965
RP11-277K21	 1	12	16	06	 64152187	 64152526	 64152356
RP11-2M9	 1	13	16	06	 71773310	 71937123	 71855216
RP11-28P18	 1	14	16	06	 75016060	 75175127	 75095593
RP11-44C7	 1	15	16	06	 84686114	 84686494	 84686304
RP11-171J20	 1	16	16	06	118309615	118309974	118309794
RP11-24F12	 1	17	16	06	115387632	115536550	115462091
RP11-28K19	 1	18	16	06	119490519	119669016	119579767
RP11-59D10	 1	19	16	06	120850055	121030474	120940264
RP11-12C21	 1	20	16	06	125434156	125434508	125434332
RP11-139O22	 1	21	16	06	131661838	131824949	131743393
CTD-2104E23	 1	22	16	06	 24516606	 24646606	 24581606
RP11-79G3	 1	23	16	06	 85101717	 85276297	 85189007
RP11-79I1	 1	24	16	06	 33123932	 33253932	 33188932
RP11-79J23	 1	25	16	06	 34858550	 35001765	 34930157
RP11-79C16	 1	 1	17	06	  9462760	  9646352	  9554556
RP11-79G12	 1	 2	17	06	 44649064	 44815783	 44732423
RP11-79L3	 1	 3	17	06	 12534760	 12683918	 12609339
RP11-79L15	 1	 4	17	06	 78576155	 78750684	 78663419
RP11-80L16	 1	 5	17	06	 67140845	 67270845	 67205845
RP11-81F7	 1	 6	17	06	 43872289	 44037150	 43954719
RP11-88B24	 1	 7	17	06	159454947	159626202	159540574
RP11-88H8	 1	 8	17	06	102875955	103063942	102969948
RP11-65J24	 1	 9	17	08	 76806925	 76936925	 76871925
RP11-117N14	 1	10	17	08	 74754218	 74913326	 74833772
RP11-93J13	 1	11	17	08	 78120972	 78298633	 78209802
RP11-195P3	 1	12	17	08	 80321858	 80451858	 80386858
RP11-80C11	 1	13	17	08	 82276812	 82420044	 82348428
RP11-3J21	 1	14	17	08	 93160310	 93308385	 93234347
RP11-229L23	 1	15	17	08	125634080	125646244	125640162
RP11-142P5	 1	16	17	08	126655187	126818105	126736646
RP11-145G10	 1	17	17	08	128612329	128612662	128612495
RP11-227F7	 1	18	17	08	131125876	131126185	131126030
RP11-184M21	 1	19	17	08	134076075	134219266	134147670
RP11-189E11	 1	20	17	08	135275350	135405350	135340350
RP11-79C18	 1	21	17	08	110867345	111034993	110951169
RP11-79G22	 1	22	17	08	 70420100	 70592979	 70506539
RP11-79F7	 1	23	17	08	107820463	107973244	107896853
RP11-79H23_1	 1	24	17	08	 79784798	 79950902	 79867850
RP11-79J9	 1	25	17	08	104732281	104899546	104815913
RP11-80F24	 1	 1	18	08	 78697706	 78850615	 78774160
RP11-89K10	 1	 2	18	08	127636646	127799456	127718051
RP11-89M20	 1	 3	18	08	 35973575	 36172217	 36072896
RP11-89H1	 1	 4	18	08	 77816701	 77969743	 77893222
RP11-89P9	 1	 5	18	08	125709031	125866269	125787650
RP11-89P19	 1	 6	18	08	119107247	119260516	119183881
RP11-90G23	 1	 7	18	08	 86745316	 86900084	 86822700
RP11-101J13	 1	 8	18	10	106042573	106198260	106120416
RP11-128H11	 1	 9	18	10	107510663	107511002	107510832
RP11-49H17	 1	10	18	10	109092539	109275992	109184265
RP11-3G2	 1	11	18	10	111115012	111257771	111186391
RP11-182P7	 1	12	18	10	111869168	111869510	111869339
RP11-31O24	 1	13	18	10	114511397	114511748	114511572
RP11-162A23	 1	14	18	10	124795479	124978916	124887197
RP11-5M6	 1	15	18	10	126664844	126665243	126665043
RP11-16P8	 1	16	18	10	128180749	128326334	128253541
RP11-42K2	 1	17	18	10	129210994	129365276	129288135
RP11-48A2	 1	18	18	10	129686061	129851191	129768626
RP11-35C24	 1	19	18	10	134299489	134299794	134299641
RP11-79M9	 1	20	18	10	 77718483	 77873148	 77795815
RP11-79M19	 1	21	18	10	120971958	121130800	121051379
RP11-79C22	 1	22	18	10	  7344843	  7501356	  7423099
RP11-79D7	 1	23	18	10	 26714040	 26871562	 26792801
RP11-79H15	 1	24	18	10	 62550598	 62706766	 62628682
RP11-80D10	 1	25	18	10	  2621298	  2772533	  2696915
RP11-89D1	 1	 1	19	10	 27245816	 27301872	 27273844
RP11-89J3	 1	 2	19	10	  4036843	  4229881	  4133362
RP11-89J6	 1	 3	19	10	 23631726	 23761726	 23696726
RP11-90E17	 1	 4	19	10	 63955366	 64119462	 64037414
RP11-90B19	 1	 5	19	10	131365090	131534266	131449678
RP11-90D9	 1	 6	19	10	 76138287	 76303495	 76220891
RP11-16M7	 1	 7	19	12	 63300097	 63460890	 63380493
RP11-109L8	 1	 8	19	12	 65016040	 65016412	 65016226
RP11-5J6	 1	 9	19	12	 66705892	 66882015	 66793953
RP11-56G10	 1	10	19	12	 73193532	 73335540	 73264536
RP11-96F19	 1	11	19	12	 75751877	 75929524	 75840700
RP11-114G18	 1	12	19	12	 80359308	 80542456	 80450882
RP11-18J7	 1	13	19	12	100203407	100203755	100203581
RP11-74J4	 1	14	19	12	 27911336	 28041336	 27976336
RP11-83G24	 1	15	19	12	103738957	103739284	103739120
RP11-3E7	 1	16	19	12	105578303	105579711	105579007
RP11-141F8	 1	17	19	12	105025090	105210456	105117773
RP11-138G1	 1	18	19	12	108239372	108369372	108304372
RP11-79K8	 1	19	19	12	 96873548	 97050927	 96962237
RP11-79B17	 1	20	19	12	 85746724	 85924714	 85835719
RP11-80D18	 1	21	19	12	 60508425	 60652543	 60580484
RP11-81D15	 1	22	19	12	 97184455	 97349757	 97267106
RP11-81H17	 1	23	19	12	 88373646	 88557615	 88465630
RP11-88D16	 1	24	19	12	  3295577	  3473577	  3384577
RP11-90E9	 1	25	19	12	 97654948	 97828493	 97741720
RP11-90D13	 1	 1	20	12	110966984	111143652	111055318
RP11-90H7	 1	 2	20	12	 30461853	 30640667	 30551260
RP11-90I23	 1	 3	20	12	 98001054	 98165571	 98083312
RP11-90N7	 1	 4	20	12	 11321259	 11480343	 11400801
RP11-91B1	 1	 5	20	12	127573996	127703996	127638996
RP11-7P8	 1	 6	20	15	 77001166	 77001503	 77001334
RP11-60J21	 1	 7	20	15	 78566480	 78736343	 78651411
RP11-68P22	 1	 8	20	15	 82874917	 83034380	 82954648
RP11-116L7	 1	 9	20	15	 83671081	 83830509	 83750795
RP11-131K19	 1	10	20	15	 85959354	 85959587	 85959470
RP11-57P19	 1	11	20	15	 92786171	 92985799	 92885985
RP11-79J15	 1	12	20	15	 58407071	 58555838	 58481454
RP11-79O13	 1	13	20	15	 41373464	 41536588	 41455026
RP11-80H14	 1	14	20	15	 20406973	 20536973	 20471973
RP11-80N16	 1	15	20	15	 53535622	 53690603	 53613112
RP11-81J11	 1	16	20	15	 32555943	 32714490	 32635216
RP11-81N9	 1	17	20	15	 31693555	 31848963	 31771259
RP11-91E10	 1	18	20	15	 86312118	 86472154	 86392136
RP11-24M13	 1	19	20	16	  8078793	  8240986	  8159889
RP11-51P23	 1	20	20	16	  8655342	  8785342	  8720342
RP11-51O5	 1	21	20	16	  9648974	  9815267	  9732120
RP11-49M6	 1	22	20	16	 11549348	 11549689	 11549518
RP11-170O16	 1	23	20	16	 12717842	 12718226	 12718034
RP11-61I15	 1	24	20	16	 53821998	 53984819	 53903408
RP11-109J21	 1	25	20	16	 54786913	 54962800	 54874856
RP11-132M21	 1	 1	21	16	 56749375	 56751528	 56750451
RP11-246M14	 1	 2	21	16	 59250997	 59380997	 59315997
RP11-110A13	 1	 3	21	16	 60811618	 60961494	 60886556
RP11-25K3	 1	 4	21	16	 62918968	 63074498	 62996733
RP11-89P20	 1	 5	21	19	 57626929	 57756929	 57691929
RP11-91L5	 1	 6	21	19	 19747489	 19877489	 19812489
RP11-451E20	 1	 7	21	19	 16258566	 16424349	 16341457
RP11-622A12	 1	 8	21	19	 14986365	 15116365	 15051365
RP11-24E15	 1	 9	21	20	   427419	   557419	   492419
RP11-153M12	 1	10	21	20	   893801	  1085086	   989443
RP11-287E11	 1	11	21	20	 11471794	 11472027	 11471910
RP11-134G22	 1	12	21	20	 15121444	 15251444	 15186444
RP11-65G18	 1	13	21	20	 15271769	 15401769	 15336769
RP11-16N16	 1	14	21	20	 16895224	 17041670	 16968447
RP11-110C10	 1	15	21	20	 18138676	 18293440	 18216058
RP11-77C2	 1	16	21	20	 23046120	 23176120	 23111120
RP11-17F3	 1	17	21	20	 40108403	 40290980	 40199691
RP11-29H19	 1	18	21	20	 41956477	 42086477	 42021477
RP11-30F23	 1	19	21	20	 42577940	 42755184	 42666562
RP11-75C17	 1	20	21	20	 44373450	 44550339	 44461894
RP11-51K19	 1	21	21	20	 46708206	 46838206	 46773206
RP11-72F10	 1	22	21	20	 48468540	 48598540	 48533540
CTD-2163H11	 1	23	21	20	  1216145	  1366233	  1291189
RP11-79E16	 1	24	21	20	  8537585	  8704168	  8620876
RP11-79G10	 1	25	21	20	 38517477	 38678165	 38597821
RP11-80N12	 1	 1	22	20	 16723470	 16896316	 16809893
RP11-88P14	 1	 2	22	20	 12157185	 12314383	 12235784
RP11-89J18	 1	 3	22	20	 23018358	 23148358	 23083358
RP11-67N18	 1	 4	22	15	 63276823	 63454934	 63365878
RP11-69I8	 1	 5	22	06	132249162	132410700	132329931
RP11-69L16	 1	 6	22	06	  7184567	  7351773	  7268170
RP11-74E23	 1	 7	22	16	 29550781	 29724963	 29637872
RP11-79H23_2	 1	 8	22	08	 79784798	 79950902	 79867850
RP11-81F3_2	 1	 9	22	02	 86778860	 86947122	 86862991
RP11-93F3	 1	10	22	06	 32985079	 33166882	 33075980
RP11-94L15	 1	11	22	17	 35065334	 35227135	 35146234
RP11-96A1	 1	12	22	04	121207825	121383454	121295639
RP11-97L2	 1	13	22	05	 73817310	 73968588	 73892949
RP11-98L5	 1	14	22	09	135676587	135849288	135762937
RP11-100G15	 1	15	22	09	 91902880	 92097996	 92000438
RP11-115K6	 1	16	22	01	236204361	236383330	236293845
RP11-117B7	 1	17	22	12	107893211	107995711	107944461
RP11-117J13	 1	18	22	04	  8218695	  8382648	  8300671
RP11-121A8	 1	19	22	07	 37991942	 38163758	 38077850
RP11-122C21	 1	20	22	08	 92904408	 93055796	 92980102
RP11-125I23	 1	21	22	13	 26843890	 27010031	 26926960
RP11-139D23	 1	22	22	01	148624563	148810010	148717286
RP11-141I24	 1	23	22	14	 76021219	 76198194	 76109706
RP11-142B17	 1	24	22	17	 54021957	 54195763	 54108860
RP11-145A4	 1	25	22	12	 55617592	 55804698	 55711145
RP11-148K1	 1	 1	23	07	150117824	150340429	150229126
RP11-149I2	 1	 2	23	09	 21899258	 22000413	 21949835
RP11-439A17	 1	 3	23	01	120459198	120648737	120553967
RP11-441B20	 1	 4	23	15	 22905049	 23073407	 22989228
RP11-442N24	 1	 5	23	01	 28627660	 28806550	 28717105
RP11-444A4	 1	 6	23	03	 19905910	 20089026	 19997468
RP11-447A21	 1	 7	23	03	 52556261	 52743025	 52649643
RP11-452O22	 1	 8	23	01	155366507	155496507	155431507
RP11-466A19	 1	 9	23	17	 27772334	 27941957	 27857145
RP11-467L20	 1	10	23	11	 61203044	 61391832	 61297438
RP11-468J21	 1	11	23	09	 76003987	 76195837	 76099912
RP11-473C18	 1	12	23	15	 41139954	 41330681	 41235317
RP11-475N22	 1	13	23	03	129634295	129803878	129719086
RP11-480A20	 1	14	23	06	161056018	161225228	161140623
RP11-493G17	 1	15	23	14	 76749117	 76959159	 76854138
RP11-494H5	 1	16	23	02	 55854375	 56054738	 55954556
RP11-495L18	 1	17	23	04	 30260074	 30424872	 30342473
RP11-496O3	 1	18	23	13	 26149371	 26355813	 26252592
RP11-498C11	 1	19	23	08	 95764729	 95978780	 95871754
RP11-499N1	 1	20	23	04	 72212731	 72413705	 72313218
RP11-515C16	 1	21	23	05	139904056	140124593	140014324
RP11-517L23	 1	22	23	01	214875597	215050882	214963239
RP11-520H16	 1	23	23	01	155685992	155866737	155776364
RP11-522G20	 1	24	23	15	 49175520	 49356242	 49265881
RP11-523G16	 1	25	23	07	106082719	106268386	106175552
RP11-525A16	 1	 1	24	10	112075319	112275104	112175211
RP11-21M24	 1	 2	24	16	 22201600	 22344731	 22273165
RP11-22M5_2	 1	 3	24	22	 20564314	 20719548	 20641931
RP11-23E3	 1	 4	24	13	 94942979	 95095773	 95019376
RP11-23J16	 1	 5	24	03	113048744	113221211	113134977
RP11-24F11	 1	 6	24	03	 46359964	 46545403	 46452683
RP11-27I1	 1	 7	24	09	120599736	120708912	120654324
RP11-37E23	 1	 8	24	13	 31703949	 31870606	 31787277
RP11-42A2	 1	 9	24	01	147889452	147893446	147891449
RP11-44B19	 1	10	24	05	148167121	148348907	148258014
RP11-44O1	 1	11	24	18	 12610289	 12811851	 12711070
RP11-48L3	 1	12	24	05	141147064	141277064	141212064
RP11-50D9	 1	13	24	04	128966573	129133816	129050194
RP11-66L22	 1	14	24	04	 78804167	 78962136	 78883151
RP11-69M1	 1	15	24	12	  7987952	  8174285	  8081118
RP11-72J7	 1	16	24	13	 97465156	 97495769	 97480462
RP11-75L1	 1	17	24	12	  9728771	  9907378	  9818074
RP11-80H8_2	 1	18	24	03	144202927	144394401	144298664
RP11-81M8	 1	19	24	19	  1510575	  1686828	  1598701
RP11-93O14	 1	20	24	16	 45114468	 45275991	 45195229
RP11-96D1	 1	21	24	16	 66768170	 66932459	 66850314
RP11-97E23	 1	22	24	13	 28069094	 28199094	 28134094
RP11-101K10	 1	23	24	09	124167653	124330492	124249072
RP11-104H15	 1	24	24	17	  7193986	  7378309	  7286147
RP11-105H19_2	 1	25	24	03	 11245296	 11402240	 11323768
RP11-566E18	 1	 1	25	02	216811074	216976009	216893541
RP11-568L16	 1	 2	25	19	 50386820	 50563607	 50475213
RP11-570C16	 1	 3	25	02	171378206	171571418	171474812
RP11-572K18	 1	 4	25	01	159383784	159500824	159442304
RP11-574F21	 1	 5	25	01	156996925	157049118	157023021
RP11-582M4	 1	 6	25	03	 69088955	 69270158	 69179556
RP11-71C11	 1	 7	25	01	184555718	184724137	184639927
RP11-4D2	 1	 8	25	Y	  2957346	  2957835	  2957590
RP11-82L3	 1	 9	25	Y	 10572771	 10573221	 10572996
RP11-71M14	 1	10	25	Y	 14972336	 15102336	 15037336
RP11-236J18	 1	11	25	Y	 19145805	 19315336	 19230570
RP11-256K9	 1	12	25	Y	 21069127	 21178300	 21123713
RP11-177M16	 2	 1	 1	01	171094173	171274712	171184442
RP11-4J2	 2	 2	 1	01	174019839	174020139	174019989
RP11-196B7	 2	 3	 1	01	179035234	179035571	179035402
RP11-162L13	 2	 4	 1	01	182448508	182622235	182535371
RP11-173E24	 2	 5	 1	01	191987583	192156745	192072164
RP11-249C10	 2	 6	 1	01	196846039	196846425	196846232
RP11-167J2	 2	 7	 1	01	205973604	206131781	206052692
RP11-123O6	 2	 8	 1	01	207793067	207793386	207793226
RP11-193P21	 2	 9	 1	01	209436445	209436790	209436617
RP11-124A11	 2	10	 1	01	212033827	212208007	212120917
RP11-260A10	 2	11	 1	01	213537353	213695637	213616495
RP11-211K12	 2	12	 1	01	215588846	215589140	215588993
CTD-2121F9	 2	13	 1	01	 67865538	 67866025	 67865781
CTD-2146H13	 2	14	 1	01	169235592	169375598	169305595
CTD-2218H7	 2	15	 1	01	202245038	202369242	202307140
RP11-79A13	 2	16	 1	01	 60721931	 60898897	 60810414
RP11-79C3	 2	17	 1	01	 98718601	 98908219	 98813410
RP11-79E17	 2	18	 1	01	167730696	167913876	167822286
RP11-80J4	 2	19	 1	01	193362822	193492822	193427822
RP11-80L8	 2	20	 1	01	161968761	162112834	162040797
RP11-80P14	 2	21	 1	01	234488456	234645981	234567218
RP11-81D13	 2	22	 1	01	 91578441	 91759187	 91668814
RP11-81J1	 2	23	 1		NA	NA	NA
RP11-81J5	 2	24	 1	01	237672842	237851119	237761980
RP11-21P18	 2	25	 1	02	 88109763	 88273220	 88191491
RP11-353M23	 2	 1	 2	11	 57264231	 57434804	 57349517
RP11-129K1	 2	 2	 2	03	  2215033	  2377366	  2296199
RP11-32F23	 2	 3	 2	03	  4016396	  4198468	  4107432
RP11-128A5	 2	 4	 2	03	  8686064	  8857271	  8771667
RP11-271E2	 2	 5	 2	03	 13892339	 14053910	 13973124
RP11-111P21	 2	 6	 2	03	 45315381	 45497977	 45406679
RP11-124O2	 2	 7	 2	03	 54358468	 54511737	 54435102
RP11-39L1	 2	 8	 2	03	 55803937	 55933937	 55868937
RP11-120C2	 2	 9	 2	03	 57297474	 57406992	 57352233
RP11-180G14	 2	10	 2	03	 59538558	 59538883	 59538720
RP11-114P15	 2	11	 2	03	 62473233	 62639806	 62556519
RP11-5K13	 2	12	 2	03	114419497	114596919	114508208
RP11-220G20	 2	13	 2	03	118631102	118777911	118704506
RP11-233L3	 2	14	 2		NA	NA	NA
RP11-217P4	 2	15	 2	03	124525892	124526078	124525985
RP11-205A6	 2	16	 2	03	127354776	127484776	127419776
RP11-220J13	 2	17	 2	03	136799829	136965543	136882686
RP11-198G24	 2	18	 2	03	165289729	165465059	165377394
RP11-24L16	 2	19	 2	03	169692713	169693073	169692893
RP11-151P12	 2	20	 2	03	171644118	171797334	171720726
RP11-196F13	 2	21	 2	03	173653816	173721242	173687529
RP11-148D23	 2	22	 2	03	174848631	175020330	174934480
RP11-118F4	 2	23	 2	03	180910839	181073269	180992054
RP11-79M4	 2	24	 2	04	135890671	136042871	135966771
RP11-79M20	 2	25	 2	04	 90571652	 90737546	 90654599
RP11-80D22	 2	 1	 3	04	 43619912	 43799496	 43709704
RP11-80H22	 2	 2	 3	04	109836650	110003969	109920309
RP11-81J9	 2	 3	 3	04	109950857	110105012	110027934
RP11-81N5	 2	 4	 3	04	 13026621	 13178995	 13102808
RP11-89I8	 2	 5	 3	04	161692409	161842483	161767446
RP11-89K12	 2	 6	 3	04	  6274488	  6444487	  6359487
RP11-89D7	 2	 7	 3	04	175318254	175483211	175400732
RP11-89D13	 2	 8	 3	04	112814271	112982439	112898355
RP11-89H17	 2	 9	 3	04	 17286550	 17457528	 17372039
RP11-89B18	 2	10	 3	04	 56172241	 56302241	 56237241
RP11-90L23	 2	11	 3	04	 42860434	 43031526	 42945980
RP11-91J3	 2	12	 3	04	188660398	188815082	188737740
RP11-91N13	 2	13	 3	04	 16042580	 16204404	 16123492
RP11-91O3	 2	14	 3	04	148054208	148225659	148139933
RP11-91C3	 2	15	 3	04	 60754321	 60915084	 60834702
RP11-91G13	 2	16	 3	04	103315819	103482988	103399403
RP11-58A5	 2	17	 3	05	  4965703	  5123153	  5044428
RP11-36H5	 2	18	 3	05	  6365579	  6533316	  6449447
RP11-145B1	 2	19	 3	05	 10279384	 10446930	 10363157
RP11-29N3	 2	20	 3	05	 11435595	 11435858	 11435726
RP11-135M13	 2	21	 3	05	 15627305	 15781105	 15704205
RP11-269O14	 2	22	 3	05	 16684131	 16684506	 16684318
RP11-90M17	 2	23	 3	06	 17954872	 18121480	 18038176
RP11-90P11	 2	24	 3	06	  1766631	  1938509	  1852570
RP11-91F13	 2	25	 3	06	  3911097	  4084546	  3997821
RP11-91N3	 2	 1	 4	06	 16653505	 16813403	 16733454
RP11-91O16	 2	 2	 4	06	167558159	167725815	167641987
RP11-91E11	 2	 3	 4	06	 37388210	 37581751	 37484980
RP11-161C7	 2	 4	 4	07	  6215991	  6396697	  6306344
RP11-123E5	 2	 5	 4	07	 17330359	 17526398	 17428378
RP11-70K3	 2	 6	 4	07	 18147213	 18277213	 18212213
RP11-49N21	 2	 7	 4	07	 19755900	 19756301	 19756100
RP11-160L16	 2	 8	 4	07	 22573519	 22737277	 22655398
RP11-17H7	 2	 9	 4	07	 27945126	 28115239	 28030182
RP11-3L22	 2	10	 4	07	 40625167	 40778748	 40701957
RP11-70D20	 2	11	 4	07	 41198124	 41198388	 41198256
RP11-141P12	 2	12	 4	07	 42860676	 43024732	 42942704
RP11-112B7	 2	13	 4	07	 44109429	 44282948	 44196188
RP11-109N2	 2	14	 4	07	 45824384	 46020556	 45922470
RP11-11D14	 2	15	 4	07	 47375651	 47505651	 47440651
RP11-114E12	 2	16	 4	07	 67843676	 68014926	 67929301
RP11-96O16	 2	17	 4	07	 69021654	 69203894	 69112774
RP11-193J17	 2	18	 4	07	 71178377	 71178710	 71178543
RP11-35H4	 2	19	 4	07	 77282649	 77438175	 77360412
RP11-219N12	 2	20	 4	07	 79491460	 79491755	 79491607
RP11-22M18	 2	21	 4	07	 84188365	 84356324	 84272344
RP11-91P17	 2	22	 4	08	 79158449	 79305261	 79231855
RP11-91M23	 2	23	 4	08	125876592	126073860	125975226
RP11-91I20_1	 2	24	 4	08	 61578650	 61769195	 61673922
RP11-91G3	 2	25	 4	08	 91135433	 91294047	 91214740
RP11-451O18	 2	 1	 5	08	 33148263	 33325914	 33237088
RP11-28N6	 2	 2	 5	09	  1301297	  1488481	  1394889
RP11-26H17	 2	 3	 5		NA	NA	NA
RP11-132G20	 2	 4	 5	09	 15858419	 15858778	 15858598
RP11-33O15	 2	 5	 5	09	 22823086	 22953086	 22888086
RP11-55P9	 2	 6	 5	09	 25425786	 25573596	 25499691
RP11-70F16	 2	 7	 5	09	 31034743	 31177453	 31106098
RP11-52I10	 2	 8	 5	09	 31664296	 31833576	 31748936
RP11-44J18	 2	 9	 5	09	 69815612	 69969615	 69892613
RP11-8L13	 2	10	 5	09	 71152731	 71320859	 71236795
RP11-74E13	 2	11	 5	09	122708810	122838810	122773810
RP11-57N18	 2	12	 5	09	 75211878	 75384409	 75298143
RP11-56C1	 2	13	 5	09	 77229325	 77229539	 77229432
RP11-14J9	 2	14	 5	09	 74876823	 75006823	 74941823
RP11-105E2	 2	15	 5	09	 88982212	 89143277	 89062744
RP11-9I18	 2	16	 5	09	 90362231	 90492231	 90427231
RP11-44O3	 2	17	 5	09	 91304426	 91434426	 91369426
RP11-95D9	 2	18	 5	09	 92195904	 92325904	 92260904
RP11-54O15	 2	19	 5	09	 94745039	 94920987	 94833013
RP11-106O17	 2	20	 5	09	 94882444	 94882881	 94882662
RP11-91I1	 2	21	 5	10	 61895574	 62056416	 61975995
RP11-91M16	 2	22	 5	10	 92885729	 93028583	 92957156
RP11-91A23	 2	23	 5	10	 28589861	 28775774	 28682817
RP11-91A6	 2	24	 5	10	103405193	103535193	103470193
RP11-91C16	 2	25	 5	10	  4220613	  4378721	  4299667
RP11-91G16	 2	 1	 6	06	137329380	137459380	137394380
RP11-170H2	 2	 2	 6	11	 12608554	 12781974	 12695264
RP11-72L17	 2	 3	 6	11	 14366764	 14496764	 14431764
RP11-7O20	 2	 4	 6	11	 14830546	 14997983	 14914264
RP11-166E15	 2	 5	 6	11	 17122028	 17286229	 17204128
RP11-199K11	 2	 6	 6	11	 19375490	 19375619	 19375554
RP11-80B10	 2	 7	 6	11	 19227077	 19402989	 19315033
RP11-127K23	 2	 8	 6	11	 33260859	 33321511	 33291185
RP11-283O4	 2	 9	 6	11	 33686931	 33687085	 33687008
RP11-145B20	 2	10	 6	11	 35233053	 35369679	 35301366
RP11-36H11	 2	11	 6	11	 36353272	 36513773	 36433522
RP11-72A10	 2	12	 6	11	 36733001	 36906432	 36819716
RP11-34F8	 2	13	 6	11	 40879124	 41048960	 40964042
RP11-135H8	 2	14	 6	11	 56357374	 56507045	 56432209
RP11-77M17	 2	15	 6	11	 57109511	 57277679	 57193595
RP11-205I14	 2	16	 6	11	 59220883	 59439636	 59330259
RP11-35F11	 2	17	 6	11	 62933911	 63103603	 63018757
RP11-9K14	 2	18	 6	11	 65029026	 65185268	 65107147
RP11-160L9	 2	19	 6	11	 67030556	 67191077	 67110816
RP11-449D7	 2	20	 6	12	101911158	101922431	101916794
RP11-91I24	 2	21	 6	12	 82150704	 82311687	 82231195
RP11-8C15	 2	22	 6	13	 20985475	 21115475	 21050475
RP11-18F22	 2	23	 6	13	 24477260	 24607260	 24542260
RP11-31H2	 2	24	 6	13	 24064249	 24194249	 24129249
RP11-85P8	 2	25	 6	13	 27475788	 27476188	 27475988
RP11-52B21	 2	 1	 7	13	 46118238	 46284283	 46201260
RP11-54G17	 2	 2	 7	13	 48803580	 48933580	 48868580
RP11-16F6	 2	 3	 7	13	 52042913	 52195294	 52119103
RP11-234M13	 2	 4	 7	13	 55405818	 55406206	 55406012
RP11-37I8	 2	 5	 7	13	 63926453	 64056453	 63991453
RP11-94F7	 2	 6	 7	13	 72204333	 72369394	 72286863
RP11-165N12	 2	 7	 7	13	 91819115	 91979519	 91899317
RP11-40H10	 2	 8	 7	13	 94359632	 94360015	 94359823
RP11-19J14	 2	 9	 7	13	 97851594	 97851757	 97851675
RP11-23M9	 2	10	 7	13	 98762177	 98923852	 98843014
RP11-7B23	 2	11	 7	13	101030160	101195607	101112883
RP11-86B6	 2	12	 7	13	104021213	104021449	104021331
RP11-79A16	 2	13	 7	13	 95390242	 95551839	 95471040
RP11-79D3	 2	14	 7	13	 62021605	 62151605	 62086605
RP11-80B16	 2	15	 7	13	 92949384	 93116618	 93033001
RP11-80J14	 2	16	 7	13	 24139393	 24325716	 24232554
RP11-80P22	 2	17	 7	13	 86580304	 86747749	 86664026
RP11-81D19	 2	18	 7	13	 57461809	 57618141	 57539975
RP11-230E8	 2	19	 7	16	 70159145	 70159547	 70159346
RP11-27D1	 2	20	 7	16	 73885123	 73885373	 73885248
RP11-217K3	 2	21	 7	16	 75074528	 75074903	 75074715
RP11-61L1	 2	22	 7	16	 77215302	 77345302	 77280302
RP11-178P16	 2	23	 7	16	 80934454	 81098865	 81016659
RP11-223I9	 2	24	 7	16	 81468847	 81469169	 81469008
RP11-79A1	 2	25	 7	16	 88125791	 88297483	 88211637
RP11-79E10	 2	 1	 8	16	 51112187	 51264162	 51188174
RP11-7D23_2	 2	 2	 8	16	 88297301	 88465228	 88381264
RP11-79I15	 2	 3	 8	16	 16650372	 16820872	 16735622
RP11-80H6	 2	 4	 8	16	 83219109	 83379313	 83299211
RP11-81F1	 2	 5	 8	16	 11237046	 11408969	 11323007
RP11-90J5	 2	 6	 8	16	 81539093	 81684867	 81611980
RP11-91H21	 2	 7	 8	02	173608959	173738959	173673959
RP11-91A22	 2	 8	 8	16	 45078235	 45249589	 45163912
CTA-485G10	 2	 9	 8	16	 26687675	 26823021	 26755348
CTA-530H11	 2	10	 8	16	 17685143	 17817504	 17751323
CTA-670B5	 2	11	 8	16	 27322544	 27454073	 27388308
RP11-520B23_1	 2	12	 8	16	 11716267	 11875890	 11796078
RP11-67I13	 2	13	 8	16	 50922223	 51084845	 51003534
RP11-26N16	 2	14	 8	17	   836330	  1008128	   922229
RP11-4F24	 2	15	 8	17	  1704706	  1705051	  1704878
RP11-208J12	 2	16	 8	17	  3394448	  3545832	  3470140
RP11-9A21	 2	17	 8	17	  7411115	  7541115	  7476115
RP11-451O20	 2	18	 8	20	 13144773	 13274773	 13209773
RP11-61A21	 2	19	 8	21	 15300085	 15453714	 15376899
RP11-31B6_2	 2	20	 8	21	 14998564	 15152259	 15075411
RP11-143A3	 2	21	 8	21	 18244635	 18244913	 18244774
RP11-49J9	 2	22	 8	21	 20982315	 21153633	 21067974
RP11-48F12	 2	23	 8	21	 22054521	 22201310	 22127915
RP11-32A2	 2	24	 8	21	 29767530	 29921601	 29844565
RP11-61G3	 2	25	 8	21	 31102834	 31232834	 31167834
RP11-191I6	 2	 1	 9	21	 31455116	 31455428	 31455272
RP11-5N20	 2	 2	 9	21	 31578099	 31736757	 31657428
RP11-276A17	 2	 3	 9	21	 31409492	 31455428	 31432460
RP11-8P19	 2	 4	 9	21	 34529859	 34737015	 34633437
RP11-79G23	 2	 5	 9	21	 29260484	 29450968	 29355726
RP11-79D9	 2	 6	 9	21	 33204656	 33369197	 33286926
RP11-88D18	 2	 7	 9	21	 25400598	 25568510	 25484554
RP11-89C22	 2	 8	 9	21	 25710762	 25895261	 25803011
RP11-89H5	 2	 9	 9	21	 28964173	 29115129	 29039651
RP11-89H16	 2	10	 9	21	 15062606	 15062997	 15062801
RP11-213L15	 2	11	 9	22	 27825879	 27826212	 27826045
RP11-5I24	 2	12	 9	22	 31998945	 31999257	 31999101
RP11-125J19	 2	13	 9	22	 33461081	 33461260	 33461170
RP11-105I18	 2	14	 9	22	 34951350	 35112595	 35031972
RP11-235O23	 2	15	 9	22	 36706132	 36706446	 36706289
RP11-4H24	 2	16	 9	22	 38706685	 38707024	 38706854
RP11-168O10	 2	17	 9	10	 91121511	 91265490	 91193500
RP11-169K17	 2	18	 9	03	 11524156	 11688746	 11606451
RP11-169N13_2	 2	19	 9	03	120926479	121091572	121009025
RP11-174I10	 2	20	 9	13	 47897821	 47960646	 47929233
RP11-175A7	 2	21	 9	02	 70222436	 70400431	 70311433
RP11-178G16	 2	22	 9	10	 75506962	 75611618	 75559290
RP11-197O4	 2	23	 9	19	 10248852	 10410630	 10329741
RP11-201P10	 2	24	 9	15	 34748790	 34912124	 34830457
RP11-203M2	 2	25	 9	09	132223828	132419564	132321696
RP11-204J18	 2	 1	10	03	 62190611	 62347194	 62268902
RP11-204N9	 2	 2	10	13	 57108112	 57238112	 57173112
RP11-205M9	 2	 3	10	01	150938154	151057614	150997884
RP11-216P6	 2	 4	10	17	   802249	  1008155	   905202
RP11-223F11	 2	 5	10	01	159417716	159576162	159496939
RP11-228B15	 2	 6	10	09	127589858	127670500	127630179
RP11-229O3	 2	 7	10	16	 63462866	 63616454	 63539660
RP11-231C18	 2	 8	10	04	 54968262	 55100426	 55034344
RP11-231G16	 2	 9	10	17	  3515829	  3716750	  3616289
RP11-252A24	 2	10	10	16	 72892287	 73055707	 72973997
RP11-255N19	 2	11	10	02	 38787976	 38899493	 38843734
RP11-258P13	 2	12	10	11	  3785609	  3953103	  3869356
RP11-260K18	 2	13	10	04	 47934140	 48092941	 48013540
RP11-262H5	 2	14	10	01	211134056	211310076	211222066
RP11-263P6	 2	15	10	20	 32208031	 32395368	 32301699
RP11-540B6	 2	16	10	15	 28869060	 29060466	 28964763
RP11-541M12	 2	17	10	10	 49230232	 49437150	 49333691
RP11-544B14	 2	18	10	01	203219764	203408496	203314130
RP11-547D13	 2	19	10	15	 53154630	 53329906	 53242268
RP11-548B6	 2	20	10	16	 23579108	 23730736	 23654922
RP11-550P17	 2	21	10	01	156029037	156197376	156113206
RP11-570L13	 2	22	10	04	 85828816	 86011586	 85920201
RP11-572O17	 2	23	10	04	  1592781	  1782006	  1687393
RP11-575C6	 2	24	10	02	201926548	202107698	202017123
RP11-576P2	 2	25	10	14	 22008203	 22195500	 22101851
RP11-593H15	 2	 1	11	07	121179788	121338858	121259323
RP11-597P9	 2	 2	11	04	187880154	188048172	187964163
RP11-622A14	 2	 3	11	03	  4916593	  5125970	  5021281
RP11-627P22	 2	 4	11	07	 26729921	 26830664	 26780292
RP11-629J17	 2	 5	11	06	 32683027	 32798351	 32740689
RP11-638A9	 2	 6	11	07	 86539140	 86669140	 86604140
RP11-644F5	 2	 7	11	12	 54224698	 54417248	 54320973
RP11-649M10	 2	 8	11	11	113637868	113816513	113727190
RP11-678D20	 2	 9	11	11	 66847435	 67013794	 66930614
RP11-680A11	 2	10	11	12	 51954287	 52060838	 52007562
RP11-683E17	 2	11	11	18	  8438642	  8622616	  8530629
RP11-686G6	 2	12	11	11	102129478	102315567	102222522
RP11-687L3	 2	13	11	06	107418523	107556329	107487426
RP11-692D12	 2	14	11	04	 74333651	 74566904	 74450277
RP11-119E13	 2	15	11	03	187916513	188068880	187992696
RP11-122K13_2	 2	16	11	10	134947600	135111183	135029391
RP11-124A7	 2	17	11	04	 41071067	 41249104	 41160085
RP11-125E8_2	 2	18	11	03	185459125	185625829	185542477
RP11-126L4	 2	19	11	03	 12025484	 12189344	 12107414
RP11-130C19	 2	20	11	09	   615147	   812246	   713696
RP11-158K18	 2	21	11	11	120633747	120813353	120723550
RP11-163K17	 2	22	11	04	104233375	104414925	104324150
RP11-164A4	 2	23	11	05	112385104	112548750	112466927
RP11-165H20	 2	24	11	01	111426345	111597595	111511970
RP11-165P4	 2	25	11	09	120891077	121069478	120980277
RP11-169D4	 2	 1	12	11	 71870379	 72068557	 71969468
RP11-190F19	 2	 2	12	10	115235472	115423821	115329646
RP11-196G18	 2	 3	12	01	146522913	146711869	146617391
RP11-202A21	 2	 4	12	03	  8555740	  8727458	  8641599
RP11-206N2	 2	 5	12	05	 76128363	 76330345	 76229354
RP11-211G3	 2	 6	12	03	188858118	188983514	188920816
RP11-211P13	 2	 7	12	03	191651341	191835543	191743442
RP11-242O24	 2	 8	12	01	 29125256	 29323720	 29224488
RP11-248G5	 2	 9	12	13	 51453674	 51641365	 51547519
RP11-252I14	 2	10	12	05	179467083	179662550	179564816
RP11-254B13	 2	11	12	12	 67207034	 67347334	 67277184
RP11-255E21	 2	12	12	13	 78696702	 78862028	 78779365
RP11-259K5	 2	13	12	03	 37197462	 37384589	 37291025
RP11-587D21	 2	14	12	11	 27557494	 27736319	 27646906
RP11-592G13	 2	15	12	02	112461168	112584350	112522759
RP11-597P14	 2	16	12	02	138788716	138963349	138876032
RP11-601N4	 2	17	12	02	 88864752	 89041307	 88953029
RP11-605F20	 2	18	12	17	 36092356	 36260510	 36176433
RP11-622P13	 2	19	12	07	 72446701	 72625924	 72536312
RP11-414C23_1	 2	20	12	Y	  2828833	  3000873	  2914853
RP11-91A13_2	 2	21	12	Y	 16855741	 17005408	 16930574
RP11-5C5	 2	22	12	Y	 23158794	 23315750	 23237272
CTB-167K11	 2	23	12	01	245208611	245358773	245283692
CTB-172I13	 2	24	12		NA	NA	NA
CTB-56H22	 2	25	12	03	198495459	198495614	198495536
RP11-177M16	 2	13	13	01	171094173	171274712	171184442
RP11-4J2	 2	14	13	01	174019839	174020139	174019989
RP11-196B7	 2	15	13	01	179035234	179035571	179035402
RP11-162L13	 2	16	13	01	182448508	182622235	182535371
RP11-173E24	 2	17	13	01	191987583	192156745	192072164
RP11-249C10	 2	18	13	01	196846039	196846425	196846232
RP11-167J2	 2	19	13	01	205973604	206131781	206052692
RP11-123O6	 2	20	13	01	207793067	207793386	207793226
RP11-193P21	 2	21	13	01	209436445	209436790	209436617
RP11-124A11	 2	22	13	01	212033827	212208007	212120917
RP11-260A10	 2	23	13	01	213537353	213695637	213616495
RP11-211K12	 2	24	13	01	215588846	215589140	215588993
CTD-2121F9	 2	25	13	01	 67865538	 67866025	 67865781
CTD-2146H13	 2	 1	14	01	169235592	169375598	169305595
CTD-2218H7	 2	 2	14	01	202245038	202369242	202307140
RP11-79A13	 2	 3	14	01	 60721931	 60898897	 60810414
RP11-79C3	 2	 4	14	01	 98718601	 98908219	 98813410
RP11-79E17	 2	 5	14	01	167730696	167913876	167822286
RP11-80J4	 2	 6	14	01	193362822	193492822	193427822
RP11-80L8	 2	 7	14	01	161968761	162112834	162040797
RP11-80P14	 2	 8	14	01	234488456	234645981	234567218
RP11-81D13	 2	 9	14	01	 91578441	 91759187	 91668814
RP11-81J1	 2	10	14		NA	NA	NA
RP11-81J5	 2	11	14	01	237672842	237851119	237761980
RP11-21P18	 2	12	14	02	 88109763	 88273220	 88191491
RP11-353M23	 2	13	14	11	 57264231	 57434804	 57349517
RP11-129K1	 2	14	14	03	  2215033	  2377366	  2296199
RP11-32F23	 2	15	14	03	  4016396	  4198468	  4107432
RP11-128A5	 2	16	14	03	  8686064	  8857271	  8771667
RP11-271E2	 2	17	14	03	 13892339	 14053910	 13973124
RP11-111P21	 2	18	14	03	 45315381	 45497977	 45406679
RP11-124O2	 2	19	14	03	 54358468	 54511737	 54435102
RP11-39L1	 2	20	14	03	 55803937	 55933937	 55868937
RP11-120C2	 2	21	14	03	 57297474	 57406992	 57352233
RP11-180G14	 2	22	14	03	 59538558	 59538883	 59538720
RP11-114P15	 2	23	14	03	 62473233	 62639806	 62556519
RP11-5K13	 2	24	14	03	114419497	114596919	114508208
RP11-220G20	 2	25	14	03	118631102	118777911	118704506
RP11-233L3	 2	 1	15		NA	NA	NA
RP11-217P4	 2	 2	15	03	124525892	124526078	124525985
RP11-205A6	 2	 3	15	03	127354776	127484776	127419776
RP11-220J13	 2	 4	15	03	136799829	136965543	136882686
RP11-198G24	 2	 5	15	03	165289729	165465059	165377394
RP11-24L16	 2	 6	15	03	169692713	169693073	169692893
RP11-151P12	 2	 7	15	03	171644118	171797334	171720726
RP11-196F13	 2	 8	15	03	173653816	173721242	173687529
RP11-148D23	 2	 9	15	03	174848631	175020330	174934480
RP11-118F4	 2	10	15	03	180910839	181073269	180992054
RP11-79M4	 2	11	15	04	135890671	136042871	135966771
RP11-79M20	 2	12	15	04	 90571652	 90737546	 90654599
RP11-80D22	 2	13	15	04	 43619912	 43799496	 43709704
RP11-80H22	 2	14	15	04	109836650	110003969	109920309
RP11-81J9	 2	15	15	04	109950857	110105012	110027934
RP11-81N5	 2	16	15	04	 13026621	 13178995	 13102808
RP11-89I8	 2	17	15	04	161692409	161842483	161767446
RP11-89K12	 2	18	15	04	  6274488	  6444487	  6359487
RP11-89D7	 2	19	15	04	175318254	175483211	175400732
RP11-89D13	 2	20	15	04	112814271	112982439	112898355
RP11-89H17	 2	21	15	04	 17286550	 17457528	 17372039
RP11-89B18	 2	22	15	04	 56172241	 56302241	 56237241
RP11-90L23	 2	23	15	04	 42860434	 43031526	 42945980
RP11-91J3	 2	24	15	04	188660398	188815082	188737740
RP11-91N13	 2	25	15	04	 16042580	 16204404	 16123492
RP11-91O3	 2	 1	16	04	148054208	148225659	148139933
RP11-91C3	 2	 2	16	04	 60754321	 60915084	 60834702
RP11-91G13	 2	 3	16	04	103315819	103482988	103399403
RP11-58A5	 2	 4	16	05	  4965703	  5123153	  5044428
RP11-36H5	 2	 5	16	05	  6365579	  6533316	  6449447
RP11-145B1	 2	 6	16	05	 10279384	 10446930	 10363157
RP11-29N3	 2	 7	16	05	 11435595	 11435858	 11435726
RP11-135M13	 2	 8	16	05	 15627305	 15781105	 15704205
RP11-269O14	 2	 9	16	05	 16684131	 16684506	 16684318
RP11-90M17	 2	10	16	06	 17954872	 18121480	 18038176
RP11-90P11	 2	11	16	06	  1766631	  1938509	  1852570
RP11-91F13	 2	12	16	06	  3911097	  4084546	  3997821
RP11-91N3	 2	13	16	06	 16653505	 16813403	 16733454
RP11-91O16	 2	14	16	06	167558159	167725815	167641987
RP11-91E11	 2	15	16	06	 37388210	 37581751	 37484980
RP11-161C7	 2	16	16	07	  6215991	  6396697	  6306344
RP11-123E5	 2	17	16	07	 17330359	 17526398	 17428378
RP11-70K3	 2	18	16	07	 18147213	 18277213	 18212213
RP11-49N21	 2	19	16	07	 19755900	 19756301	 19756100
RP11-160L16	 2	20	16	07	 22573519	 22737277	 22655398
RP11-17H7	 2	21	16	07	 27945126	 28115239	 28030182
RP11-3L22	 2	22	16	07	 40625167	 40778748	 40701957
RP11-70D20	 2	23	16	07	 41198124	 41198388	 41198256
RP11-141P12	 2	24	16	07	 42860676	 43024732	 42942704
RP11-112B7	 2	25	16	07	 44109429	 44282948	 44196188
RP11-109N2	 2	 1	17	07	 45824384	 46020556	 45922470
RP11-11D14	 2	 2	17	07	 47375651	 47505651	 47440651
RP11-114E12	 2	 3	17	07	 67843676	 68014926	 67929301
RP11-96O16	 2	 4	17	07	 69021654	 69203894	 69112774
RP11-193J17	 2	 5	17	07	 71178377	 71178710	 71178543
RP11-35H4	 2	 6	17	07	 77282649	 77438175	 77360412
RP11-219N12	 2	 7	17	07	 79491460	 79491755	 79491607
RP11-22M18	 2	 8	17	07	 84188365	 84356324	 84272344
RP11-91P17	 2	 9	17	08	 79158449	 79305261	 79231855
RP11-91M23	 2	10	17	08	125876592	126073860	125975226
RP11-91I20_1	 2	11	17	08	 61578650	 61769195	 61673922
RP11-91G3	 2	12	17	08	 91135433	 91294047	 91214740
RP11-451O18	 2	13	17	08	 33148263	 33325914	 33237088
RP11-28N6	 2	14	17	09	  1301297	  1488481	  1394889
RP11-26H17	 2	15	17		NA	NA	NA
RP11-132G20	 2	16	17	09	 15858419	 15858778	 15858598
RP11-33O15	 2	17	17	09	 22823086	 22953086	 22888086
RP11-55P9	 2	18	17	09	 25425786	 25573596	 25499691
RP11-70F16	 2	19	17	09	 31034743	 31177453	 31106098
RP11-52I10	 2	20	17	09	 31664296	 31833576	 31748936
RP11-44J18	 2	21	17	09	 69815612	 69969615	 69892613
RP11-8L13	 2	22	17	09	 71152731	 71320859	 71236795
RP11-74E13	 2	23	17	09	122708810	122838810	122773810
RP11-57N18	 2	24	17	09	 75211878	 75384409	 75298143
RP11-56C1	 2	25	17	09	 77229325	 77229539	 77229432
RP11-14J9	 2	 1	18	09	 74876823	 75006823	 74941823
RP11-105E2	 2	 2	18	09	 88982212	 89143277	 89062744
RP11-9I18	 2	 3	18	09	 90362231	 90492231	 90427231
RP11-44O3	 2	 4	18	09	 91304426	 91434426	 91369426
RP11-95D9	 2	 5	18	09	 92195904	 92325904	 92260904
RP11-54O15	 2	 6	18	09	 94745039	 94920987	 94833013
RP11-106O17	 2	 7	18	09	 94882444	 94882881	 94882662
RP11-91I1	 2	 8	18	10	 61895574	 62056416	 61975995
RP11-91M16	 2	 9	18	10	 92885729	 93028583	 92957156
RP11-91A23	 2	10	18	10	 28589861	 28775774	 28682817
RP11-91A6	 2	11	18	10	103405193	103535193	103470193
RP11-91C16	 2	12	18	10	  4220613	  4378721	  4299667
RP11-91G16	 2	13	18	06	137329380	137459380	137394380
RP11-170H2	 2	14	18	11	 12608554	 12781974	 12695264
RP11-72L17	 2	15	18	11	 14366764	 14496764	 14431764
RP11-7O20	 2	16	18	11	 14830546	 14997983	 14914264
RP11-166E15	 2	17	18	11	 17122028	 17286229	 17204128
RP11-199K11	 2	18	18	11	 19375490	 19375619	 19375554
RP11-80B10	 2	19	18	11	 19227077	 19402989	 19315033
RP11-127K23	 2	20	18	11	 33260859	 33321511	 33291185
RP11-283O4	 2	21	18	11	 33686931	 33687085	 33687008
RP11-145B20	 2	22	18	11	 35233053	 35369679	 35301366
RP11-36H11	 2	23	18	11	 36353272	 36513773	 36433522
RP11-72A10	 2	24	18	11	 36733001	 36906432	 36819716
RP11-34F8	 2	25	18	11	 40879124	 41048960	 40964042
RP11-135H8	 2	 1	19	11	 56357374	 56507045	 56432209
RP11-77M17	 2	 2	19	11	 57109511	 57277679	 57193595
RP11-205I14	 2	 3	19	11	 59220883	 59439636	 59330259
RP11-35F11	 2	 4	19	11	 62933911	 63103603	 63018757
RP11-9K14	 2	 5	19	11	 65029026	 65185268	 65107147
RP11-160L9	 2	 6	19	11	 67030556	 67191077	 67110816
RP11-449D7	 2	 7	19	12	101911158	101922431	101916794
RP11-91I24	 2	 8	19	12	 82150704	 82311687	 82231195
RP11-8C15	 2	 9	19	13	 20985475	 21115475	 21050475
RP11-18F22	 2	10	19	13	 24477260	 24607260	 24542260
RP11-31H2	 2	11	19	13	 24064249	 24194249	 24129249
RP11-85P8	 2	12	19	13	 27475788	 27476188	 27475988
RP11-52B21	 2	13	19	13	 46118238	 46284283	 46201260
RP11-54G17	 2	14	19	13	 48803580	 48933580	 48868580
RP11-16F6	 2	15	19	13	 52042913	 52195294	 52119103
RP11-234M13	 2	16	19	13	 55405818	 55406206	 55406012
RP11-37I8	 2	17	19	13	 63926453	 64056453	 63991453
RP11-94F7	 2	18	19	13	 72204333	 72369394	 72286863
RP11-165N12	 2	19	19	13	 91819115	 91979519	 91899317
RP11-40H10	 2	20	19	13	 94359632	 94360015	 94359823
RP11-19J14	 2	21	19	13	 97851594	 97851757	 97851675
RP11-23M9	 2	22	19	13	 98762177	 98923852	 98843014
RP11-7B23	 2	23	19	13	101030160	101195607	101112883
RP11-86B6	 2	24	19	13	104021213	104021449	104021331
RP11-79A16	 2	25	19	13	 95390242	 95551839	 95471040
RP11-79D3	 2	 1	20	13	 62021605	 62151605	 62086605
RP11-80B16	 2	 2	20	13	 92949384	 93116618	 93033001
RP11-80J14	 2	 3	20	13	 24139393	 24325716	 24232554
RP11-80P22	 2	 4	20	13	 86580304	 86747749	 86664026
RP11-81D19	 2	 5	20	13	 57461809	 57618141	 57539975
RP11-230E8	 2	 6	20	16	 70159145	 70159547	 70159346
RP11-27D1	 2	 7	20	16	 73885123	 73885373	 73885248
RP11-217K3	 2	 8	20	16	 75074528	 75074903	 75074715
RP11-61L1	 2	 9	20	16	 77215302	 77345302	 77280302
RP11-178P16	 2	10	20	16	 80934454	 81098865	 81016659
RP11-223I9	 2	11	20	16	 81468847	 81469169	 81469008
RP11-79A1	 2	12	20	16	 88125791	 88297483	 88211637
RP11-79E10	 2	13	20	16	 51112187	 51264162	 51188174
RP11-7D23_2	 2	14	20	16	 88297301	 88465228	 88381264
RP11-79I15	 2	15	20	16	 16650372	 16820872	 16735622
RP11-80H6	 2	16	20	16	 83219109	 83379313	 83299211
RP11-81F1	 2	17	20	16	 11237046	 11408969	 11323007
RP11-90J5	 2	18	20	16	 81539093	 81684867	 81611980
RP11-91H21	 2	19	20	02	173608959	173738959	173673959
RP11-91A22	 2	20	20	16	 45078235	 45249589	 45163912
CTA-485G10	 2	21	20	16	 26687675	 26823021	 26755348
CTA-530H11	 2	22	20	16	 17685143	 17817504	 17751323
CTA-670B5	 2	23	20	16	 27322544	 27454073	 27388308
RP11-520B23_1	 2	24	20	16	 11716267	 11875890	 11796078
RP11-67I13	 2	25	20	16	 50922223	 51084845	 51003534
RP11-26N16	 2	 1	21	17	   836330	  1008128	   922229
RP11-4F24	 2	 2	21	17	  1704706	  1705051	  1704878
RP11-208J12	 2	 3	21	17	  3394448	  3545832	  3470140
RP11-9A21	 2	 4	21	17	  7411115	  7541115	  7476115
RP11-451O20	 2	 5	21	20	 13144773	 13274773	 13209773
RP11-61A21	 2	 6	21	21	 15300085	 15453714	 15376899
RP11-31B6_2	 2	 7	21	21	 14998564	 15152259	 15075411
RP11-143A3	 2	 8	21	21	 18244635	 18244913	 18244774
RP11-49J9	 2	 9	21	21	 20982315	 21153633	 21067974
RP11-48F12	 2	10	21	21	 22054521	 22201310	 22127915
RP11-32A2	 2	11	21	21	 29767530	 29921601	 29844565
RP11-61G3	 2	12	21	21	 31102834	 31232834	 31167834
RP11-191I6	 2	13	21	21	 31455116	 31455428	 31455272
RP11-5N20	 2	14	21	21	 31578099	 31736757	 31657428
RP11-276A17	 2	15	21	21	 31409492	 31455428	 31432460
RP11-8P19	 2	16	21	21	 34529859	 34737015	 34633437
RP11-79G23	 2	17	21	21	 29260484	 29450968	 29355726
RP11-79D9	 2	18	21	21	 33204656	 33369197	 33286926
RP11-88D18	 2	19	21	21	 25400598	 25568510	 25484554
RP11-89C22	 2	20	21	21	 25710762	 25895261	 25803011
RP11-89H5	 2	21	21	21	 28964173	 29115129	 29039651
RP11-89H16	 2	22	21	21	 15062606	 15062997	 15062801
RP11-213L15	 2	23	21	22	 27825879	 27826212	 27826045
RP11-5I24	 2	24	21	22	 31998945	 31999257	 31999101
RP11-125J19	 2	25	21	22	 33461081	 33461260	 33461170
RP11-105I18	 2	 1	22	22	 34951350	 35112595	 35031972
RP11-235O23	 2	 2	22	22	 36706132	 36706446	 36706289
RP11-4H24	 2	 3	22	22	 38706685	 38707024	 38706854
RP11-168O10	 2	 4	22	10	 91121511	 91265490	 91193500
RP11-169K17	 2	 5	22	03	 11524156	 11688746	 11606451
RP11-169N13_2	 2	 6	22	03	120926479	121091572	121009025
RP11-174I10	 2	 7	22	13	 47897821	 47960646	 47929233
RP11-175A7	 2	 8	22	02	 70222436	 70400431	 70311433
RP11-178G16	 2	 9	22	10	 75506962	 75611618	 75559290
RP11-197O4	 2	10	22	19	 10248852	 10410630	 10329741
RP11-201P10	 2	11	22	15	 34748790	 34912124	 34830457
RP11-203M2	 2	12	22	09	132223828	132419564	132321696
RP11-204J18	 2	13	22	03	 62190611	 62347194	 62268902
RP11-204N9	 2	14	22	13	 57108112	 57238112	 57173112
RP11-205M9	 2	15	22	01	150938154	151057614	150997884
RP11-216P6	 2	16	22	17	   802249	  1008155	   905202
RP11-223F11	 2	17	22	01	159417716	159576162	159496939
RP11-228B15	 2	18	22	09	127589858	127670500	127630179
RP11-229O3	 2	19	22	16	 63462866	 63616454	 63539660
RP11-231C18	 2	20	22	04	 54968262	 55100426	 55034344
RP11-231G16	 2	21	22	17	  3515829	  3716750	  3616289
RP11-252A24	 2	22	22	16	 72892287	 73055707	 72973997
RP11-255N19	 2	23	22	02	 38787976	 38899493	 38843734
RP11-258P13	 2	24	22	11	  3785609	  3953103	  3869356
RP11-260K18	 2	25	22	04	 47934140	 48092941	 48013540
RP11-262H5	 2	 1	23	01	211134056	211310076	211222066
RP11-263P6	 2	 2	23	20	 32208031	 32395368	 32301699
RP11-540B6	 2	 3	23	15	 28869060	 29060466	 28964763
RP11-541M12	 2	 4	23	10	 49230232	 49437150	 49333691
RP11-544B14	 2	 5	23	01	203219764	203408496	203314130
RP11-547D13	 2	 6	23	15	 53154630	 53329906	 53242268
RP11-548B6	 2	 7	23	16	 23579108	 23730736	 23654922
RP11-550P17	 2	 8	23	01	156029037	156197376	156113206
RP11-570L13	 2	 9	23	04	 85828816	 86011586	 85920201
RP11-572O17	 2	10	23	04	  1592781	  1782006	  1687393
RP11-575C6	 2	11	23	02	201926548	202107698	202017123
RP11-576P2	 2	12	23	14	 22008203	 22195500	 22101851
RP11-593H15	 2	13	23	07	121179788	121338858	121259323
RP11-597P9	 2	14	23	04	187880154	188048172	187964163
RP11-622A14	 2	15	23	03	  4916593	  5125970	  5021281
RP11-627P22	 2	16	23	07	 26729921	 26830664	 26780292
RP11-629J17	 2	17	23	06	 32683027	 32798351	 32740689
RP11-638A9	 2	18	23	07	 86539140	 86669140	 86604140
RP11-644F5	 2	19	23	12	 54224698	 54417248	 54320973
RP11-649M10	 2	20	23	11	113637868	113816513	113727190
RP11-678D20	 2	21	23	11	 66847435	 67013794	 66930614
RP11-680A11	 2	22	23	12	 51954287	 52060838	 52007562
RP11-683E17	 2	23	23	18	  8438642	  8622616	  8530629
RP11-686G6	 2	24	23	11	102129478	102315567	102222522
RP11-687L3	 2	25	23	06	107418523	107556329	107487426
RP11-692D12	 2	 1	24	04	 74333651	 74566904	 74450277
RP11-119E13	 2	 2	24	03	187916513	188068880	187992696
RP11-122K13_2	 2	 3	24	10	134947600	135111183	135029391
RP11-124A7	 2	 4	24	04	 41071067	 41249104	 41160085
RP11-125E8_2	 2	 5	24	03	185459125	185625829	185542477
RP11-126L4	 2	 6	24	03	 12025484	 12189344	 12107414
RP11-130C19	 2	 7	24	09	   615147	   812246	   713696
RP11-158K18	 2	 8	24	11	120633747	120813353	120723550
RP11-163K17	 2	 9	24	04	104233375	104414925	104324150
RP11-164A4	 2	10	24	05	112385104	112548750	112466927
RP11-165H20	 2	11	24	01	111426345	111597595	111511970
RP11-165P4	 2	12	24	09	120891077	121069478	120980277
RP11-169D4	 2	13	24	11	 71870379	 72068557	 71969468
RP11-190F19	 2	14	24	10	115235472	115423821	115329646
RP11-196G18	 2	15	24	01	146522913	146711869	146617391
RP11-202A21	 2	16	24	03	  8555740	  8727458	  8641599
RP11-206N2	 2	17	24	05	 76128363	 76330345	 76229354
RP11-211G3	 2	18	24	03	188858118	188983514	188920816
RP11-211P13	 2	19	24	03	191651341	191835543	191743442
RP11-242O24	 2	20	24	01	 29125256	 29323720	 29224488
RP11-248G5	 2	21	24	13	 51453674	 51641365	 51547519
RP11-252I14	 2	22	24	05	179467083	179662550	179564816
RP11-254B13	 2	23	24	12	 67207034	 67347334	 67277184
RP11-255E21	 2	24	24	13	 78696702	 78862028	 78779365
RP11-259K5	 2	25	24	03	 37197462	 37384589	 37291025
RP11-587D21	 2	 1	25	11	 27557494	 27736319	 27646906
RP11-592G13	 2	 2	25	02	112461168	112584350	112522759
RP11-597P14	 2	 3	25	02	138788716	138963349	138876032
RP11-601N4	 2	 4	25	02	 88864752	 89041307	 88953029
RP11-605F20	 2	 5	25	17	 36092356	 36260510	 36176433
RP11-622P13	 2	 6	25	07	 72446701	 72625924	 72536312
RP11-414C23_1	 2	 7	25	Y	  2828833	  3000873	  2914853
RP11-91A13_2	 2	 8	25	Y	 16855741	 17005408	 16930574
RP11-5C5	 2	 9	25	Y	 23158794	 23315750	 23237272
CTB-167K11	 2	10	25	01	245208611	245358773	245283692
CTB-172I13	 2	11	25		NA	NA	NA
CTB-56H22	 2	12	25	03	198495459	198495614	198495536
RP11-62M23	 3	 1	 1	01	  3608018	  3739916	  3673967
RP11-51B4_1	 3	 2	 1		NA	NA	NA
RP11-199O1	 3	 3	 1	01	 10508329	 10508645	 10508487
RP11-178M15	 3	 4	 1	01	 13731634	 13731966	 13731800
RP11-265F14_1	 3	 5	 1	01	 15503411	 15683816	 15593613
RP11-251K5	 3	 6	 1	01	 19573421	 19573723	 19573572
RP11-51A20	 3	 7	 1	01	 33790776	 33920776	 33855776
RP11-219O7	 3	 8	 1	01	 36739998	 36740391	 36740194
RP11-192A12	 3	 9	 1	01	 38923718	 39053718	 38988718
RP11-52I2	 3	10	 1	01	 47620139	 47620504	 47620321
RP11-235B24	 3	11	 1	01	 50462496	 50462714	 50462605
RP11-55M23	 3	12	 1	01	 55178851	 55179163	 55179007
RP11-80G24	 3	13	 1	01	 77428804	 77558804	 77493804
RP11-267M21	 3	14	 1	01	 79681532	 79681876	 79681704
RP11-6B16	 3	15	 1	01	 82255369	 82255623	 82255496
RP11-254E16	 3	16	 1	01	 84547815	 84548232	 84548023
RP11-211D4	 3	17	 1	01	 85677788	 85807788	 85742788
RP11-148B18	 3	18	 1	01	 94421595	 94578676	 94500135
RP11-254K1	 3	19	 1	01	114738403	114926225	114832314
RP11-63I1	 3	20	 1	01	118453796	118623999	118538897
RP11-29M22	 3	21	 1	01	119870182	120000182	119935182
RP11-30I17	 3	22	 1	01	142951738	143139578	143045658
RP11-214H6	 3	23	 1	01	153444364	153444622	153444493
RP11-97G24	 3	24	 1	01	157289290	157461144	157375217
RP11-90K23	 3	25	 1	02	121500476	121679355	121589915
RP11-90O9	 3	 1	 2	02	104350305	104499884	104425094
RP11-90L9	 3	 2	 2	02	228400981	228557487	228479234
RP11-91J17	 3	 3	 2	02	227462004	227631753	227546878
RP11-91L23	 3	 4	 2	02	173582122	173739010	173660566
RP11-91N19	 3	 5	 2	02	233104529	233261162	233182845
RP11-91C20	 3	 6	 2	02	140341729	140509149	140425439
RP11-91G8	 3	 7	 2	02	124769802	124929224	124849513
RP11-844K18	 3	 8	 2	02	159598125	159728125	159663125
RP11-185P14_2	 3	 9	 2	02	  9547577	  9547954	  9547765
RP11-81F24_2	 3	10	 2	02	 15177860	 15178217	 15178038
RP11-77G15_2	 3	11	 2	02	 34191612	 34356053	 34273832
RP11-95H5_2	 3	12	 2	02	106732231	106926971	106829601
RP11-67G15_2	 3	13	 2	02	127677441	127816311	127746876
RP11-9L19_2	 3	14	 2	02	133997687	134169585	134083636
RP11-29N17_2	 3	15	 2	02	141479850	141609850	141544850
RP11-72H23_2	 3	16	 2	02	148636288	148766288	148701288
RP11-185M22_2	 3	17	 2	02	152488388	152667424	152577906
RP11-4B6_2	 3	18	 2	02	218084294	218214294	218149294
RP11-23G2_2	 3	19	 2	02	221750872	221916763	221833817
RP11-183N7_2	 3	20	 2	02	224418350	224577926	224498138
RP11-71H20_2	 3	21	 2	02	231937955	232067955	232002955
RP11-156M13_2	 3	22	 2		NA	NA	NA
RP11-116M19_2	 3	23	 2	02	236411955	236412301	236412128
RP11-40D5	 3	24	 2	04	135147960	135148335	135148147
RP11-149A7	 3	25	 2	04	133802360	133974779	133888569
RP11-218I24	 3	 1	 3	04	138248484	138248882	138248683
RP11-128J2	 3	 2	 3	04	139773624	139773796	139773710
RP11-22O8	 3	 3	 3	04	141028895	141158895	141093895
RP11-135O7	 3	 4	 3	04	142546978	142676978	142611978
RP11-101A21	 3	 5	 3	04	152695370	152825370	152760370
RP11-119B13_1	 3	 6	 3	04	154907191	155056506	154981848
RP11-84M15_1	 3	 7	 3	04	155606072	155696244	155651158
RP11-93I2	 3	 8	 3	04	155780643	155910643	155845643
RP11-136D2	 3	 9	 3	04	158076763	158236766	158156764
RP11-192D11	 3	10	 3	04	159886665	160059374	159973019
RP11-189F4	 3	11	 3	04	175079197	175079516	175079356
RP11-182G5	 3	12	 3	04	176062869	176063210	176063039
RP11-122D8	 3	13	 3	04	177978448	178154717	178066582
RP11-272O3	 3	14	 3	04	178981314	179129482	179055398
RP11-171G12	 3	15	 3	04	181577510	181577898	181577704
RP11-125M9	 3	16	 3	04	182929475	183096645	183013060
RP11-159A22	 3	17	 3	04	186820862	186993186	186907024
RP11-173M11	 3	18	 3	04	187429471	187596903	187513187
RP11-40O3	 3	19	 3	04	190471998	190472339	190472168
RP11-237D3	 3	20	 3	04	188693843	188866451	188780147
CTD-2050K10	 3	21	 3	04	  2847381	  2957938	  2902659
CTD-2164I11	 3	22	 3	04	  3031931	  3161931	  3096931
RP11-7H16	 3	23	 3	06	 53474206	 53646166	 53560186
RP11-111P16	 3	24	 3	06	 55544176	 55715796	 55629986
RP11-164C22	 3	25	 3	06	 62379464	 62577198	 62478331
RP11-121K16	 3	 1	 4	06	 72245460	 72401016	 72323238
RP11-217L13	 3	 2	 4	06	 79297258	 79474213	 79385735
RP11-32O2	 3	 3	 4	06	 85568541	 85698541	 85633541
RP11-59F18	 3	 4	 4	06	113003534	113168055	113085794
RP11-51N24	 3	 5	 4	06	113666837	113792519	113729678
RP11-149M1	 3	 6	 4	06	119371315	119501315	119436315
RP11-231F3	 3	 7	 4	06	125008658	125140989	125074823
RP11-107M3	 3	 8	 4	06	128778088	128908088	128843088
RP11-54P6	 3	 9	 4	06	134023936	134162289	134093112
RP11-79A17	 3	10	 4	06	118916115	119046115	118981115
RP11-79G15	 3	11	 4	06	 99724979	 99896445	 99810712
RP11-79J17	 3	12	 4	06	 32958729	 33107258	 33032993
RP11-79M3	 3	13	 4	06	 12138336	 12329145	 12233740
RP11-79M13	 3	14	 4	06	100255383	100402455	100328919
RP11-79I2	 3	15	 4	06	 43435071	 43619796	 43527433
RP11-79L7	 3	16	 4	06	106772705	106949084	106860894
RP11-80B14	 3	17	 4	06	123778064	123943937	123861000
RP11-81B13	 3	18	 4	06	 88549154	 88724237	 88636695
RP11-81H13	 3	19	 4	06	161455552	161627949	161541750
RP11-88D2	 3	20	 4	06	 28581930	 28783688	 28682809
RP11-88H24	 3	21	 4	06	 24927930	 25093844	 25010887
RP11-203C23	 3	22	 4	08	 75089404	 75089730	 75089567
RP11-33D7	 3	23	 4	08	 75004089	 75134089	 75069089
RP11-90B7_1	 3	24	 4	08	 79496714	 79685067	 79590890
RP11-214E11	 3	25	 4	08	 81110313	 81110557	 81110435
RP11-93E11	 3	 1	 5	08	 81875410	 82031123	 81953266
RP11-118O8	 3	 2	 5	08	 92998430	 93166789	 93082609
RP11-150N13	 3	 3	 5	08	126445210	126626507	126535858
RP11-128G18	 3	 4	 5	08	127751254	127751581	127751417
RP11-237F24	 3	 5	 5	08	128822386	128822827	128822606
RP11-158G1	 3	 6	 5	08	133225033	133225412	133225222
RP11-128P9	 3	 7	 5	08	133561338	133561490	133561414
RP11-88M23	 3	 8	 5	08	134537164	134537579	134537371
RP11-79E8	 3	 9	 5	08	130828077	130999919	130913998
RP11-79O20	 3	10	 5	08	110047327	110205767	110126547
RP11-79H13	 3	11	 5	08	 34946592	 35108516	 35027554
RP11-79I19	 3	12	 5	08	  3725983	  3883664	  3804823
RP11-80B8	 3	13	 5	08	 11617790	 11803115	 11710452
RP11-80D8	 3	14	 5	08	109289180	109441448	109365314
RP11-89M8_2	 3	15	 5	08	 22779033	 22949883	 22864458
RP11-89O4	 3	16	 5	08	 20596099	 20769457	 20682778
RP11-89F14	 3	17	 5	08	 92441534	 92593423	 92517478
RP11-90G11	 3	18	 5	08	127644127	127820732	127732429
RP11-90G19	 3	19	 5	08	 89002539	 89158439	 89080489
RP11-90B7_2	 3	20	 5	08	 79496714	 79685067	 79590890
RP11-287G20	 3	21	 5	10	106148786	106149115	106148950
RP11-41D21	 3	22	 5	10	108165938	108343479	108254708
RP11-246B13	 3	23	 5	10	108916615	109079434	108998024
RP11-182C2	 3	24	 5	10	111740417	111829115	111784766
RP11-1I16	 3	25	 5	10	113310817	113311159	113310988
RP11-106N20	 3	 1	 6	10	114856262	115024106	114940184
RP11-47G11	 3	 2	 6	10	125710218	125859462	125784840
RP11-8O10	 3	 3	 6	10	127832427	127985179	127908803
RP11-32H11	 3	 4	 6	10	128657284	128681114	128669199
RP11-31A20	 3	 5	 6	10	129427475	129565710	129496592
RP11-122K13_1	 3	 6	 6	10	134947600	135111183	135029391
RP11-27F2	 3	 7	 6	10	133470856	133471230	133471043
RP11-79A2	 3	 8	 6	10	 57053261	 57194288	 57123774
RP11-79A18	 3	 9	 6	10	119176050	119331359	119253704
RP11-79K24	 3	10	 6	10	  1302776	  1474060	  1388418
RP11-79H9	 3	11	 6	10	  1302790	  1474057	  1388423
RP11-79I23	 3	12	 6	10	 60095348	 60270672	 60183010
RP11-80H4	 3	13	 6	10	 43603026	 43733026	 43668026
RP11-89H7	 3	14	 6	10	116289991	116445436	116367713
RP11-89J23	 3	15	 6	10	 43432325	 43596132	 43514228
RP11-89J24	 3	16	 6	10	 67131288	 67261288	 67196288
RP11-90E19	 3	17	 6	10	132288410	132445997	132367203
RP11-90D7	 3	18	 6	10	   969751	  1143289	  1056520
RP11-90F7	 3	19	 6	10	 23370639	 23547027	 23458833
RP11-18B8	 3	20	 6	12	 63730862	 63882712	 63806787
RP11-184C7	 3	21	 6	12	 65483115	 65647017	 65565066
RP11-15L3	 3	22	 6	12	 68217524	 68403913	 68310718
RP11-92P22	 3	23	 6	12	 74052866	 74222988	 74137927
RP11-230I13	 3	24	 6	12	 78276020	 78456697	 78366358
RP11-51M11	 3	25	 6	12	 89158341	 89288341	 89223341
RP11-51K17	 3	 1	 7	12	100260302	100390302	100325302
RP11-3E2	 3	 2	 7	12	103711124	103711507	103711315
RP11-5O2	 3	 3	 7	12	102604575	102604940	102604757
RP11-3P19	 3	 4	 7	12	105448121	105610295	105529208
RP11-110L13	 3	 5	 7	12	105290197	105453607	105371902
RP11-287D11	 3	 6	 7	12	108042751	108043088	108042919
RP11-79K20	 3	 7	 7	12	  1109504	  1284988	  1197246
RP11-80B4	 3	 8	 7	12	 79644278	 79809802	 79727040
RP11-80N2	 3	 9	 7	12	 20833481	 21009087	 20921284
RP11-81H3	 3	10	 7	12	 72966135	 73144427	 73055281
RP11-81H23	 3	11	 7	12	106478655	106648494	106563574
RP11-88F18	 3	12	 7	12	 60601465	 60768726	 60685095
RP11-90G3	 3	13	 7	12	 69088876	 69258353	 69173614
RP11-90F3	 3	14	 7	12	111019769	111206853	111113311
RP11-90I21	 3	15	 7	12	 41391594	 41543191	 41467392
RP11-90K13	 3	16	 7	12	 30789460	 30963605	 30876532
RP11-90P21	 3	17	 7	12	 58377273	 58526679	 58451976
RP11-91B13	 3	18	 7	12	  4593556	  4745407	  4669481
RP11-81A1	 3	19	 7	15	 77928968	 78080096	 78004532
RP11-58C20	 3	20	 7	15	 82015112	 82186756	 82100934
RP11-43K17	 3	21	 7	15	 83225994	 83355994	 83290994
RP11-60P2	 3	22	 7	15	 85245342	 85429624	 85337483
RP11-185D5	 3	23	 7	15	 92238362	 92368362	 92303362
RP11-120N1	 3	24	 7	15	 95833746	 95963746	 95898746
RP11-79J21	 3	25	 7	15	 74334873	 74499781	 74417327
RP11-80F4	 3	 1	 8	15	 96495497	 96655554	 96575525
RP11-80J8	 3	 2	 8	15	 85413252	 85560367	 85486809
RP11-81H5	 3	 3	 8	15	 44594167	 44774431	 44684299
RP11-81L17	 3	 4	 8	15	 82048703	 82205904	 82127303
RP11-88D20	 3	 5	 8	15	 43407777	 43594735	 43501256
RP11-160D13	 3	 6	 8	16	  6468000	  6603117	  6535558
RP11-142O7	 3	 7	 8	16	  8346280	  8507334	  8426807
RP11-58M17	 3	 8	 8	16	  8937209	  9097133	  9017171
RP11-66H6	 3	 9	 8	16	 10944014	 11111099	 11027556
RP11-165B11	 3	10	 8	16	 12029008	 12211311	 12120159
RP11-283M20	 3	11	 8	16	 18559573	 18756060	 18657816
RP11-2I4	 3	12	 8	16	 54385373	 54394461	 54389917
RP11-106L3	 3	13	 8	16	 56696187	 56826187	 56761187
RP11-11E14	 3	14	 8	16	 57249741	 57406601	 57328171
RP11-50C5	 3	15	 8	16	 60251376	 60381376	 60316376
RP11-3I14	 3	16	 8	16	 61098253	 61253550	 61175901
RP11-52B24	 3	17	 8	16	 63708677	 63709059	 63708868
RP11-91H11	 3	18	 8	19	 63223239	 63387841	 63305540
RP11-91O21	 3	19	 8	19	 10656390	 10814419	 10735404
RP11-451E12	 3	20	 8	19	 34159370	 34341241	 34250305
RP11-841N21	 3	21	 8	19	  9248376	  9456899	  9352637
RP11-78P4	 3	22	 8	20	  1872352	  2002352	  1937352
RP11-107L14	 3	23	 8	20	  2488182	  2671851	  2580016
RP11-238I2	 3	24	 8	20	 13528058	 13658058	 13593058
RP11-51O4	 3	25	 8	20	 15546274	 15720420	 15633347
RP11-11O15	 3	 1	 9	20	 15567962	 15728758	 15648360
RP11-11M17	 3	 2	 9	20	 17661477	 17835009	 17748243
RP11-7F10	 3	 3	 9	20	 21609455	 21757443	 21683449
RP11-32N12	 3	 4	 9	20	 24132287	 24282120	 24207203
RP11-4A12	 3	 5	 9	20	 41091495	 41175494	 41133494
RP11-69I10	 3	 6	 9	20	 41467082	 41631733	 41549407
RP11-169A6_1	 3	 7	 9	20	 43013962	 43172910	 43093436
RP11-109C3	 3	 8	 9	20	 45531927	 45661927	 45596927
RP11-124D1	 3	 9	 9	20	 46671728	 46843321	 46757524
RP11-5P14	 3	10	 9	20	 48820372	 48995030	 48907701
CTD-2258K15	 3	11	 9	20	 34580335	 34710335	 34645335
RP11-79F17	 3	12	 9	20	 19057986	 19224591	 19141288
RP11-79K14	 3	13	 9	20	 24816861	 24974986	 24895923
RP11-80P6	 3	14	 9	20	 56597433	 56727433	 56662433
RP11-89F13	 3	15	 9	20	 14420247	 14580838	 14500542
RP11-89L20	 3	16	 9	04	129403776	129533776	129468776
RP11-69G7	 3	17	 9	15	 61119454	 61292877	 61206165
RP11-69J7	 3	18	 9	02	230955241	231129940	231042590
RP11-71H17	 3	19	 9	03	125910477	126076548	125993512
RP11-78O10	 3	20	 9	03	 49843915	 50006888	 49925401
RP11-80B9	 3	21	 9	01	237216929	237390563	237303746
RP11-83J21	 3	22	 9	09	130681561	130858027	130769794
RP11-93H5	 3	23	 9	16	 64828173	 65032857	 64930515
RP11-95P2_2	 3	24	 9	16	  4114616	  4289638	  4202127
RP11-96N16	 3	25	 9	10	117796863	117962983	117879923
RP11-98F14	 3	 1	10	13	112777671	112939870	112858770
RP11-100A11	 3	 2	10	15	 64818092	 64985115	 64901603
RP11-100M22	 3	 3	10	18	 46362962	 46552210	 46457586
RP11-115P16	 3	 4	10	01	223100771	223281925	223191348
RP11-117C11	 3	 5	10	06	 43262021	 43439935	 43350978
RP11-119O22	 3	 6	10	15	 78225490	 78397187	 78311338
RP11-121G22	 3	 7	10	12	 80085382	 80241706	 80163544
RP11-125F14	 3	 8	10	11	 47289748	 47477595	 47383671
RP11-126K1	 3	 9	10	01	148001246	148169951	148085598
RP11-140E3	 3	10	10	11	 99053819	 99206521	 99130170
RP11-141K9	 3	11	10	08	 17364531	 17521678	 17443104
RP11-143D15	 3	12	10	08	  6182449	  6365024	  6273736
RP11-147L21	 3	13	10	20	   379480	   549250	   464365
RP11-149B7	 3	14	10	13	 20826876	 20994706	 20910791
RP11-151D14	 3	15	10	09	 72713375	 72865094	 72789234
RP11-440G5	 3	16	10	09	 91210443	 91381341	 91295892
RP11-441F2	 3	17	10	16	 54805517	 54988902	 54897209
RP11-442P12	 3	18	10	04	 15412620	 15619251	 15515935
RP11-446K8	 3	19	10	Y	  1694970	  1842030	  1768500
RP11-449I17	 3	20	10	10	 30646344	 30857971	 30752157
RP11-455F5	 3	21	10	16	 29981455	 30174474	 30077964
RP11-466J8	 3	22	10	20	  2845437	  2975437	  2910437
RP11-467M14	 3	23	10	12	   111317	   269241	   190279
RP11-472H5	 3	24	10	17	 44811769	 44985647	 44898708
RP11-473M20	 3	25	10	16	  2978481	  3158832	  3068656
RP11-478A6	 3	 1	11	04	  2483649	  2667192	  2575420
RP11-480D6	 3	 2	11	08	 89042460	 89249769	 89146114
RP11-494H4	 3	 3	11	03	180900719	181064369	180982544
RP11-495C15	 3	 4	11	18	 59104463	 59293404	 59198933
RP11-496I9_1	 3	 5	11	11	   446970	   635941	   541455
RP11-498A2	 3	 6	11	01	151701110	151880686	151790898
RP11-498C9	 3	 7	11	06	120812073	120974386	120893229
RP11-501I18	 3	 8	11	06	 42815770	 42914110	 42864940
RP11-517H2	 3	 9	11	06	167484798	167586023	167535410
RP11-518C18	 3	10	11	20	  5724709	  5930457	  5827583
RP11-521P1	 3	11	11	17	 29660464	 29841486	 29750975
RP11-523D2	 3	12	11	08	 79633065	 79802910	 79717987
RP11-524F11	 3	13	11	17	 17338140	 17521471	 17429805
RP11-525G7	 3	14	11	09	120727750	120922549	120825149
RP11-22B10	 3	15	11	X	 51265318	 51453343	 51359330
RP11-22N19	 3	16	11	07	105428741	105570154	105499447
RP11-23F23	 3	17	11	11	  4012521	  4195043	  4103782
RP11-23K2	 3	18	11	11	 31930962	 32107376	 32019169
RP11-24J23	 3	19	11	01	 64273330	 64463562	 64368446
RP11-27I22	 3	20	11	11	107726532	107886151	107806341
RP11-41F22	 3	21	11	07	 72964684	 73113915	 73039299
RP11-42O4	 3	22	11	20	 33184582	 33356764	 33270673
RP11-44D11	 3	23	11	05	 39220168	 39422603	 39321385
RP11-45C13	 3	24	11	04	187794113	187948956	187871534
RP11-49P4	 3	25	11	01	 46704885	 46861947	 46783416
RP11-54A1	 3	 1	12	18	 46494606	 46672017	 46583311
RP11-67K19	 3	 2	12	09	116408129	116563597	116485863
RP11-71A24	 3	 3	12	09	 72848272	 73017375	 72932823
RP11-73F12	 3	 4	12	03	121047780	121205097	121126438
RP11-79C6_2	 3	 5	12	05	 35825919	 35991223	 35908571
RP11-80I15	 3	 6	12	09	 94911101	 95069535	 94990318
RP11-82B23	 3	 7	12	03	 53150032	 53328628	 53239330
RP11-96C23	 3	 8	12	10	 88715604	 88898563	 88807083
RP11-96J19	 3	 9	12	06	 53331812	 53502896	 53417354
RP11-100E5	 3	10	12	17	 38762436	 38932045	 38847240
RP11-103G8	 3	11	12	03	151858226	152005328	151931777
RP11-104P21	 3	12	12	01	 32731911	 32908199	 32820055
RP11-106B10	 3	13	12	03	  4740289	  4904842	  4822565
RP11-566J7	 3	14	12	04	170875029	170875297	170875163
RP11-569D9_1	 3	15	12	13	113930806	114103243	114017024
RP11-571L19	 3	16	12	04	100195057	100403797	100299427
RP11-573G6	 3	17	12	10	 22573926	 22712022	 22642974
RP11-575L7	 3	18	12	09	 83643577	 83833156	 83738366
RP11-586A2	 3	19	12	04	 55371429	 55501429	 55436429
RP11-48J15	 3	20	12	Y	  2734459	  2761900	  2748179
RP11-115H13	 3	21	12	Y	  6735814	  6903088	  6819451
RP11-91A13_1	 3	22	12	Y	 16855741	 17005408	 16930574
RP11-135H9	 3	23	12	Y	 17442232	 17604405	 17523318
RP11-20H21	 3	24	12	Y	 19227852	 19400388	 19314120
RP11-214M24	 3	25	12	Y	 25135463	 25220735	 25178099
RP11-62M23	 3	13	13	01	  3608018	  3739916	  3673967
RP11-51B4_1	 3	14	13		NA	NA	NA
RP11-199O1	 3	15	13	01	 10508329	 10508645	 10508487
RP11-178M15	 3	16	13	01	 13731634	 13731966	 13731800
RP11-265F14_1	 3	17	13	01	 15503411	 15683816	 15593613
RP11-251K5	 3	18	13	01	 19573421	 19573723	 19573572
RP11-51A20	 3	19	13	01	 33790776	 33920776	 33855776
RP11-219O7	 3	20	13	01	 36739998	 36740391	 36740194
RP11-192A12	 3	21	13	01	 38923718	 39053718	 38988718
RP11-52I2	 3	22	13	01	 47620139	 47620504	 47620321
RP11-235B24	 3	23	13	01	 50462496	 50462714	 50462605
RP11-55M23	 3	24	13	01	 55178851	 55179163	 55179007
RP11-80G24	 3	25	13	01	 77428804	 77558804	 77493804
RP11-267M21	 3	 1	14	01	 79681532	 79681876	 79681704
RP11-6B16	 3	 2	14	01	 82255369	 82255623	 82255496
RP11-254E16	 3	 3	14	01	 84547815	 84548232	 84548023
RP11-211D4	 3	 4	14	01	 85677788	 85807788	 85742788
RP11-148B18	 3	 5	14	01	 94421595	 94578676	 94500135
RP11-254K1	 3	 6	14	01	114738403	114926225	114832314
RP11-63I1	 3	 7	14	01	118453796	118623999	118538897
RP11-29M22	 3	 8	14	01	119870182	120000182	119935182
RP11-30I17	 3	 9	14	01	142951738	143139578	143045658
RP11-214H6	 3	10	14	01	153444364	153444622	153444493
RP11-97G24	 3	11	14	01	157289290	157461144	157375217
RP11-90K23	 3	12	14	02	121500476	121679355	121589915
RP11-90O9	 3	13	14	02	104350305	104499884	104425094
RP11-90L9	 3	14	14	02	228400981	228557487	228479234
RP11-91J17	 3	15	14	02	227462004	227631753	227546878
RP11-91L23	 3	16	14	02	173582122	173739010	173660566
RP11-91N19	 3	17	14	02	233104529	233261162	233182845
RP11-91C20	 3	18	14	02	140341729	140509149	140425439
RP11-91G8	 3	19	14	02	124769802	124929224	124849513
RP11-844K18	 3	20	14	02	159598125	159728125	159663125
RP11-185P14_2	 3	21	14	02	  9547577	  9547954	  9547765
RP11-81F24_2	 3	22	14	02	 15177860	 15178217	 15178038
RP11-77G15_2	 3	23	14	02	 34191612	 34356053	 34273832
RP11-95H5_2	 3	24	14	02	106732231	106926971	106829601
RP11-67G15_2	 3	25	14	02	127677441	127816311	127746876
RP11-9L19_2	 3	 1	15	02	133997687	134169585	134083636
RP11-29N17_2	 3	 2	15	02	141479850	141609850	141544850
RP11-72H23_2	 3	 3	15	02	148636288	148766288	148701288
RP11-185M22_2	 3	 4	15	02	152488388	152667424	152577906
RP11-4B6_2	 3	 5	15	02	218084294	218214294	218149294
RP11-23G2_2	 3	 6	15	02	221750872	221916763	221833817
RP11-183N7_2	 3	 7	15	02	224418350	224577926	224498138
RP11-71H20_2	 3	 8	15	02	231937955	232067955	232002955
RP11-156M13_2	 3	 9	15		NA	NA	NA
RP11-116M19_2	 3	10	15	02	236411955	236412301	236412128
RP11-40D5	 3	11	15	04	135147960	135148335	135148147
RP11-149A7	 3	12	15	04	133802360	133974779	133888569
RP11-218I24	 3	13	15	04	138248484	138248882	138248683
RP11-128J2	 3	14	15	04	139773624	139773796	139773710
RP11-22O8	 3	15	15	04	141028895	141158895	141093895
RP11-135O7	 3	16	15	04	142546978	142676978	142611978
RP11-101A21	 3	17	15	04	152695370	152825370	152760370
RP11-119B13_1	 3	18	15	04	154907191	155056506	154981848
RP11-84M15_1	 3	19	15	04	155606072	155696244	155651158
RP11-93I2	 3	20	15	04	155780643	155910643	155845643
RP11-136D2	 3	21	15	04	158076763	158236766	158156764
RP11-192D11	 3	22	15	04	159886665	160059374	159973019
RP11-189F4	 3	23	15	04	175079197	175079516	175079356
RP11-182G5	 3	24	15	04	176062869	176063210	176063039
RP11-122D8	 3	25	15	04	177978448	178154717	178066582
RP11-272O3	 3	 1	16	04	178981314	179129482	179055398
RP11-171G12	 3	 2	16	04	181577510	181577898	181577704
RP11-125M9	 3	 3	16	04	182929475	183096645	183013060
RP11-159A22	 3	 4	16	04	186820862	186993186	186907024
RP11-173M11	 3	 5	16	04	187429471	187596903	187513187
RP11-40O3	 3	 6	16	04	190471998	190472339	190472168
RP11-237D3	 3	 7	16	04	188693843	188866451	188780147
CTD-2050K10	 3	 8	16	04	  2847381	  2957938	  2902659
CTD-2164I11	 3	 9	16	04	  3031931	  3161931	  3096931
RP11-7H16	 3	10	16	06	 53474206	 53646166	 53560186
RP11-111P16	 3	11	16	06	 55544176	 55715796	 55629986
RP11-164C22	 3	12	16	06	 62379464	 62577198	 62478331
RP11-121K16	 3	13	16	06	 72245460	 72401016	 72323238
RP11-217L13	 3	14	16	06	 79297258	 79474213	 79385735
RP11-32O2	 3	15	16	06	 85568541	 85698541	 85633541
RP11-59F18	 3	16	16	06	113003534	113168055	113085794
RP11-51N24	 3	17	16	06	113666837	113792519	113729678
RP11-149M1	 3	18	16	06	119371315	119501315	119436315
RP11-231F3	 3	19	16	06	125008658	125140989	125074823
RP11-107M3	 3	20	16	06	128778088	128908088	128843088
RP11-54P6	 3	21	16	06	134023936	134162289	134093112
RP11-79A17	 3	22	16	06	118916115	119046115	118981115
RP11-79G15	 3	23	16	06	 99724979	 99896445	 99810712
RP11-79J17	 3	24	16	06	 32958729	 33107258	 33032993
RP11-79M3	 3	25	16	06	 12138336	 12329145	 12233740
RP11-79M13	 3	 1	17	06	100255383	100402455	100328919
RP11-79I2	 3	 2	17	06	 43435071	 43619796	 43527433
RP11-79L7	 3	 3	17	06	106772705	106949084	106860894
RP11-80B14	 3	 4	17	06	123778064	123943937	123861000
RP11-81B13	 3	 5	17	06	 88549154	 88724237	 88636695
RP11-81H13	 3	 6	17	06	161455552	161627949	161541750
RP11-88D2	 3	 7	17	06	 28581930	 28783688	 28682809
RP11-88H24	 3	 8	17	06	 24927930	 25093844	 25010887
RP11-203C23	 3	 9	17	08	 75089404	 75089730	 75089567
RP11-33D7	 3	10	17	08	 75004089	 75134089	 75069089
RP11-90B7_1	 3	11	17	08	 79496714	 79685067	 79590890
RP11-214E11	 3	12	17	08	 81110313	 81110557	 81110435
RP11-93E11	 3	13	17	08	 81875410	 82031123	 81953266
RP11-118O8	 3	14	17	08	 92998430	 93166789	 93082609
RP11-150N13	 3	15	17	08	126445210	126626507	126535858
RP11-128G18	 3	16	17	08	127751254	127751581	127751417
RP11-237F24	 3	17	17	08	128822386	128822827	128822606
RP11-158G1	 3	18	17	08	133225033	133225412	133225222
RP11-128P9	 3	19	17	08	133561338	133561490	133561414
RP11-88M23	 3	20	17	08	134537164	134537579	134537371
RP11-79E8	 3	21	17	08	130828077	130999919	130913998
RP11-79O20	 3	22	17	08	110047327	110205767	110126547
RP11-79H13	 3	23	17	08	 34946592	 35108516	 35027554
RP11-79I19	 3	24	17	08	  3725983	  3883664	  3804823
RP11-80B8	 3	25	17	08	 11617790	 11803115	 11710452
RP11-80D8	 3	 1	18	08	109289180	109441448	109365314
RP11-89M8_2	 3	 2	18	08	 22779033	 22949883	 22864458
RP11-89O4	 3	 3	18	08	 20596099	 20769457	 20682778
RP11-89F14	 3	 4	18	08	 92441534	 92593423	 92517478
RP11-90G11	 3	 5	18	08	127644127	127820732	127732429
RP11-90G19	 3	 6	18	08	 89002539	 89158439	 89080489
RP11-90B7_2	 3	 7	18	08	 79496714	 79685067	 79590890
RP11-287G20	 3	 8	18	10	106148786	106149115	106148950
RP11-41D21	 3	 9	18	10	108165938	108343479	108254708
RP11-246B13	 3	10	18	10	108916615	109079434	108998024
RP11-182C2	 3	11	18	10	111740417	111829115	111784766
RP11-1I16	 3	12	18	10	113310817	113311159	113310988
RP11-106N20	 3	13	18	10	114856262	115024106	114940184
RP11-47G11	 3	14	18	10	125710218	125859462	125784840
RP11-8O10	 3	15	18	10	127832427	127985179	127908803
RP11-32H11	 3	16	18	10	128657284	128681114	128669199
RP11-31A20	 3	17	18	10	129427475	129565710	129496592
RP11-122K13_1	 3	18	18	10	134947600	135111183	135029391
RP11-27F2	 3	19	18	10	133470856	133471230	133471043
RP11-79A2	 3	20	18	10	 57053261	 57194288	 57123774
RP11-79A18	 3	21	18	10	119176050	119331359	119253704
RP11-79K24	 3	22	18	10	  1302776	  1474060	  1388418
RP11-79H9	 3	23	18	10	  1302790	  1474057	  1388423
RP11-79I23	 3	24	18	10	 60095348	 60270672	 60183010
RP11-80H4	 3	25	18	10	 43603026	 43733026	 43668026
RP11-89H7	 3	 1	19	10	116289991	116445436	116367713
RP11-89J23	 3	 2	19	10	 43432325	 43596132	 43514228
RP11-89J24	 3	 3	19	10	 67131288	 67261288	 67196288
RP11-90E19	 3	 4	19	10	132288410	132445997	132367203
RP11-90D7	 3	 5	19	10	   969751	  1143289	  1056520
RP11-90F7	 3	 6	19	10	 23370639	 23547027	 23458833
RP11-18B8	 3	 7	19	12	 63730862	 63882712	 63806787
RP11-184C7	 3	 8	19	12	 65483115	 65647017	 65565066
RP11-15L3	 3	 9	19	12	 68217524	 68403913	 68310718
RP11-92P22	 3	10	19	12	 74052866	 74222988	 74137927
RP11-230I13	 3	11	19	12	 78276020	 78456697	 78366358
RP11-51M11	 3	12	19	12	 89158341	 89288341	 89223341
RP11-51K17	 3	13	19	12	100260302	100390302	100325302
RP11-3E2	 3	14	19	12	103711124	103711507	103711315
RP11-5O2	 3	15	19	12	102604575	102604940	102604757
RP11-3P19	 3	16	19	12	105448121	105610295	105529208
RP11-110L13	 3	17	19	12	105290197	105453607	105371902
RP11-287D11	 3	18	19	12	108042751	108043088	108042919
RP11-79K20	 3	19	19	12	  1109504	  1284988	  1197246
RP11-80B4	 3	20	19	12	 79644278	 79809802	 79727040
RP11-80N2	 3	21	19	12	 20833481	 21009087	 20921284
RP11-81H3	 3	22	19	12	 72966135	 73144427	 73055281
RP11-81H23	 3	23	19	12	106478655	106648494	106563574
RP11-88F18	 3	24	19	12	 60601465	 60768726	 60685095
RP11-90G3	 3	25	19	12	 69088876	 69258353	 69173614
RP11-90F3	 3	 1	20	12	111019769	111206853	111113311
RP11-90I21	 3	 2	20	12	 41391594	 41543191	 41467392
RP11-90K13	 3	 3	20	12	 30789460	 30963605	 30876532
RP11-90P21	 3	 4	20	12	 58377273	 58526679	 58451976
RP11-91B13	 3	 5	20	12	  4593556	  4745407	  4669481
RP11-81A1	 3	 6	20	15	 77928968	 78080096	 78004532
RP11-58C20	 3	 7	20	15	 82015112	 82186756	 82100934
RP11-43K17	 3	 8	20	15	 83225994	 83355994	 83290994
RP11-60P2	 3	 9	20	15	 85245342	 85429624	 85337483
RP11-185D5	 3	10	20	15	 92238362	 92368362	 92303362
RP11-120N1	 3	11	20	15	 95833746	 95963746	 95898746
RP11-79J21	 3	12	20	15	 74334873	 74499781	 74417327
RP11-80F4	 3	13	20	15	 96495497	 96655554	 96575525
RP11-80J8	 3	14	20	15	 85413252	 85560367	 85486809
RP11-81H5	 3	15	20	15	 44594167	 44774431	 44684299
RP11-81L17	 3	16	20	15	 82048703	 82205904	 82127303
RP11-88D20	 3	17	20	15	 43407777	 43594735	 43501256
RP11-160D13	 3	18	20	16	  6468000	  6603117	  6535558
RP11-142O7	 3	19	20	16	  8346280	  8507334	  8426807
RP11-58M17	 3	20	20	16	  8937209	  9097133	  9017171
RP11-66H6	 3	21	20	16	 10944014	 11111099	 11027556
RP11-165B11	 3	22	20	16	 12029008	 12211311	 12120159
RP11-283M20	 3	23	20	16	 18559573	 18756060	 18657816
RP11-2I4	 3	24	20	16	 54385373	 54394461	 54389917
RP11-106L3	 3	25	20	16	 56696187	 56826187	 56761187
RP11-11E14	 3	 1	21	16	 57249741	 57406601	 57328171
RP11-50C5	 3	 2	21	16	 60251376	 60381376	 60316376
RP11-3I14	 3	 3	21	16	 61098253	 61253550	 61175901
RP11-52B24	 3	 4	21	16	 63708677	 63709059	 63708868
RP11-91H11	 3	 5	21	19	 63223239	 63387841	 63305540
RP11-91O21	 3	 6	21	19	 10656390	 10814419	 10735404
RP11-451E12	 3	 7	21	19	 34159370	 34341241	 34250305
RP11-841N21	 3	 8	21	19	  9248376	  9456899	  9352637
RP11-78P4	 3	 9	21	20	  1872352	  2002352	  1937352
RP11-107L14	 3	10	21	20	  2488182	  2671851	  2580016
RP11-238I2	 3	11	21	20	 13528058	 13658058	 13593058
RP11-51O4	 3	12	21	20	 15546274	 15720420	 15633347
RP11-11O15	 3	13	21	20	 15567962	 15728758	 15648360
RP11-11M17	 3	14	21	20	 17661477	 17835009	 17748243
RP11-7F10	 3	15	21	20	 21609455	 21757443	 21683449
RP11-32N12	 3	16	21	20	 24132287	 24282120	 24207203
RP11-4A12	 3	17	21	20	 41091495	 41175494	 41133494
RP11-69I10	 3	18	21	20	 41467082	 41631733	 41549407
RP11-169A6_1	 3	19	21	20	 43013962	 43172910	 43093436
RP11-109C3	 3	20	21	20	 45531927	 45661927	 45596927
RP11-124D1	 3	21	21	20	 46671728	 46843321	 46757524
RP11-5P14	 3	22	21	20	 48820372	 48995030	 48907701
CTD-2258K15	 3	23	21	20	 34580335	 34710335	 34645335
RP11-79F17	 3	24	21	20	 19057986	 19224591	 19141288
RP11-79K14	 3	25	21	20	 24816861	 24974986	 24895923
RP11-80P6	 3	 1	22	20	 56597433	 56727433	 56662433
RP11-89F13	 3	 2	22	20	 14420247	 14580838	 14500542
RP11-89L20	 3	 3	22	04	129403776	129533776	129468776
RP11-69G7	 3	 4	22	15	 61119454	 61292877	 61206165
RP11-69J7	 3	 5	22	02	230955241	231129940	231042590
RP11-71H17	 3	 6	22	03	125910477	126076548	125993512
RP11-78O10	 3	 7	22	03	 49843915	 50006888	 49925401
RP11-80B9	 3	 8	22	01	237216929	237390563	237303746
RP11-83J21	 3	 9	22	09	130681561	130858027	130769794
RP11-93H5	 3	10	22	16	 64828173	 65032857	 64930515
RP11-95P2_2	 3	11	22	16	  4114616	  4289638	  4202127
RP11-96N16	 3	12	22	10	117796863	117962983	117879923
RP11-98F14	 3	13	22	13	112777671	112939870	112858770
RP11-100A11	 3	14	22	15	 64818092	 64985115	 64901603
RP11-100M22	 3	15	22	18	 46362962	 46552210	 46457586
RP11-115P16	 3	16	22	01	223100771	223281925	223191348
RP11-117C11	 3	17	22	06	 43262021	 43439935	 43350978
RP11-119O22	 3	18	22	15	 78225490	 78397187	 78311338
RP11-121G22	 3	19	22	12	 80085382	 80241706	 80163544
RP11-125F14	 3	20	22	11	 47289748	 47477595	 47383671
RP11-126K1	 3	21	22	01	148001246	148169951	148085598
RP11-140E3	 3	22	22	11	 99053819	 99206521	 99130170
RP11-141K9	 3	23	22	08	 17364531	 17521678	 17443104
RP11-143D15	 3	24	22	08	  6182449	  6365024	  6273736
RP11-147L21	 3	25	22	20	   379480	   549250	   464365
RP11-149B7	 3	 1	23	13	 20826876	 20994706	 20910791
RP11-151D14	 3	 2	23	09	 72713375	 72865094	 72789234
RP11-440G5	 3	 3	23	09	 91210443	 91381341	 91295892
RP11-441F2	 3	 4	23	16	 54805517	 54988902	 54897209
RP11-442P12	 3	 5	23	04	 15412620	 15619251	 15515935
RP11-446K8	 3	 6	23	Y	  1694970	  1842030	  1768500
RP11-449I17	 3	 7	23	10	 30646344	 30857971	 30752157
RP11-455F5	 3	 8	23	16	 29981455	 30174474	 30077964
RP11-466J8	 3	 9	23	20	  2845437	  2975437	  2910437
RP11-467M14	 3	10	23	12	   111317	   269241	   190279
RP11-472H5	 3	11	23	17	 44811769	 44985647	 44898708
RP11-473M20	 3	12	23	16	  2978481	  3158832	  3068656
RP11-478A6	 3	13	23	04	  2483649	  2667192	  2575420
RP11-480D6	 3	14	23	08	 89042460	 89249769	 89146114
RP11-494H4	 3	15	23	03	180900719	181064369	180982544
RP11-495C15	 3	16	23	18	 59104463	 59293404	 59198933
RP11-496I9_1	 3	17	23	11	   446970	   635941	   541455
RP11-498A2	 3	18	23	01	151701110	151880686	151790898
RP11-498C9	 3	19	23	06	120812073	120974386	120893229
RP11-501I18	 3	20	23	06	 42815770	 42914110	 42864940
RP11-517H2	 3	21	23	06	167484798	167586023	167535410
RP11-518C18	 3	22	23	20	  5724709	  5930457	  5827583
RP11-521P1	 3	23	23	17	 29660464	 29841486	 29750975
RP11-523D2	 3	24	23	08	 79633065	 79802910	 79717987
RP11-524F11	 3	25	23	17	 17338140	 17521471	 17429805
RP11-525G7	 3	 1	24	09	120727750	120922549	120825149
RP11-22B10	 3	 2	24	X	 51265318	 51453343	 51359330
RP11-22N19	 3	 3	24	07	105428741	105570154	105499447
RP11-23F23	 3	 4	24	11	  4012521	  4195043	  4103782
RP11-23K2	 3	 5	24	11	 31930962	 32107376	 32019169
RP11-24J23	 3	 6	24	01	 64273330	 64463562	 64368446
RP11-27I22	 3	 7	24	11	107726532	107886151	107806341
RP11-41F22	 3	 8	24	07	 72964684	 73113915	 73039299
RP11-42O4	 3	 9	24	20	 33184582	 33356764	 33270673
RP11-44D11	 3	10	24	05	 39220168	 39422603	 39321385
RP11-45C13	 3	11	24	04	187794113	187948956	187871534
RP11-49P4	 3	12	24	01	 46704885	 46861947	 46783416
RP11-54A1	 3	13	24	18	 46494606	 46672017	 46583311
RP11-67K19	 3	14	24	09	116408129	116563597	116485863
RP11-71A24	 3	15	24	09	 72848272	 73017375	 72932823
RP11-73F12	 3	16	24	03	121047780	121205097	121126438
RP11-79C6_2	 3	17	24	05	 35825919	 35991223	 35908571
RP11-80I15	 3	18	24	09	 94911101	 95069535	 94990318
RP11-82B23	 3	19	24	03	 53150032	 53328628	 53239330
RP11-96C23	 3	20	24	10	 88715604	 88898563	 88807083
RP11-96J19	 3	21	24	06	 53331812	 53502896	 53417354
RP11-100E5	 3	22	24	17	 38762436	 38932045	 38847240
RP11-103G8	 3	23	24	03	151858226	152005328	151931777
RP11-104P21	 3	24	24	01	 32731911	 32908199	 32820055
RP11-106B10	 3	25	24	03	  4740289	  4904842	  4822565
RP11-566J7	 3	 1	25	04	170875029	170875297	170875163
RP11-569D9_1	 3	 2	25	13	113930806	114103243	114017024
RP11-571L19	 3	 3	25	04	100195057	100403797	100299427
RP11-573G6	 3	 4	25	10	 22573926	 22712022	 22642974
RP11-575L7	 3	 5	25	09	 83643577	 83833156	 83738366
RP11-586A2	 3	 6	25	04	 55371429	 55501429	 55436429
RP11-48J15	 3	 7	25	Y	  2734459	  2761900	  2748179
RP11-115H13	 3	 8	25	Y	  6735814	  6903088	  6819451
RP11-91A13_1	 3	 9	25	Y	 16855741	 17005408	 16930574
RP11-135H9	 3	10	25	Y	 17442232	 17604405	 17523318
RP11-20H21	 3	11	25	Y	 19227852	 19400388	 19314120
RP11-214M24	 3	12	25	Y	 25135463	 25220735	 25178099
RP11-137N24	 4	 1	 1	01	171853400	171983400	171918400
RP11-212K9	 4	 2	 1	01	179605151	179605500	179605325
RP11-118P13	 4	 3	 1	01	181886466	182046994	181966730
RP11-134C1	 4	 4	 1	01	184717073	184882953	184800013
RP11-154A22	 4	 5	 1	01	191988230	191988520	191988375
RP11-150L7	 4	 6	 1	01	197877387	198042003	197959695
RP11-104A2	 4	 7	 1	01	206402345	206590859	206496602
RP11-216F1	 4	 8	 1	01	208471580	208471938	208471759
RP11-74E6	 4	 9	 1	01	210921577	211051577	210986577
RP11-131M16	 4	10	 1	01	212527448	212527757	212527602
RP11-66M7	 4	11	 1	01	213531712	213695638	213613675
RP11-149C8	 4	12	 1	01	218544610	218545004	218544807
CTD-2122L24	 4	13	 1	01	142916565	143041235	142978900
CTD-2148O23	 4	14	 1	01	223279841	223409841	223344841
CTD-2244D23	 4	15	 1	01	151921064	152051064	151986064
RP11-79A19	 4	16	 1	01	114664772	114794772	114729772
RP11-79C7	 4	17	 1	01	167099574	167266405	167182989
RP11-79I7	 4	18	 1	01	182043937	182213605	182128771
RP11-80L2	 4	19	 1	10	 41703293	 41920110	 41811701
RP11-80N24	 4	20	 1	01	195477228	195629725	195553476
RP11-81B15	 4	21	 1	01	149228563	149416975	149322769
RP11-81H19	 4	22	 1	01	168115663	168306098	168210880
RP11-81J3	 4	23	 1	10	 41703983	 41716931	 41710457
RP11-81J7	 4	24	 1	01	  8902538	  9032538	  8967538
RP11-206J15	 4	25	 1	02	240619075	240776899	240697987
RP11-204C23	 4	 1	 2	03	  1859870	  2026056	  1942963
RP11-129L14	 4	 2	 2	03	  2675495	  2675754	  2675624
RP11-28P14	 4	 3	 2	03	  6823289	  7009709	  6916499
RP11-175G7	 4	 4	 2		NA	NA	NA
RP11-121D3	 4	 5	 2		NA	NA	NA
RP11-122D19	 4	 6	 2	03	 54007388	 54188449	 54097918
RP11-189K9	 4	 7	 2	03	 54570694	 54737275	 54653984
RP11-169G24	 4	 8	 2	03	 56171548	 56352991	 56262269
RP11-229A12	 4	 9	 2	03	 57370433	 57534933	 57452683
RP11-94D19	 4	10	 2	03	 60756956	 60927079	 60842017
RP11-108A8	 4	11	 2	03	 63254907	 63396359	 63325633
RP11-214A5	 4	12	 2	03	116606843	116607148	116606995
RP11-165B13	 4	13	 2	03	119084427	119243600	119164013
RP11-169N13_1	 4	14	 2	03	120926479	121091572	121009025
RP11-95H16	 4	15	 2	03	125533569	125716603	125625086
RP11-59J16	 4	16	 2	03	128599467	128752054	128675760
RP11-219P10	 4	17	 2	03	137606244	137606550	137606397
RP11-264D7	 4	18	 2	03	168566878	168739953	168653415
RP11-141C22	 4	19	 2	03	170366497	170543979	170455238
RP11-163H6	 4	20	 2	03	173181079	173348030	173264554
RP11-172G5	 4	21	 2	03	174558909	174688909	174623909
RP11-114M1	 4	22	 2	03	178755564	178913010	178834287
RP11-125E8_1	 4	23	 2	03	185459125	185625829	185542477
RP11-79M16	 4	24	 2	04	 78985846	 79125087	 79055466
RP11-79J7	 4	25	 2	04	157409699	157549396	157479547
RP11-80P12	 4	 1	 3	04	132462884	132619703	132541293
RP11-81H11	 4	 2	 3	04	 31647084	 31828210	 31737647
RP11-81L15	 4	 3	 3	04	 14647093	 14811519	 14729306
RP11-81N11	 4	 4	 3	04	 34599887	 34749291	 34674589
RP11-89I24_2	 4	 5	 3	04	140215007	140355384	140285195
RP11-89M12	 4	 6	 3	04	 68241176	 68391970	 68316573
RP11-89D9	 4	 7	 3	04	126766858	126923504	126845181
RP11-89F11	 4	 8	 3	04	 80685289	 80848094	 80766691
RP11-89B16	 4	 9	 3	04	 54485239	 54640563	 54562901
RP11-89D22	 4	10	 3	04	 24421460	 24551460	 24486460
RP11-91F19	 4	11	 3	04	 42717355	 42888284	 42802819
RP11-91J11	 4	12	 3	04	 84692317	 84854250	 84773283
RP11-91I19	 4	13	 3	04	144177822	144348489	144263155
RP11-91O14	 4	14	 3	04	115919650	116069676	115994663
RP11-91E23	 4	15	 3	04	112736421	112882443	112809432
RP11-91C2	 4	16	 3	04	105541341	105705683	105623512
RP11-35K22	 4	17	 3	05	  5802650	  5955704	  5879177
RP11-46O23	 4	18	 3	05	  7387129	  7517129	  7452129
RP11-72C10	 4	19	 3	05	 10644125	 10774125	 10709125
RP11-5N8	 4	20	 3	05	 14926849	 15108182	 15017515
RP11-261B20	 4	21	 3	05	 15744574	 15874574	 15809574
RP11-260E18	 4	22	 3	05	 16623362	 16775431	 16699396
RP11-90O11	 4	23	 3	06	101893295	102051789	101972542
RP11-91B17	 4	24	 3	06	108376797	108553128	108464962
RP11-91H17	 4	25	 3	06	 23938649	 24098124	 24018386
RP11-91I3	 4	 1	 4	06	157434204	157614749	157524476
RP11-91C13	 4	 2	 4	06	  7506204	  7657448	  7581826
RP11-91C23	 4	 3	 4	06	115531393	115684742	115608067
RP11-128J9	 4	 4	 4	07	  9848493	  9848893	  9848693
RP11-173P9	 4	 5	 4	07	 17370306	 17509726	 17440016
RP11-51L23	 4	 6	 4	07	 18504006	 18679696	 18591851
RP11-71F18	 4	 7	 4	07	 19209283	 19394202	 19301742
RP11-243C6	 4	 8	 4	07	 22486975	 22680945	 22583960
RP11-66O14	 4	 9	 4	07	 25938483	 26068483	 26003483
RP11-15M23	 4	10	 4	07	 40896698	 40896963	 40896830
RP11-100C21	 4	11	 4	07	 42454349	 42617046	 42535697
RP11-52M17	 4	12	 4	07	 44282942	 44464049	 44373495
RP11-126K7	 4	13	 4	07	 45862816	 46016704	 45939760
RP11-217O10	 4	14	 4	07	 45530784	 45531015	 45530899
RP11-271O10	 4	15	 4	07	 47166667	 47167023	 47166845
RP11-170H15	 4	16	 4	07	 68659462	 68813002	 68736232
RP11-35P20	 4	17	 4	07	 71464807	 71637730	 71551268
RP11-137E8	 4	18	 4	07	 73389370	 73574238	 73481804
RP11-56C16	 4	19	 4	07	 77730075	 77730388	 77730231
RP11-115O3	 4	20	 4	07	 80153319	 80301255	 80227287
RP11-126A20	 4	21	 4	07	 82641745	 82808335	 82725040
RP11-91K1	 4	22	 4	08	110271946	110446235	110359090
RP11-91O11	 4	23	 4	08	102107868	102268083	102187975
RP11-91K2	 4	24	 4	08	 87443086	 87618908	 87530997
RP11-449D3	 4	25	 4	08	138066482	138225333	138145907
RP11-451M4	 4	 1	 5	08	  5973492	  6132222	  6052857
RP11-122A20	 4	 2	 5	09	  2611542	  2741542	  2676542
RP11-139G9	 4	 3	 5	08	 31062086	 31192086	 31127086
RP11-61D22	 4	 4	 5	09	 19584555	 19732337	 19658446
RP11-85J5	 4	 5	 5	09	 24524208	 24524427	 24524317
RP11-235F7	 4	 6	 5	09	 27452822	 27582822	 27517822
RP11-18A21	 4	 7	 5	09	 30768614	 30768974	 30768794
RP11-141J7	 4	 8	 5	09	 32325652	 32469400	 32397526
RP11-19O14	 4	 9	 5	09	 70455465	 70634947	 70545206
RP11-54O21	 4	10	 5	09	 72890997	 73020997	 72955997
RP11-116C10	 4	11	 5	09	123488195	123618195	123553195
RP11-96B7	 4	12	 5	09	 76307470	 76465054	 76386262
RP11-136M18	 4	13	 5	09	 77172311	 77326811	 77249561
RP11-31D18	 4	14	 5	09	 79625511	 79786507	 79706009
RP11-31N23	 4	15	 5	09	 89643978	 89644182	 89644080
RP11-95G21	 4	16	 5	09	 90885967	 91053840	 90969903
RP11-77D21	 4	17	 5	09	 92194493	 92350847	 92272670
RP11-128O12	 4	18	 5	09	 93288026	 93288287	 93288156
RP11-223A21	 4	19	 5	09	 94301758	 94302252	 94302005
RP11-34J23	 4	20	 5	09	 95123337	 95306596	 95214966
RP11-91K20	 4	21	 5	10	  8343520	  8498294	  8420907
RP11-91A1	 4	22	 5	10	 72033907	 72202069	 72117988
RP11-91C1	 4	23	 5	03	110923823	111115657	111019740
RP11-91C12	 4	24	 5	10	 29523208	 29688334	 29605771
RP11-91E2	 4	25	 5	10	135150439	135301208	135225823
RP11-120E20	 4	 1	 6	11	  3573460	  3758006	  3665733
RP11-21L19	 4	 2	 6	11	 14198466	 14382320	 14290393
RP11-39F19	 4	 3	 6	11	 14877934	 15064654	 14971294
RP11-79N15_1	 4	 4	 6	11	 15256088	 15424709	 15340398
RP11-13O19	 4	 5	 6	11	 19253116	 19415680	 19334398
RP11-89P14_1	 4	 6	 6	11	 18150643	 18280643	 18215643
RP11-62G18	 4	 7	 6	11	 19588593	 19763723	 19676158
RP11-102C11	 4	 8	 6	11	 33531085	 33705184	 33618134
RP11-3E12	 4	 9	 6	11	 34624001	 34624268	 34624134
RP11-103P20	 4	10	 6	11	 36021056	 36180792	 36100924
RP11-187A8	 4	11	 6	11	 36546150	 36552398	 36549274
RP11-114G6	 4	12	 6	11	 40333699	 40489667	 40411683
RP11-14K17	 4	13	 6	11	 39708284	 39868896	 39788590
RP11-217G11	 4	14	 6	11	 56609800	 56610186	 56609993
RP11-75H24	 4	15	 6	11	 58480720	 58632565	 58556642
RP11-49D19	 4	16	 6	11	 62270859	 62448065	 62359462
RP11-20K4	 4	17	 6	11	 67021831	 67228670	 67125250
RP11-15L8	 4	18	 6	11	 66379947	 66562716	 66471331
RP11-278A17	 4	19	 6	11	 69333916	 69334253	 69334084
RP11-451A12	 4	20	 6	12	107617696	107797398	107707547
RP11-451M6	 4	21	 6	12	  6716750	  6846750	  6781750
RP11-87E7	 4	22	 6	13	 22802262	 22802731	 22802496
RP11-204D11	 4	23	 6	13	 24246271	 24414884	 24330577
RP11-35M5	 4	24	 6	13	 27534229	 27697746	 27615987
RP11-7G2	 4	25	 6	13	 26634101	 26811563	 26722832
RP11-120G8	 4	 1	 7	13	 47457205	 47629816	 47543510
RP11-58C16	 4	 2	 7	13	 50061416	 50191416	 50126416
RP11-93H24	 4	 3	 7	13	 52110495	 52275611	 52193053
RP11-205J24	 4	 4	 7	13	 56820212	 56820599	 56820405
RP11-205C23	 4	 5	 7	13	 72218390	 72348390	 72283390
RP11-11C5	 4	 6	 7	13	 72013886	 72183774	 72098830
RP11-100A3	 4	 7	 7	13	 93718513	 93876914	 93797713
RP11-14C20	 4	 8	 7	13	 97158695	 97158949	 97158822
RP11-122A8	 4	 9	 7	13	 98471181	 98644517	 98557849
RP11-113F15	 4	10	 7	13	 99160038	 99328275	 99244156
RP11-29B2_1	 4	11	 7	13	102007251	102165732	102086491
RP11-25E13	 4	12	 7	13	105615921	105795472	105705696
RP11-79I4_2	 4	13	 7	13	 73284060	 73462828	 73373444
RP11-79H7	 4	14	 7	13	 89731121	 89905878	 89818499
RP11-80H2	 4	15	 7	13	 49778489	 49931985	 49855237
RP11-80N10	 4	16	 7	13	 80203303	 80367022	 80285162
RP11-81D9	 4	17	 7	13	 72702354	 72871439	 72786896
RP11-81F11	 4	18	 7	13	 32572850	 32739179	 32656014
RP11-36N1	 4	19	 7	16	 70520162	 70520352	 70520257
RP11-253O10	 4	20	 7	16	 74101075	 74101477	 74101276
RP11-12H11	 4	21	 7	16	 75715649	 75868868	 75792258
RP11-284G2	 4	22	 7	16	 77311882	 77350316	 77331099
RP11-1B11	 4	23	 7	16	 80565336	 80727266	 80646301
RP11-162I18	 4	24	 7	16	 82299929	 82429929	 82364929
RP11-79E15	 4	25	 7	16	 56952486	 57122502	 57037494
RP11-79M18	 4	 1	 8	16	  7681171	  7857876	  7769523
RP11-79F19	 4	 2	 8	16	 26366610	 26527801	 26447205
RP11-80F22	 4	 3	 8	16	 34476094	 34627143	 34551618
RP11-81D3	 4	 4	 8	16	 52980348	 53003525	 52991936
RP11-81L5	 4	 5	 8	16	 81623771	 81784852	 81704311
RP11-90L19	 4	 6	 8	16	 70848591	 71029614	 70939102
RP11-91M7	 4	 7	 8	16	 14350354	 14529445	 14439899
CTA-388D4	 4	 8	 8	16	 12308331	 12558585	 12433458
CTA-521A12	 4	 9	 8	16	 19201063	 19316419	 19258741
CTA-589H1	 4	10	 8		NA	NA	NA
CTA-951C11	 4	11	 8	16	 27465281	 27579690	 27522485
RP11-545E2	 4	12	 8	16	 47399763	 47620322	 47510042
RP11-71H6	 4	13	 8	02	240992390	241148248	241070319
RP11-61B16	 4	14	 8	17	   586010	   740037	   663023
RP11-135N5	 4	15	 8	17	  2312021	  2492178	  2402099
RP11-61B20	 4	16	 8	17	  6780962	  6943107	  6862034
RP11-55C13	 4	17	 8	17	  8338030	  8524677	  8431353
RP11-451G10	 4	18	 8	20	 35432771	 35617003	 35524887
RP11-31B6_1	 4	19	 8	21	 14998564	 15152259	 15075411
RP11-181G18	 4	20	 8	21	 16651613	 16651846	 16651729
RP11-15E10	 4	21	 8	21	 18595720	 18774434	 18685077
RP11-86J21	 4	22	 8	21	 22224957	 22225289	 22225123
RP11-13J15	 4	23	 8	21	 24034431	 24189219	 24111825
RP11-96H21	 4	24	 8	21	 30854753	 31025100	 30939926
RP11-147H1	 4	25	 8	21	 32218203	 32372918	 32295560
RP11-54F16	 4	 1	 9	21	 32694021	 32849422	 32771721
RP11-125H1	 4	 2	 9	21	 31282582	 31446878	 31364730
RP11-14B21_1	 4	 3	 9	21	 31204588	 31376316	 31290452
RP11-17O20	 4	 4	 9	21	 35229244	 35371851	 35300547
RP11-79A12	 4	 5	 9	21	 34660646	 34819795	 34740220
RP11-80N20	 4	 6	 9	21	 23885286	 24051119	 23968202
RP11-88N2_1	 4	 7	 9	21	 43556393	 43769964	 43663178
RP11-89M24	 4	 8	 9	21	 15643938	 15819543	 15731740
RP11-89H21	 4	 9	 9	21	 14850741	 14980741	 14915741
RP11-90A17	 4	10	 9	21	 27718667	 27867189	 27792928
RP11-70F2	 4	11	 9	22	 31533925	 31692227	 31613076
RP11-129B19	 4	12	 9	22	 33335911	 33336242	 33336076
RP11-62G2	 4	13	 9	22	 34595999	 34596413	 34596206
RP11-35I10	 4	14	 9	22	 35234422	 35364422	 35299422
RP11-108C6	 4	15	 9	22	 37253448	 37415719	 37334583
RP11-206B19	 4	16	 9	22	 40564358	 40564705	 40564531
RP11-169A6_2	 4	17	 9	20	 43013962	 43172910	 43093436
RP11-169L20	 4	18	 9	02	 24763123	 24933828	 24848475
RP11-173B14	 4	19	 9	13	 74961989	 75145347	 75053668
RP11-174N3	 4	20	 9	06	 35124982	 35280521	 35202751
RP11-176F3	 4	21	 9	09	 33786695	 33979975	 33883335
RP11-179A7	 4	22	 9	13	 33124196	 33309798	 33216997
RP11-200O9	 4	23	 9	06	 37222629	 37397263	 37309946
RP11-202B22	 4	24	 9	02	 20306606	 20456683	 20381644
RP11-204B7	 4	25	 9	06	 18145655	 18315634	 18230644
RP11-204L3	 4	 1	10	01	 39969518	 40094411	 40031964
RP11-205M20	 4	 2	10	09	 32452044	 32607629	 32529836
RP11-206N24	 4	 3	10	07	136364842	136546791	136455816
RP11-219B4	 4	 4	10	08	 86197049	 86357332	 86277190
RP11-223M6	 4	 5	10	02	215383382	215577686	215480534
RP11-229D13	 4	 6	10	07	 75230225	 75326524	 75278374
RP11-230F18	 4	 7	10	13	113166604	113351493	113259048
RP11-231D20	 4	 8	10	08	 42145139	 42333716	 42239427
RP11-232P16	 4	 9	10	05	 66396407	 66526407	 66461407
RP11-255G5	 4	10	10	11	 44920274	 45034232	 44977253
RP11-258B17	 4	11	10	02	133116845	133304518	133210681
RP11-260J21	 4	12	10	02	237157330	237338113	237247721
RP11-261P4	 4	13	10		NA	NA	NA
RP11-263C6	 4	14	10	08	 28927774	 29094532	 29011153
RP11-264F23	 4	15	10	12	  4187701	  4341718	  4264709
RP11-540P6	 4	16	10	22	 35750202	 35930534	 35840368
RP11-542K23	 4	17	10	09	122229517	122423453	122326485
RP11-544L8	 4	18	10	06	114200748	114383739	114292243
RP11-547D14	 4	19	10	16	 11531985	 11680350	 11606167
RP11-550J21	 4	20	10	09	128534863	128543247	128539055
RP11-551E2	 4	21	10	10	104538662	104712421	104625541
RP11-571M6	 4	22	10	12	 56286136	 56497675	 56391905
RP11-574O17	 4	23	10	02	 96209274	 96355192	 96282233
RP11-576C12	 4	24	10	09	112405631	112481745	112443688
RP11-577G20	 4	25	10	04	 59100490	 59286047	 59193268
RP11-594N15	 4	 1	11	08	 79545493	 79728349	 79636921
RP11-600K23	 4	 2	11	07	 30244330	 30374330	 30309330
RP11-627M5	 4	 3	11	05	176292860	176476422	176384641
RP11-629B4	 4	 4	11	02	191614090	191776561	191695325
RP11-62N23_1	 4	 5	11	17	 34979166	 35136396	 35057781
RP11-640P3	 4	 6	11	03	188891939	189083483	188987711
RP11-647O5	 4	 7	11	02	219556999	219612589	219584794
RP11-651M4	 4	 8	11	11	 27616023	 27784098	 27700060
RP11-678N8	 4	 9	11	05	138924976	139128791	139026883
RP11-680A7	 4	10	11	11	118644724	118829605	118737164
RP11-684M15	 4	11	11	11	 57026337	 57202367	 57114352
RP11-686P6	 4	12	11	20	  4962138	  5153894	  5058016
RP11-691N7	 4	13	11	11	 57196034	 57354107	 57275070
RP11-692J20	 4	14	11	01	 28151477	 28352697	 28252087
RP11-120D12	 4	15	11	01	154501690	154652686	154577188
RP11-122M14	 4	16	11	01	208224523	208389429	208306976
RP11-124B17	 4	17	11	13	 93876917	 94036921	 93956919
RP11-125K7	 4	18	11	11	 65316468	 65478939	 65397703
RP11-129M16	 4	19	11	10	118991885	119096596	119044240
RP11-132G19	 4	20	11	01	 21794664	 21969826	 21882245
RP11-162H11	 4	21	11	01	175039955	175196015	175117985
RP11-163O17	 4	22	11	04	 84140937	 84328297	 84234617
RP11-164B11	 4	23	11	12	 15584950	 15773224	 15679087
RP11-165J3	 4	24	11	09	 93149580	 93300391	 93224985
RP11-166P13	 4	25	11	17	 52394700	 52568150	 52481425
RP11-170N16	 4	 1	12	04	124088844	124267761	124178302
RP11-191A7	 4	 2	12	07	111661569	111821990	111741779
RP11-197M22	 4	 3	12	10	 16649252	 16818173	 16733712
RP11-203F10	 4	 4	12	01	200861804	201051225	200956514
RP11-208G24	 4	 5	12	09	 86727019	 86851352	 86789185
RP11-211N11	 4	 6	12	10	115449555	115624331	115536943
RP11-214J9	 4	 7	12	02	 26184731	 26365941	 26275336
RP11-247A12	 4	 8	12	09	128934352	129096797	129015574
RP11-250E14_2	 4	 9	12	16	 55893719	 56094253	 55993986
RP11-252K7	 4	10	12	02	160826503	160977144	160901823
RP11-254F7	 4	11	12	02	 10059526	 10223098	 10141312
RP11-259G7	 4	12	12	04	154996598	155197703	155097150
RP11-259O18	 4	13	12	12	  8894906	  9067837	  8981371
RP11-589N15	 4	14	12	08	 11627381	 11803128	 11715254
RP11-594C8	 4	15	12		NA	NA	NA
RP11-600P18	 4	16	12	03	152311793	152495652	152403722
RP11-603J24	 4	17	12	12	 54649146	 54841349	 54745247
RP11-621J12	 4	18	12	12	 52777050	 52938758	 52857904
RP11-624G17	 4	19	12	11	 56953549	 57164109	 57058829
RP11-88F4	 4	20	12		NA	NA	NA
RP11-91N9	 4	21	12	Y	 12781276	 12942571	 12861923
CTC-232B23	 4	22	12	01	  1036980	  1037083	  1037031
CTB-8L3	 4	23	12	02	   322536	   322710	   322623
CTC-228K22	 4	24	12	03	   231485	   231767	   231626
CTB-118B13	 4	25	12	04	   101785	   101886	   101835
RP11-137N24	 4	13	13	01	171853400	171983400	171918400
RP11-212K9	 4	14	13	01	179605151	179605500	179605325
RP11-118P13	 4	15	13	01	181886466	182046994	181966730
RP11-134C1	 4	16	13	01	184717073	184882953	184800013
RP11-154A22	 4	17	13	01	191988230	191988520	191988375
RP11-150L7	 4	18	13	01	197877387	198042003	197959695
RP11-104A2	 4	19	13	01	206402345	206590859	206496602
RP11-216F1	 4	20	13	01	208471580	208471938	208471759
RP11-74E6	 4	21	13	01	210921577	211051577	210986577
RP11-131M16	 4	22	13	01	212527448	212527757	212527602
RP11-66M7	 4	23	13	01	213531712	213695638	213613675
RP11-149C8	 4	24	13	01	218544610	218545004	218544807
CTD-2122L24	 4	25	13	01	142916565	143041235	142978900
CTD-2148O23	 4	 1	14	01	223279841	223409841	223344841
CTD-2244D23	 4	 2	14	01	151921064	152051064	151986064
RP11-79A19	 4	 3	14	01	114664772	114794772	114729772
RP11-79C7	 4	 4	14	01	167099574	167266405	167182989
RP11-79I7	 4	 5	14	01	182043937	182213605	182128771
RP11-80L2	 4	 6	14	10	 41703293	 41920110	 41811701
RP11-80N24	 4	 7	14	01	195477228	195629725	195553476
RP11-81B15	 4	 8	14	01	149228563	149416975	149322769
RP11-81H19	 4	 9	14	01	168115663	168306098	168210880
RP11-81J3	 4	10	14	10	 41703983	 41716931	 41710457
RP11-81J7	 4	11	14	01	  8902538	  9032538	  8967538
RP11-206J15	 4	12	14	02	240619075	240776899	240697987
RP11-204C23	 4	13	14	03	  1859870	  2026056	  1942963
RP11-129L14	 4	14	14	03	  2675495	  2675754	  2675624
RP11-28P14	 4	15	14	03	  6823289	  7009709	  6916499
RP11-175G7	 4	16	14		NA	NA	NA
RP11-121D3	 4	17	14		NA	NA	NA
RP11-122D19	 4	18	14	03	 54007388	 54188449	 54097918
RP11-189K9	 4	19	14	03	 54570694	 54737275	 54653984
RP11-169G24	 4	20	14	03	 56171548	 56352991	 56262269
RP11-229A12	 4	21	14	03	 57370433	 57534933	 57452683
RP11-94D19	 4	22	14	03	 60756956	 60927079	 60842017
RP11-108A8	 4	23	14	03	 63254907	 63396359	 63325633
RP11-214A5	 4	24	14	03	116606843	116607148	116606995
RP11-165B13	 4	25	14	03	119084427	119243600	119164013
RP11-169N13_1	 4	 1	15	03	120926479	121091572	121009025
RP11-95H16	 4	 2	15	03	125533569	125716603	125625086
RP11-59J16	 4	 3	15	03	128599467	128752054	128675760
RP11-219P10	 4	 4	15	03	137606244	137606550	137606397
RP11-264D7	 4	 5	15	03	168566878	168739953	168653415
RP11-141C22	 4	 6	15	03	170366497	170543979	170455238
RP11-163H6	 4	 7	15	03	173181079	173348030	173264554
RP11-172G5	 4	 8	15	03	174558909	174688909	174623909
RP11-114M1	 4	 9	15	03	178755564	178913010	178834287
RP11-125E8_1	 4	10	15	03	185459125	185625829	185542477
RP11-79M16	 4	11	15	04	 78985846	 79125087	 79055466
RP11-79J7	 4	12	15	04	157409699	157549396	157479547
RP11-80P12	 4	13	15	04	132462884	132619703	132541293
RP11-81H11	 4	14	15	04	 31647084	 31828210	 31737647
RP11-81L15	 4	15	15	04	 14647093	 14811519	 14729306
RP11-81N11	 4	16	15	04	 34599887	 34749291	 34674589
RP11-89I24_2	 4	17	15	04	140215007	140355384	140285195
RP11-89M12	 4	18	15	04	 68241176	 68391970	 68316573
RP11-89D9	 4	19	15	04	126766858	126923504	126845181
RP11-89F11	 4	20	15	04	 80685289	 80848094	 80766691
RP11-89B16	 4	21	15	04	 54485239	 54640563	 54562901
RP11-89D22	 4	22	15	04	 24421460	 24551460	 24486460
RP11-91F19	 4	23	15	04	 42717355	 42888284	 42802819
RP11-91J11	 4	24	15	04	 84692317	 84854250	 84773283
RP11-91I19	 4	25	15	04	144177822	144348489	144263155
RP11-91O14	 4	 1	16	04	115919650	116069676	115994663
RP11-91E23	 4	 2	16	04	112736421	112882443	112809432
RP11-91C2	 4	 3	16	04	105541341	105705683	105623512
RP11-35K22	 4	 4	16	05	  5802650	  5955704	  5879177
RP11-46O23	 4	 5	16	05	  7387129	  7517129	  7452129
RP11-72C10	 4	 6	16	05	 10644125	 10774125	 10709125
RP11-5N8	 4	 7	16	05	 14926849	 15108182	 15017515
RP11-261B20	 4	 8	16	05	 15744574	 15874574	 15809574
RP11-260E18	 4	 9	16	05	 16623362	 16775431	 16699396
RP11-90O11	 4	10	16	06	101893295	102051789	101972542
RP11-91B17	 4	11	16	06	108376797	108553128	108464962
RP11-91H17	 4	12	16	06	 23938649	 24098124	 24018386
RP11-91I3	 4	13	16	06	157434204	157614749	157524476
RP11-91C13	 4	14	16	06	  7506204	  7657448	  7581826
RP11-91C23	 4	15	16	06	115531393	115684742	115608067
RP11-128J9	 4	16	16	07	  9848493	  9848893	  9848693
RP11-173P9	 4	17	16	07	 17370306	 17509726	 17440016
RP11-51L23	 4	18	16	07	 18504006	 18679696	 18591851
RP11-71F18	 4	19	16	07	 19209283	 19394202	 19301742
RP11-243C6	 4	20	16	07	 22486975	 22680945	 22583960
RP11-66O14	 4	21	16	07	 25938483	 26068483	 26003483
RP11-15M23	 4	22	16	07	 40896698	 40896963	 40896830
RP11-100C21	 4	23	16	07	 42454349	 42617046	 42535697
RP11-52M17	 4	24	16	07	 44282942	 44464049	 44373495
RP11-126K7	 4	25	16	07	 45862816	 46016704	 45939760
RP11-217O10	 4	 1	17	07	 45530784	 45531015	 45530899
RP11-271O10	 4	 2	17	07	 47166667	 47167023	 47166845
RP11-170H15	 4	 3	17	07	 68659462	 68813002	 68736232
RP11-35P20	 4	 4	17	07	 71464807	 71637730	 71551268
RP11-137E8	 4	 5	17	07	 73389370	 73574238	 73481804
RP11-56C16	 4	 6	17	07	 77730075	 77730388	 77730231
RP11-115O3	 4	 7	17	07	 80153319	 80301255	 80227287
RP11-126A20	 4	 8	17	07	 82641745	 82808335	 82725040
RP11-91K1	 4	 9	17	08	110271946	110446235	110359090
RP11-91O11	 4	10	17	08	102107868	102268083	102187975
RP11-91K2	 4	11	17	08	 87443086	 87618908	 87530997
RP11-449D3	 4	12	17	08	138066482	138225333	138145907
RP11-451M4	 4	13	17	08	  5973492	  6132222	  6052857
RP11-122A20	 4	14	17	09	  2611542	  2741542	  2676542
RP11-139G9	 4	15	17	08	 31062086	 31192086	 31127086
RP11-61D22	 4	16	17	09	 19584555	 19732337	 19658446
RP11-85J5	 4	17	17	09	 24524208	 24524427	 24524317
RP11-235F7	 4	18	17	09	 27452822	 27582822	 27517822
RP11-18A21	 4	19	17	09	 30768614	 30768974	 30768794
RP11-141J7	 4	20	17	09	 32325652	 32469400	 32397526
RP11-19O14	 4	21	17	09	 70455465	 70634947	 70545206
RP11-54O21	 4	22	17	09	 72890997	 73020997	 72955997
RP11-116C10	 4	23	17	09	123488195	123618195	123553195
RP11-96B7	 4	24	17	09	 76307470	 76465054	 76386262
RP11-136M18	 4	25	17	09	 77172311	 77326811	 77249561
RP11-31D18	 4	 1	18	09	 79625511	 79786507	 79706009
RP11-31N23	 4	 2	18	09	 89643978	 89644182	 89644080
RP11-95G21	 4	 3	18	09	 90885967	 91053840	 90969903
RP11-77D21	 4	 4	18	09	 92194493	 92350847	 92272670
RP11-128O12	 4	 5	18	09	 93288026	 93288287	 93288156
RP11-223A21	 4	 6	18	09	 94301758	 94302252	 94302005
RP11-34J23	 4	 7	18	09	 95123337	 95306596	 95214966
RP11-91K20	 4	 8	18	10	  8343520	  8498294	  8420907
RP11-91A1	 4	 9	18	10	 72033907	 72202069	 72117988
RP11-91C1	 4	10	18	03	110923823	111115657	111019740
RP11-91C12	 4	11	18	10	 29523208	 29688334	 29605771
RP11-91E2	 4	12	18	10	135150439	135301208	135225823
RP11-120E20	 4	13	18	11	  3573460	  3758006	  3665733
RP11-21L19	 4	14	18	11	 14198466	 14382320	 14290393
RP11-39F19	 4	15	18	11	 14877934	 15064654	 14971294
RP11-79N15_1	 4	16	18	11	 15256088	 15424709	 15340398
RP11-13O19	 4	17	18	11	 19253116	 19415680	 19334398
RP11-89P14_1	 4	18	18	11	 18150643	 18280643	 18215643
RP11-62G18	 4	19	18	11	 19588593	 19763723	 19676158
RP11-102C11	 4	20	18	11	 33531085	 33705184	 33618134
RP11-3E12	 4	21	18	11	 34624001	 34624268	 34624134
RP11-103P20	 4	22	18	11	 36021056	 36180792	 36100924
RP11-187A8	 4	23	18	11	 36546150	 36552398	 36549274
RP11-114G6	 4	24	18	11	 40333699	 40489667	 40411683
RP11-14K17	 4	25	18	11	 39708284	 39868896	 39788590
RP11-217G11	 4	 1	19	11	 56609800	 56610186	 56609993
RP11-75H24	 4	 2	19	11	 58480720	 58632565	 58556642
RP11-49D19	 4	 3	19	11	 62270859	 62448065	 62359462
RP11-20K4	 4	 4	19	11	 67021831	 67228670	 67125250
RP11-15L8	 4	 5	19	11	 66379947	 66562716	 66471331
RP11-278A17	 4	 6	19	11	 69333916	 69334253	 69334084
RP11-451A12	 4	 7	19	12	107617696	107797398	107707547
RP11-451M6	 4	 8	19	12	  6716750	  6846750	  6781750
RP11-87E7	 4	 9	19	13	 22802262	 22802731	 22802496
RP11-204D11	 4	10	19	13	 24246271	 24414884	 24330577
RP11-35M5	 4	11	19	13	 27534229	 27697746	 27615987
RP11-7G2	 4	12	19	13	 26634101	 26811563	 26722832
RP11-120G8	 4	13	19	13	 47457205	 47629816	 47543510
RP11-58C16	 4	14	19	13	 50061416	 50191416	 50126416
RP11-93H24	 4	15	19	13	 52110495	 52275611	 52193053
RP11-205J24	 4	16	19	13	 56820212	 56820599	 56820405
RP11-205C23	 4	17	19	13	 72218390	 72348390	 72283390
RP11-11C5	 4	18	19	13	 72013886	 72183774	 72098830
RP11-100A3	 4	19	19	13	 93718513	 93876914	 93797713
RP11-14C20	 4	20	19	13	 97158695	 97158949	 97158822
RP11-122A8	 4	21	19	13	 98471181	 98644517	 98557849
RP11-113F15	 4	22	19	13	 99160038	 99328275	 99244156
RP11-29B2_1	 4	23	19	13	102007251	102165732	102086491
RP11-25E13	 4	24	19	13	105615921	105795472	105705696
RP11-79I4_2	 4	25	19	13	 73284060	 73462828	 73373444
RP11-79H7	 4	 1	20	13	 89731121	 89905878	 89818499
RP11-80H2	 4	 2	20	13	 49778489	 49931985	 49855237
RP11-80N10	 4	 3	20	13	 80203303	 80367022	 80285162
RP11-81D9	 4	 4	20	13	 72702354	 72871439	 72786896
RP11-81F11	 4	 5	20	13	 32572850	 32739179	 32656014
RP11-36N1	 4	 6	20	16	 70520162	 70520352	 70520257
RP11-253O10	 4	 7	20	16	 74101075	 74101477	 74101276
RP11-12H11	 4	 8	20	16	 75715649	 75868868	 75792258
RP11-284G2	 4	 9	20	16	 77311882	 77350316	 77331099
RP11-1B11	 4	10	20	16	 80565336	 80727266	 80646301
RP11-162I18	 4	11	20	16	 82299929	 82429929	 82364929
RP11-79E15	 4	12	20	16	 56952486	 57122502	 57037494
RP11-79M18	 4	13	20	16	  7681171	  7857876	  7769523
RP11-79F19	 4	14	20	16	 26366610	 26527801	 26447205
RP11-80F22	 4	15	20	16	 34476094	 34627143	 34551618
RP11-81D3	 4	16	20	16	 52980348	 53003525	 52991936
RP11-81L5	 4	17	20	16	 81623771	 81784852	 81704311
RP11-90L19	 4	18	20	16	 70848591	 71029614	 70939102
RP11-91M7	 4	19	20	16	 14350354	 14529445	 14439899
CTA-388D4	 4	20	20	16	 12308331	 12558585	 12433458
CTA-521A12	 4	21	20	16	 19201063	 19316419	 19258741
CTA-589H1	 4	22	20		NA	NA	NA
CTA-951C11	 4	23	20	16	 27465281	 27579690	 27522485
RP11-545E2	 4	24	20	16	 47399763	 47620322	 47510042
RP11-71H6	 4	25	20	02	240992390	241148248	241070319
RP11-61B16	 4	 1	21	17	   586010	   740037	   663023
RP11-135N5	 4	 2	21	17	  2312021	  2492178	  2402099
RP11-61B20	 4	 3	21	17	  6780962	  6943107	  6862034
RP11-55C13	 4	 4	21	17	  8338030	  8524677	  8431353
RP11-451G10	 4	 5	21	20	 35432771	 35617003	 35524887
RP11-31B6_1	 4	 6	21	21	 14998564	 15152259	 15075411
RP11-181G18	 4	 7	21	21	 16651613	 16651846	 16651729
RP11-15E10	 4	 8	21	21	 18595720	 18774434	 18685077
RP11-86J21	 4	 9	21	21	 22224957	 22225289	 22225123
RP11-13J15	 4	10	21	21	 24034431	 24189219	 24111825
RP11-96H21	 4	11	21	21	 30854753	 31025100	 30939926
RP11-147H1	 4	12	21	21	 32218203	 32372918	 32295560
RP11-54F16	 4	13	21	21	 32694021	 32849422	 32771721
RP11-125H1	 4	14	21	21	 31282582	 31446878	 31364730
RP11-14B21_1	 4	15	21	21	 31204588	 31376316	 31290452
RP11-17O20	 4	16	21	21	 35229244	 35371851	 35300547
RP11-79A12	 4	17	21	21	 34660646	 34819795	 34740220
RP11-80N20	 4	18	21	21	 23885286	 24051119	 23968202
RP11-88N2_1	 4	19	21	21	 43556393	 43769964	 43663178
RP11-89M24	 4	20	21	21	 15643938	 15819543	 15731740
RP11-89H21	 4	21	21	21	 14850741	 14980741	 14915741
RP11-90A17	 4	22	21	21	 27718667	 27867189	 27792928
RP11-70F2	 4	23	21	22	 31533925	 31692227	 31613076
RP11-129B19	 4	24	21	22	 33335911	 33336242	 33336076
RP11-62G2	 4	25	21	22	 34595999	 34596413	 34596206
RP11-35I10	 4	 1	22	22	 35234422	 35364422	 35299422
RP11-108C6	 4	 2	22	22	 37253448	 37415719	 37334583
RP11-206B19	 4	 3	22	22	 40564358	 40564705	 40564531
RP11-169A6_2	 4	 4	22	20	 43013962	 43172910	 43093436
RP11-169L20	 4	 5	22	02	 24763123	 24933828	 24848475
RP11-173B14	 4	 6	22	13	 74961989	 75145347	 75053668
RP11-174N3	 4	 7	22	06	 35124982	 35280521	 35202751
RP11-176F3	 4	 8	22	09	 33786695	 33979975	 33883335
RP11-179A7	 4	 9	22	13	 33124196	 33309798	 33216997
RP11-200O9	 4	10	22	06	 37222629	 37397263	 37309946
RP11-202B22	 4	11	22	02	 20306606	 20456683	 20381644
RP11-204B7	 4	12	22	06	 18145655	 18315634	 18230644
RP11-204L3	 4	13	22	01	 39969518	 40094411	 40031964
RP11-205M20	 4	14	22	09	 32452044	 32607629	 32529836
RP11-206N24	 4	15	22	07	136364842	136546791	136455816
RP11-219B4	 4	16	22	08	 86197049	 86357332	 86277190
RP11-223M6	 4	17	22	02	215383382	215577686	215480534
RP11-229D13	 4	18	22	07	 75230225	 75326524	 75278374
RP11-230F18	 4	19	22	13	113166604	113351493	113259048
RP11-231D20	 4	20	22	08	 42145139	 42333716	 42239427
RP11-232P16	 4	21	22	05	 66396407	 66526407	 66461407
RP11-255G5	 4	22	22	11	 44920274	 45034232	 44977253
RP11-258B17	 4	23	22	02	133116845	133304518	133210681
RP11-260J21	 4	24	22	02	237157330	237338113	237247721
RP11-261P4	 4	25	22		NA	NA	NA
RP11-263C6	 4	 1	23	08	 28927774	 29094532	 29011153
RP11-264F23	 4	 2	23	12	  4187701	  4341718	  4264709
RP11-540P6	 4	 3	23	22	 35750202	 35930534	 35840368
RP11-542K23	 4	 4	23	09	122229517	122423453	122326485
RP11-544L8	 4	 5	23	06	114200748	114383739	114292243
RP11-547D14	 4	 6	23	16	 11531985	 11680350	 11606167
RP11-550J21	 4	 7	23	09	128534863	128543247	128539055
RP11-551E2	 4	 8	23	10	104538662	104712421	104625541
RP11-571M6	 4	 9	23	12	 56286136	 56497675	 56391905
RP11-574O17	 4	10	23	02	 96209274	 96355192	 96282233
RP11-576C12	 4	11	23	09	112405631	112481745	112443688
RP11-577G20	 4	12	23	04	 59100490	 59286047	 59193268
RP11-594N15	 4	13	23	08	 79545493	 79728349	 79636921
RP11-600K23	 4	14	23	07	 30244330	 30374330	 30309330
RP11-627M5	 4	15	23	05	176292860	176476422	176384641
RP11-629B4	 4	16	23	02	191614090	191776561	191695325
RP11-62N23_1	 4	17	23	17	 34979166	 35136396	 35057781
RP11-640P3	 4	18	23	03	188891939	189083483	188987711
RP11-647O5	 4	19	23	02	219556999	219612589	219584794
RP11-651M4	 4	20	23	11	 27616023	 27784098	 27700060
RP11-678N8	 4	21	23	05	138924976	139128791	139026883
RP11-680A7	 4	22	23	11	118644724	118829605	118737164
RP11-684M15	 4	23	23	11	 57026337	 57202367	 57114352
RP11-686P6	 4	24	23	20	  4962138	  5153894	  5058016
RP11-691N7	 4	25	23	11	 57196034	 57354107	 57275070
RP11-692J20	 4	 1	24	01	 28151477	 28352697	 28252087
RP11-120D12	 4	 2	24	01	154501690	154652686	154577188
RP11-122M14	 4	 3	24	01	208224523	208389429	208306976
RP11-124B17	 4	 4	24	13	 93876917	 94036921	 93956919
RP11-125K7	 4	 5	24	11	 65316468	 65478939	 65397703
RP11-129M16	 4	 6	24	10	118991885	119096596	119044240
RP11-132G19	 4	 7	24	01	 21794664	 21969826	 21882245
RP11-162H11	 4	 8	24	01	175039955	175196015	175117985
RP11-163O17	 4	 9	24	04	 84140937	 84328297	 84234617
RP11-164B11	 4	10	24	12	 15584950	 15773224	 15679087
RP11-165J3	 4	11	24	09	 93149580	 93300391	 93224985
RP11-166P13	 4	12	24	17	 52394700	 52568150	 52481425
RP11-170N16	 4	13	24	04	124088844	124267761	124178302
RP11-191A7	 4	14	24	07	111661569	111821990	111741779
RP11-197M22	 4	15	24	10	 16649252	 16818173	 16733712
RP11-203F10	 4	16	24	01	200861804	201051225	200956514
RP11-208G24	 4	17	24	09	 86727019	 86851352	 86789185
RP11-211N11	 4	18	24	10	115449555	115624331	115536943
RP11-214J9	 4	19	24	02	 26184731	 26365941	 26275336
RP11-247A12	 4	20	24	09	128934352	129096797	129015574
RP11-250E14_2	 4	21	24	16	 55893719	 56094253	 55993986
RP11-252K7	 4	22	24	02	160826503	160977144	160901823
RP11-254F7	 4	23	24	02	 10059526	 10223098	 10141312
RP11-259G7	 4	24	24	04	154996598	155197703	155097150
RP11-259O18	 4	25	24	12	  8894906	  9067837	  8981371
RP11-589N15	 4	 1	25	08	 11627381	 11803128	 11715254
RP11-594C8	 4	 2	25		NA	NA	NA
RP11-600P18	 4	 3	25	03	152311793	152495652	152403722
RP11-603J24	 4	 4	25	12	 54649146	 54841349	 54745247
RP11-621J12	 4	 5	25	12	 52777050	 52938758	 52857904
RP11-624G17	 4	 6	25	11	 56953549	 57164109	 57058829
RP11-88F4	 4	 7	25		NA	NA	NA
RP11-91N9	 4	 8	25	Y	 12781276	 12942571	 12861923
CTC-232B23	 4	 9	25	01	  1036980	  1037083	  1037031
CTB-8L3	 4	10	25	02	   322536	   322710	   322623
CTC-228K22	 4	11	25	03	   231485	   231767	   231626
CTB-118B13	 4	12	25	04	   101785	   101886	   101835
RP11-89K2	 5	 1	 1	01	 68483258	 68650295	 68566776
RP11-89O16	 5	 2	 1	01	 61095738	 61256769	 61176253
RP11-89D5	 5	 3	 1	01	 72065577	 72211722	 72138649
RP11-89B24	 5	 4	 1	01	 94234835	 94364835	 94299835
RP11-89F22	 5	 5	 1	01	106657433	106787433	106722433
RP11-89J22	 5	 6	 1	01	179030162	179160162	179095162
RP11-90I5	 5	 7	 1	01	186682750	186846060	186764405
RP11-90N5	 5	 8	 1	01	 13483568	 13682453	 13583010
RP11-91B5	 5	 9	 1	01	 64421451	 64570707	 64496079
RP11-91I11	 5	10	 1	01	 91628500	 91812267	 91720383
RP11-91K11	 5	11	 1	01	 19802895	 19980347	 19891621
RP11-91I12	 5	12	 1	01	 82585932	 82757940	 82671936
RP11-172P12	 5	13	 1	01	244456246	244456607	244456426
RP11-850I15	 5	14	 1	01	244773995	244903995	244838995
RP11-200F14_1	 5	15	 1	02	  6608798	  6609100	  6608949
RP11-87J7_1	 5	16	 1	02	 10494129	 10494340	 10494234
RP11-111J6	 5	17	 1	02	 18548231	 18724921	 18636576
RP11-57F9	 5	18	 1	02	 28514932	 28515225	 28515078
RP11-82B19_1	 5	19	 1	02	 84900386	 84900641	 84900513
RP11-67L23_1	 5	20	 1	02	 96627590	 96757590	 96692590
RP11-95H5_1	 5	21	 1	02	106732231	106926971	106829601
RP11-56O17	 5	22	 1	10	 94829347	 94980209	 94904778
RP11-1L22_1	 5	23	 1	02	133003528	133183138	133093333
RP11-119N3_1	 5	24	 1	02	137321669	137484246	137402957
CTD-2170C3	 5	25	 1	03	136353824	136483824	136418824
CTD-2278F18	 5	 1	 2	03	 50114648	 50114898	 50114773
RP11-79O5	 5	 2	 2	03	 76450939	 76611609	 76531274
RP11-79A14	 5	 3	 2	03	158992867	159140975	159066921
RP11-79E6	 5	 4	 2	03	 20396813	 20575549	 20486181
RP11-79K10	 5	 5	 2	03	186127110	186280455	186203782
RP11-81N13	 5	 6	 2	03	 68012152	 68170232	 68091192
RP11-81P15	 5	 7	 2	03	 87044530	 87223753	 87134141
RP11-88H10	 5	 8	 2	03	147011376	147184830	147098103
RP11-88P20	 5	 9	 2	03	 62456006	 62632959	 62544482
RP11-89E16	 5	10	 2	03	141263362	141441533	141352447
RP11-89O2	 5	11	 2	03	 64076340	 64232631	 64154485
RP11-90M23	 5	12	 2	03	 38337791	 38504773	 38421282
RP11-91B3	 5	13	 2	03	106786818	106966498	106876658
RP11-91F9	 5	14	 2	03	119261409	119412639	119337024
RP11-91L9	 5	15	 2	03	159672166	159822896	159747531
RP11-91M9	 5	16	 2	03	193633588	193789281	193711434
RP11-91O5	 5	17	 2	03	136539149	136692885	136616017
RP11-451C20	 5	18	 2	03	155495918	155644198	155570058
RP11-449B7	 5	19	 2	03	168576292	168706292	168641292
RP11-20I20	 5	20	 2	04	  1082846	  1273308	  1178077
RP11-7A6	 5	21	 2	04	  4989073	  5119073	  5054073
RP11-91B20	 5	22	 2	04	  4912323	  5042323	  4977323
RP11-29J24	 5	23	 2	04	 13427096	 13427435	 13427265
RP11-143O12	 5	24	 2	05	 55718890	 55904038	 55811464
RP11-47P7	 5	25	 2	05	 56303276	 56437163	 56370219
RP11-59G13	 5	 1	 3	05	 58004904	 58005254	 58005079
RP11-19I19	 5	 2	 3	05	 58789235	 58947885	 58868560
RP11-15P2	 5	 3	 3	05	 66244285	 66417271	 66330778
RP11-267K19	 5	 4	 3	05	 67838976	 67839365	 67839170
RP11-115L24	 5	 5	 3	05	103075860	103258636	103167248
RP11-277N18	 5	 6	 3	05	106562223	106725541	106643882
RP11-64F17	 5	 7	 3	05	112712910	112887118	112800014
RP11-81C5	 5	 8	 3	05	115183046	115366698	115274872
RP11-15P5	 5	 9	 3	05	120338707	120486364	120412535
RP11-47L19	 5	10	 3	05	121346323	121496535	121421429
RP11-128C13	 5	11	 3	05	150017067	150017377	150017222
RP11-86C20	 5	12	 3	05	152618608	152788777	152703692
RP11-31B18	 5	13	 3	05	155589756	155754489	155672122
RP11-134N14	 5	14	 3	05	157674600	157838235	157756417
RP11-4J6	 5	15	 3	05	158135099	158272567	158203833
RP11-90N23_1	 5	16	 3	05	159818160	159984761	159901460
RP11-193D11	 5	17	 3	05	172525555	172525749	172525652
RP11-48K2	 5	18	 3	05	172952619	173131940	173042279
RP11-2I16	 5	19	 3	05	177590852	177742910	177666881
RP11-124B12	 5	20	 3	05	146133447	146300556	146217001
RP11-15J20	 5	21	 3	05	140937170	141110789	141023979
RP11-422J14	 5	22	 3	05	 32078901	 32239209	 32159055
RP11-86P18	 5	23	 3	07	107940949	107941302	107941125
RP11-92J13	 5	24	 3	07	111233618	111401092	111317355
RP11-78C11	 5	25	 3	07	114102146	114261700	114181923
RP11-51M22	 5	 1	 4	07	115435012	115597337	115516174
RP11-68E12	 5	 2	 4	07	120238701	120368701	120303701
RP11-112P4	 5	 3	 4	07	121128048	121317230	121222639
RP11-269N18	 5	 4	 4	07	137725987	137900588	137813287
RP11-140I14	 5	 5	 4	07	134546621	134697492	134622056
RP11-148F17	 5	 6	 4	07	136669942	136821436	136745689
RP11-43L19	 5	 7	 4	07	150974336	151131938	151053137
RP11-81I21	 5	 8	 4	07	147953626	148122787	148038206
RP11-58F7	 5	 9	 4	07	157072238	157265148	157168693
RP11-80J18	 5	10	 4	07	136667178	136830314	136748746
RP11-80L6	 5	11	 4	07	102435956	102633550	102534753
RP11-80N8	 5	12	 4	07	127455639	127585639	127520639
RP11-80N18	 5	13	 4	07	111120152	111283011	111201581
RP11-81B7	 5	14	 4	07	126695314	126866526	126780920
RP11-81F19	 5	15	 4	07	 43092990	 43246540	 43169765
RP11-89N17	 5	16	 4	07	 33525356	 33703991	 33614673
RP11-89L18	 5	17	 4	07	 78684447	 78862373	 78773410
RP11-90C13	 5	18	 4	07	124683458	124848075	124765766
RP11-90B1	 5	19	 4	07	 70888200	 71032684	 70960442
RP11-90K11	 5	20	 4	07	148672491	148802491	148737491
RP11-90J23	 5	21	 4	07	  5698939	  5893800	  5796369
RP11-80F13	 5	22	 4	09	107243084	107406817	107324950
RP11-39J22	 5	23	 4	09	107719722	107719959	107719840
RP11-57O13	 5	24	 4	09	110605764	110764046	110684905
RP11-95J4	 5	25	 4	09	112900939	112901149	112901044
RP11-46P18	 5	 1	 5	09	114057165	114237322	114147243
RP11-16A3	 5	 2	 5	09	114488436	114649807	114569121
RP11-170E9	 5	 3	 5	09	131428744	131593906	131511325
RP11-421C4_1	 5	 4	 5		NA	NA	NA
CTD-2154O24	 5	 5	 5	09	 21992938	 21993102	 21993020
RP11-79G7	 5	 6	 5	09	 79580442	 79757725	 79669083
RP11-79K3	 5	 7	 5	09	  7302939	  7472982	  7387960
RP11-79A20	 5	 8	 5	09	 96802366	 96943258	 96872812
RP11-81N19	 5	 9	 5	09	127190574	127379754	127285164
RP11-81P13_2	 5	10	 5	09	110123103	110306968	110215035
RP11-88J16_2	 5	11	 5	09	 88247300	 88427843	 88337571
RP11-89C6	 5	12	 5	09	 19795646	 19959054	 19877350
RP11-89K14	 5	13	 5	09	 89021841	 89189795	 89105818
RP11-89B23	 5	14	 5	09	132940576	133100115	133020345
RP11-91M2	 5	15	 5	09	 80515147	 80658557	 80586852
RP11-91G7	 5	16	 5	09	124316484	124513874	124415179
RP11-451A16	 5	17	 5	09	118116150	118310825	118213487
RP11-69N2	 5	18	 5	10	   312215	   442215	   377215
RP11-111O7	 5	19	 5	10	  1613880	  1614195	  1614037
RP11-6H14	 5	20	 5	10	  2103673	  2233673	  2168673
RP11-32D14	 5	21	 5	11	 78502018	 78502148	 78502083
RP11-34L12	 5	22	 5	11	 82210812	 82372884	 82291848
RP11-102K15	 5	23	 5	11	 83026127	 83175158	 83100642
RP11-119M23	 5	24	 5	11	 85346395	 85346523	 85346459
RP11-89H11_1	 5	25	 5	11	 86725843	 86890447	 86808145
RP11-30C9	 5	 1	 6	11	 89750729	 89917285	 89834007
RP11-51M23	 5	 2	 6	11	104324007	104480911	104402459
RP11-85F4	 5	 3	 6	11	105026334	105156334	105091334
RP11-209E9	 5	 4	 6	11	107883685	108036758	107960221
RP11-97J23	 5	 5	 6	11	109547297	109707585	109627441
RP11-262J9	 5	 6	 6	11	111212060	111368866	111290463
RP11-5N6	 5	 7	 6	11	112931428	113063915	112997671
RP11-133I16	 5	 8	 6	11	120168346	120338475	120253410
RP11-126D18	 5	 9	 6	11	120423815	120586632	120505223
RP11-35M6	 5	10	 6	11	122877308	123007308	122942308
RP11-15J15	 5	11	 6	11	125422188	125586057	125504122
RP11-41K5	 5	12	 6	11	126226427	126391452	126308939
RP11-7F12	 5	13	 6	11	131174410	131333921	131254165
RP11-79O15	 5	14	 6	11	 13338428	 13495588	 13417008
RP11-79E12	 5	15	 6	11	 10149869	 10309555	 10229712
RP11-79M22	 5	16	 6	11	 27445503	 27595985	 27520744
RP11-79I17	 5	17	 6	11	112592002	112776405	112684203
RP11-80B24	 5	18	 6	11	 63230446	 63411884	 63321165
RP11-80J16	 5	19	 6	11	129557164	129738904	129648034
RP11-90L1_1	 5	20	 6	13	109936817	110114209	110025513
RP11-91H15	 5	21	 6	22	 28115556	 28245556	 28180556
RP11-91N5	 5	22	 6	13	 29438248	 29592946	 29515597
RP11-91O15	 5	23	 6	13	 83539640	 83669640	 83604640
RP11-91C24	 5	24	 6	13	 26096162	 26265249	 26180705
RP11-451E2	 5	25	 6	13	 71404703	 71574154	 71489428
RP11-109D12	 5	 1	 7	14	 26195329	 26345513	 26270421
RP11-48L1	 5	 2	 7	14	 30430848	 30560848	 30495848
RP11-91K19_1	 5	 3	 7	14	 31150740	 31318688	 31234714
RP11-54H22	 5	 4	 7	14	 32135322	 32283974	 32209648
RP11-105F9	 5	 5	 7	14	 33407160	 33555603	 33481381
RP11-288G5	 5	 6	 7	14	 38438528	 38438793	 38438660
RP11-45H9	 5	 7	 7	14	 54176195	 54176587	 54176391
RP11-29B7	 5	 8	 7	14	 54535363	 54665363	 54600363
RP11-21P8	 5	 9	 7	14	 56167551	 56297551	 56232551
RP11-2L22	 5	10	 7	14	 58681498	 58851792	 58766645
RP11-145O12	 5	11	 7	14	 62681382	 62848934	 62765158
RP11-206J4	 5	12	 7	14	 63950508	 64080508	 64015508
RP11-83I2	 5	13	 7	14	 88149356	 88149603	 88149479
RP11-40P23	 5	14	 7	14	 88958250	 88958551	 88958400
RP11-99C24	 5	15	 7	14	 89927463	 90094722	 90011092
RP11-192K24	 5	16	 7	14	 90761202	 90848466	 90804834
RP11-28G16	 5	17	 7	14	 91826415	 91985949	 91906182
RP11-26J5	 5	18	 7	14	 93784993	 93937440	 93861216
RP11-139N17	 5	19	 7		NA	NA	NA
RP11-9M20	 5	20	 7	17	 40615955	 40616103	 40616029
RP11-110H20	 5	21	 7	17	 44275860	 44426887	 44351373
RP11-143M4	 5	22	 7	17	 47477556	 47607556	 47542556
RP11-42M14	 5	23	 7	17	 47968636	 48136235	 48052435
RP11-52B5	 5	24	 7	17	 62285480	 62454207	 62369843
RP11-160E2	 5	25	 7	17	 18863807	 19044654	 18954230
CTD-2019C10	 5	 1	 8	17	 35027978	 35196587	 35112282
CTD-2153I4	 5	 2	 8	17	 63925565	 64055565	 63990565
RP11-79K13	 5	 3	 8	17	 64421494	 64592701	 64507097
RP11-79O18	 5	 4	 8	17	 42087497	 42244517	 42166007
RP11-81D5	 5	 5	 8		NA	NA	NA
RP11-90L11	 5	 6	 8	17	 65981809	 66144564	 66063186
RP11-91O17	 5	 7	 8	17	 69778105	 69959368	 69868736
RP11-506H21	 5	 8	 8	17	 53510739	 53672821	 53591780
RP11-451O6	 5	 9	 8	17	 26878139	 27008139	 26943139
RP11-847E16	 5	10	 8	17	  2941496	  3071496	  3006496
RP11-78H1	 5	11	 8	18	  2136811	  2307213	  2222012
RP11-10G8	 5	12	 8	18	 17274438	 17431001	 17352719
RP11-10L24	 5	13	 8	18	 20190773	 20354635	 20272704
RP11-94H23	 5	14	 8	18	 20247333	 20423414	 20335373
RP11-19F14	 5	15	 8	18	 28038322	 28168322	 28103322
RP11-63N12	 5	16	 8	18	 30826672	 30985926	 30906299
RP11-87H5	 5	17	 8	18	 38712284	 38712632	 38712458
RP11-81N15	 5	18	 8	22	 40929608	 41098203	 41013905
RP11-89D12	 5	19	 8	22	 34535593	 34665593	 34600593
RP11-90I17	 5	20	 8	22	 35686144	 35883800	 35784972
RP11-91O6	 5	21	 8	22	 16520657	 16705028	 16612842
RP11-835H20	 5	22	 8		NA	NA	NA
RP11-48D14	 5	23	 8	X	 20291696	 20465002	 20378349
RP11-287E8	 5	24	 8	X	 37764813	 37765140	 37764976
RP11-107C19	 5	25	 8	X	 48043396	 48203755	 48123575
RP11-183F2	 5	 1	 9	X	 69231089	 69231284	 69231186
RP11-246G22	 5	 2	 9	X	 82543053	 82716671	 82629862
RP11-77D22	 5	 3	 9	X	 92691036	 92821036	 92756036
RP11-147G1	 5	 4	 9	X	 64371203	 64510788	 64440995
RP11-34J1	 5	 5	 9	X	134907919	135057582	134982750
RP11-112H23	 5	 6	 9	X	136873081	137037931	136955506
RP11-221G13	 5	 7	 9	X	149205306	149205691	149205498
RP11-363G10	 5	 8	 9	X	 51717395	 51903673	 51810534
CTD-2006G2	 5	 9	 9	X	100807555	100923894	100865724
CTD-2051F22	 5	10	 9	X	 43564279	 43565298	 43564788
RP11-80F18	 5	11	 9	X	136763722	136911075	136837398
RP11-88F12	 5	12	 9	X	 92511356	 92668313	 92589834
RP11-89G18	 5	13	 9	X	 99853090	100008263	 99930676
RP11-89L23	 5	14	 9	X	 30355118	 30496214	 30425666
RP11-90F9	 5	15	 9	X	 13613213	 13743213	 13678213
RP11-90L17	 5	16	 9	X	117985978	118133913	118059945
RP11-276H7	 5	17	 9	01	 16179671	 16309671	 16244671
RP11-280N16	 5	18	 9	16	 82240146	 82429945	 82335045
RP11-282P15	 5	19	 9	15	 77888759	 78048385	 77968572
RP11-283G6	 5	20	 9	12	 26122382	 26326610	 26224496
RP11-285A1	 5	21	 9	15	 76072276	 76279484	 76175880
RP11-286D5	 5	22	 9	04	142966527	143144965	143055746
RP11-297A16	 5	23	 9	10	 35293873	 35442144	 35368008
RP11-297M24	 5	24	 9	04	174544214	174714986	174629600
RP11-297O4	 5	25	 9	01	109501414	109670655	109586034
RP11-299G20	 5	 1	10		NA	NA	NA
RP11-301K6	 5	 2	10	02	158281995	158449096	158365545
RP11-303I4	 5	 3	10	02	 80715783	 80867025	 80791404
RP11-317E13	 5	 4	10	19	 47268068	 47443199	 47355633
RP11-318E23	 5	 5	10	01	 28801528	 28950310	 28875919
RP11-318G21	 5	 6	10	13	 77297642	 77480979	 77389310
RP11-319K17	 5	 7	10	12	 18556866	 18726113	 18641489
RP11-320N7	 5	 8	10	12	  3997825	  4189702	  4093763
RP11-321N4	 5	 9	10	06	 86222125	 86351135	 86286630
RP11-331G8	 5	10	10	10	101601095	101761847	101681471
RP11-332C17	 5	11	10	05	 55066142	 55272599	 55169370
RP11-333B24	 5	12	10	08	 38260477	 38453623	 38357050
RP11-334P12	 5	13	10	09	 32342352	 32454044	 32398198
RP11-336P12	 5	14	10	09	125698693	125854825	125776759
RP11-339F13	 5	15	10	07	 55029593	 55154846	 55092219
RP11-721P9	 5	16	10	17	 58042984	 58213666	 58128325
RP11-727M5	 5	17	10	01	103857106	104049664	103953385
RP11-729C24	 5	18	10	05	131816997	131977071	131897034
RP11-730K20	 5	19	10	11	 64723295	 64896754	 64810024
RP11-738E22	 5	20	10	04	 57593237	 57796711	 57694974
RP11-745J15	 5	21	10	07	 55899481	 55938356	 55918918
RP11-775D22	 5	22	10	07	129266363	129449716	129358039
RP11-778P8	 5	23	10	18	   600984	   771970	   686477
RP11-782H1	 5	24	10	19	 17985862	 18157188	 18071525
RP11-787I22	 5	25	10	06	109354293	109484293	109419293
RP11-791J7	 5	 1	11	11	124917744	124984768	124951256
RP11-793J2	 5	 2	11	18	 59694849	 59886251	 59790550
RP11-815P21	 5	 3	11	14	105149437	105159201	105154319
RP11-856B14	 5	 4	11	11	 65043481	 65254877	 65149179
RP11-861A13	 5	 5	11	03	109212058	109389893	109300975
RP11-866E20	 5	 6	11	18	 55690397	 55884029	 55787213
RP11-872D17	 5	 7	11	11	 56768733	 56958984	 56863858
RP11-881M11	 5	 8	11	11	 60417794	 60621331	 60519562
RP11-1137G4	 5	 9	11	19	  6859583	  6995048	  6927315
RP11-17K19	 5	10	11	05	131910695	132085910	131998302
RP11-56D20	 5	11	11		NA	NA	NA
RP11-65K20	 5	12	11	20	 54299290	 54460761	 54380025
RP11-77C3	 5	13	11	20	  1437290	  1627256	  1532273
RP11-88N2_2	 5	14	11	21	 43556393	 43769964	 43663178
RP11-288G11	 5	15	11	10	134340939	134549003	134444971
RP11-289N10	 5	16	11	03	123243312	123407474	123325393
RP11-291L19	 5	17	11	01	 45518445	 45655593	 45587019
RP11-291P10	 5	18	11	03	 81469186	 81649525	 81559355
RP11-295I5	 5	19	11	12	 25121735	 25317791	 25219763
RP11-298E9	 5	20	11	10	  3131935	  3295007	  3213471
RP11-325K4	 5	21	11	16	 55369591	 55559304	 55464447
RP11-326I11	 5	22	11	04	185682071	185878287	185780179
RP11-332F10	 5	23	11	04	 40593591	 40751599	 40672595
RP11-334N15	 5	24	11	02	168466065	168668066	168567065
RP11-338C15	 5	25	11	01	209172388	209237484	209204936
RP11-342M3_2	 5	 1	12	10	 80780233	 80947467	 80863850
RP11-354M1	 5	 2	12	16	 67247880	 67432825	 67340352
RP11-356I18	 5	 3	12	17	   707754	   880135	   793944
RP11-357P18	 5	 4	12	01	203848863	204029268	203939065
RP11-361L15	 5	 5	12	16	 65476514	 65660416	 65568465
RP11-365H22	 5	 6	12	04	 52501045	 52679030	 52590037
RP11-368G2	 5	 7	12	04	 89275729	 89457606	 89366667
RP11-384M15	 5	 8	12	16	 70533938	 70708777	 70621357
RP11-386B13	 5	 9	12	04	186294567	186445829	186370198
RP11-386G11	 5	10	12	12	 47664567	 47838967	 47751767
RP11-389D21	 5	11	12	11	 18330597	 18491374	 18410985
RP11-392A22	 5	12	12	03	157881169	158057242	157969205
RP11-396K3	 5	13	12	07	 71922030	 72133581	 72027805
RP11-627I23	 5	14	12	02	190945900	191120026	191032963
RP11-629O1	 5	15	12	08	134535921	134725130	134630525
RP11-635A1	 5	16	12	04	149271897	149379862	149325879
RP11-645N11	 5	17	12	07	102158398	102314240	102236319
RP11-655A7	 5	18	12	02	189533777	189705653	189619715
RP11-661A3	 5	19	12	08	 59655134	 59857023	 59756078
CTB-31J3	 5	20	12	04	190471998	190472339	190472168
CTB-77L23	 5	21	12	08	  1004849	  1005174	  1005011
CTB-41L13	 5	22	12	09	   222268	   336205	   279236
CTB-23B11	 5	23	12	10	   332786	   334048	   333417
RP11-651K21	 5	24	12	11	131037498	131254195	131145846
CTC-200D12	 5	25	12	14	106175185	106175506	106175345
RP11-89K2	 5	13	13	01	 68483258	 68650295	 68566776
RP11-89O16	 5	14	13	01	 61095738	 61256769	 61176253
RP11-89D5	 5	15	13	01	 72065577	 72211722	 72138649
RP11-89B24	 5	16	13	01	 94234835	 94364835	 94299835
RP11-89F22	 5	17	13	01	106657433	106787433	106722433
RP11-89J22	 5	18	13	01	179030162	179160162	179095162
RP11-90I5	 5	19	13	01	186682750	186846060	186764405
RP11-90N5	 5	20	13	01	 13483568	 13682453	 13583010
RP11-91B5	 5	21	13	01	 64421451	 64570707	 64496079
RP11-91I11	 5	22	13	01	 91628500	 91812267	 91720383
RP11-91K11	 5	23	13	01	 19802895	 19980347	 19891621
RP11-91I12	 5	24	13	01	 82585932	 82757940	 82671936
RP11-172P12	 5	25	13	01	244456246	244456607	244456426
RP11-850I15	 5	 1	14	01	244773995	244903995	244838995
RP11-200F14_1	 5	 2	14	02	  6608798	  6609100	  6608949
RP11-87J7_1	 5	 3	14	02	 10494129	 10494340	 10494234
RP11-111J6	 5	 4	14	02	 18548231	 18724921	 18636576
RP11-57F9	 5	 5	14	02	 28514932	 28515225	 28515078
RP11-82B19_1	 5	 6	14	02	 84900386	 84900641	 84900513
RP11-67L23_1	 5	 7	14	02	 96627590	 96757590	 96692590
RP11-95H5_1	 5	 8	14	02	106732231	106926971	106829601
RP11-56O17	 5	 9	14	10	 94829347	 94980209	 94904778
RP11-1L22_1	 5	10	14	02	133003528	133183138	133093333
RP11-119N3_1	 5	11	14	02	137321669	137484246	137402957
CTD-2170C3	 5	12	14	03	136353824	136483824	136418824
CTD-2278F18	 5	13	14	03	 50114648	 50114898	 50114773
RP11-79O5	 5	14	14	03	 76450939	 76611609	 76531274
RP11-79A14	 5	15	14	03	158992867	159140975	159066921
RP11-79E6	 5	16	14	03	 20396813	 20575549	 20486181
RP11-79K10	 5	17	14	03	186127110	186280455	186203782
RP11-81N13	 5	18	14	03	 68012152	 68170232	 68091192
RP11-81P15	 5	19	14	03	 87044530	 87223753	 87134141
RP11-88H10	 5	20	14	03	147011376	147184830	147098103
RP11-88P20	 5	21	14	03	 62456006	 62632959	 62544482
RP11-89E16	 5	22	14	03	141263362	141441533	141352447
RP11-89O2	 5	23	14	03	 64076340	 64232631	 64154485
RP11-90M23	 5	24	14	03	 38337791	 38504773	 38421282
RP11-91B3	 5	25	14	03	106786818	106966498	106876658
RP11-91F9	 5	 1	15	03	119261409	119412639	119337024
RP11-91L9	 5	 2	15	03	159672166	159822896	159747531
RP11-91M9	 5	 3	15	03	193633588	193789281	193711434
RP11-91O5	 5	 4	15	03	136539149	136692885	136616017
RP11-451C20	 5	 5	15	03	155495918	155644198	155570058
RP11-449B7	 5	 6	15	03	168576292	168706292	168641292
RP11-20I20	 5	 7	15	04	  1082846	  1273308	  1178077
RP11-7A6	 5	 8	15	04	  4989073	  5119073	  5054073
RP11-91B20	 5	 9	15	04	  4912323	  5042323	  4977323
RP11-29J24	 5	10	15	04	 13427096	 13427435	 13427265
RP11-143O12	 5	11	15	05	 55718890	 55904038	 55811464
RP11-47P7	 5	12	15	05	 56303276	 56437163	 56370219
RP11-59G13	 5	13	15	05	 58004904	 58005254	 58005079
RP11-19I19	 5	14	15	05	 58789235	 58947885	 58868560
RP11-15P2	 5	15	15	05	 66244285	 66417271	 66330778
RP11-267K19	 5	16	15	05	 67838976	 67839365	 67839170
RP11-115L24	 5	17	15	05	103075860	103258636	103167248
RP11-277N18	 5	18	15	05	106562223	106725541	106643882
RP11-64F17	 5	19	15	05	112712910	112887118	112800014
RP11-81C5	 5	20	15	05	115183046	115366698	115274872
RP11-15P5	 5	21	15	05	120338707	120486364	120412535
RP11-47L19	 5	22	15	05	121346323	121496535	121421429
RP11-128C13	 5	23	15	05	150017067	150017377	150017222
RP11-86C20	 5	24	15	05	152618608	152788777	152703692
RP11-31B18	 5	25	15	05	155589756	155754489	155672122
RP11-134N14	 5	 1	16	05	157674600	157838235	157756417
RP11-4J6	 5	 2	16	05	158135099	158272567	158203833
RP11-90N23_1	 5	 3	16	05	159818160	159984761	159901460
RP11-193D11	 5	 4	16	05	172525555	172525749	172525652
RP11-48K2	 5	 5	16	05	172952619	173131940	173042279
RP11-2I16	 5	 6	16	05	177590852	177742910	177666881
RP11-124B12	 5	 7	16	05	146133447	146300556	146217001
RP11-15J20	 5	 8	16	05	140937170	141110789	141023979
RP11-422J14	 5	 9	16	05	 32078901	 32239209	 32159055
RP11-86P18	 5	10	16	07	107940949	107941302	107941125
RP11-92J13	 5	11	16	07	111233618	111401092	111317355
RP11-78C11	 5	12	16	07	114102146	114261700	114181923
RP11-51M22	 5	13	16	07	115435012	115597337	115516174
RP11-68E12	 5	14	16	07	120238701	120368701	120303701
RP11-112P4	 5	15	16	07	121128048	121317230	121222639
RP11-269N18	 5	16	16	07	137725987	137900588	137813287
RP11-140I14	 5	17	16	07	134546621	134697492	134622056
RP11-148F17	 5	18	16	07	136669942	136821436	136745689
RP11-43L19	 5	19	16	07	150974336	151131938	151053137
RP11-81I21	 5	20	16	07	147953626	148122787	148038206
RP11-58F7	 5	21	16	07	157072238	157265148	157168693
RP11-80J18	 5	22	16	07	136667178	136830314	136748746
RP11-80L6	 5	23	16	07	102435956	102633550	102534753
RP11-80N8	 5	24	16	07	127455639	127585639	127520639
RP11-80N18	 5	25	16	07	111120152	111283011	111201581
RP11-81B7	 5	 1	17	07	126695314	126866526	126780920
RP11-81F19	 5	 2	17	07	 43092990	 43246540	 43169765
RP11-89N17	 5	 3	17	07	 33525356	 33703991	 33614673
RP11-89L18	 5	 4	17	07	 78684447	 78862373	 78773410
RP11-90C13	 5	 5	17	07	124683458	124848075	124765766
RP11-90B1	 5	 6	17	07	 70888200	 71032684	 70960442
RP11-90K11	 5	 7	17	07	148672491	148802491	148737491
RP11-90J23	 5	 8	17	07	  5698939	  5893800	  5796369
RP11-80F13	 5	 9	17	09	107243084	107406817	107324950
RP11-39J22	 5	10	17	09	107719722	107719959	107719840
RP11-57O13	 5	11	17	09	110605764	110764046	110684905
RP11-95J4	 5	12	17	09	112900939	112901149	112901044
RP11-46P18	 5	13	17	09	114057165	114237322	114147243
RP11-16A3	 5	14	17	09	114488436	114649807	114569121
RP11-170E9	 5	15	17	09	131428744	131593906	131511325
RP11-421C4_1	 5	16	17		NA	NA	NA
CTD-2154O24	 5	17	17	09	 21992938	 21993102	 21993020
RP11-79G7	 5	18	17	09	 79580442	 79757725	 79669083
RP11-79K3	 5	19	17	09	  7302939	  7472982	  7387960
RP11-79A20	 5	20	17	09	 96802366	 96943258	 96872812
RP11-81N19	 5	21	17	09	127190574	127379754	127285164
RP11-81P13_2	 5	22	17	09	110123103	110306968	110215035
RP11-88J16_2	 5	23	17	09	 88247300	 88427843	 88337571
RP11-89C6	 5	24	17	09	 19795646	 19959054	 19877350
RP11-89K14	 5	25	17	09	 89021841	 89189795	 89105818
RP11-89B23	 5	 1	18	09	132940576	133100115	133020345
RP11-91M2	 5	 2	18	09	 80515147	 80658557	 80586852
RP11-91G7	 5	 3	18	09	124316484	124513874	124415179
RP11-451A16	 5	 4	18	09	118116150	118310825	118213487
RP11-69N2	 5	 5	18	10	   312215	   442215	   377215
RP11-111O7	 5	 6	18	10	  1613880	  1614195	  1614037
RP11-6H14	 5	 7	18	10	  2103673	  2233673	  2168673
RP11-32D14	 5	 8	18	11	 78502018	 78502148	 78502083
RP11-34L12	 5	 9	18	11	 82210812	 82372884	 82291848
RP11-102K15	 5	10	18	11	 83026127	 83175158	 83100642
RP11-119M23	 5	11	18	11	 85346395	 85346523	 85346459
RP11-89H11_1	 5	12	18	11	 86725843	 86890447	 86808145
RP11-30C9	 5	13	18	11	 89750729	 89917285	 89834007
RP11-51M23	 5	14	18	11	104324007	104480911	104402459
RP11-85F4	 5	15	18	11	105026334	105156334	105091334
RP11-209E9	 5	16	18	11	107883685	108036758	107960221
RP11-97J23	 5	17	18	11	109547297	109707585	109627441
RP11-262J9	 5	18	18	11	111212060	111368866	111290463
RP11-5N6	 5	19	18	11	112931428	113063915	112997671
RP11-133I16	 5	20	18	11	120168346	120338475	120253410
RP11-126D18	 5	21	18	11	120423815	120586632	120505223
RP11-35M6	 5	22	18	11	122877308	123007308	122942308
RP11-15J15	 5	23	18	11	125422188	125586057	125504122
RP11-41K5	 5	24	18	11	126226427	126391452	126308939
RP11-7F12	 5	25	18	11	131174410	131333921	131254165
RP11-79O15	 5	 1	19	11	 13338428	 13495588	 13417008
RP11-79E12	 5	 2	19	11	 10149869	 10309555	 10229712
RP11-79M22	 5	 3	19	11	 27445503	 27595985	 27520744
RP11-79I17	 5	 4	19	11	112592002	112776405	112684203
RP11-80B24	 5	 5	19	11	 63230446	 63411884	 63321165
RP11-80J16	 5	 6	19	11	129557164	129738904	129648034
RP11-90L1_1	 5	 7	19	13	109936817	110114209	110025513
RP11-91H15	 5	 8	19	22	 28115556	 28245556	 28180556
RP11-91N5	 5	 9	19	13	 29438248	 29592946	 29515597
RP11-91O15	 5	10	19	13	 83539640	 83669640	 83604640
RP11-91C24	 5	11	19	13	 26096162	 26265249	 26180705
RP11-451E2	 5	12	19	13	 71404703	 71574154	 71489428
RP11-109D12	 5	13	19	14	 26195329	 26345513	 26270421
RP11-48L1	 5	14	19	14	 30430848	 30560848	 30495848
RP11-91K19_1	 5	15	19	14	 31150740	 31318688	 31234714
RP11-54H22	 5	16	19	14	 32135322	 32283974	 32209648
RP11-105F9	 5	17	19	14	 33407160	 33555603	 33481381
RP11-288G5	 5	18	19	14	 38438528	 38438793	 38438660
RP11-45H9	 5	19	19	14	 54176195	 54176587	 54176391
RP11-29B7	 5	20	19	14	 54535363	 54665363	 54600363
RP11-21P8	 5	21	19	14	 56167551	 56297551	 56232551
RP11-2L22	 5	22	19	14	 58681498	 58851792	 58766645
RP11-145O12	 5	23	19	14	 62681382	 62848934	 62765158
RP11-206J4	 5	24	19	14	 63950508	 64080508	 64015508
RP11-83I2	 5	25	19	14	 88149356	 88149603	 88149479
RP11-40P23	 5	 1	20	14	 88958250	 88958551	 88958400
RP11-99C24	 5	 2	20	14	 89927463	 90094722	 90011092
RP11-192K24	 5	 3	20	14	 90761202	 90848466	 90804834
RP11-28G16	 5	 4	20	14	 91826415	 91985949	 91906182
RP11-26J5	 5	 5	20	14	 93784993	 93937440	 93861216
RP11-139N17	 5	 6	20		NA	NA	NA
RP11-9M20	 5	 7	20	17	 40615955	 40616103	 40616029
RP11-110H20	 5	 8	20	17	 44275860	 44426887	 44351373
RP11-143M4	 5	 9	20	17	 47477556	 47607556	 47542556
RP11-42M14	 5	10	20	17	 47968636	 48136235	 48052435
RP11-52B5	 5	11	20	17	 62285480	 62454207	 62369843
RP11-160E2	 5	12	20	17	 18863807	 19044654	 18954230
CTD-2019C10	 5	13	20	17	 35027978	 35196587	 35112282
CTD-2153I4	 5	14	20	17	 63925565	 64055565	 63990565
RP11-79K13	 5	15	20	17	 64421494	 64592701	 64507097
RP11-79O18	 5	16	20	17	 42087497	 42244517	 42166007
RP11-81D5	 5	17	20		NA	NA	NA
RP11-90L11	 5	18	20	17	 65981809	 66144564	 66063186
RP11-91O17	 5	19	20	17	 69778105	 69959368	 69868736
RP11-506H21	 5	20	20	17	 53510739	 53672821	 53591780
RP11-451O6	 5	21	20	17	 26878139	 27008139	 26943139
RP11-847E16	 5	22	20	17	  2941496	  3071496	  3006496
RP11-78H1	 5	23	20	18	  2136811	  2307213	  2222012
RP11-10G8	 5	24	20	18	 17274438	 17431001	 17352719
RP11-10L24	 5	25	20	18	 20190773	 20354635	 20272704
RP11-94H23	 5	 1	21	18	 20247333	 20423414	 20335373
RP11-19F14	 5	 2	21	18	 28038322	 28168322	 28103322
RP11-63N12	 5	 3	21	18	 30826672	 30985926	 30906299
RP11-87H5	 5	 4	21	18	 38712284	 38712632	 38712458
RP11-81N15	 5	 5	21	22	 40929608	 41098203	 41013905
RP11-89D12	 5	 6	21	22	 34535593	 34665593	 34600593
RP11-90I17	 5	 7	21	22	 35686144	 35883800	 35784972
RP11-91O6	 5	 8	21	22	 16520657	 16705028	 16612842
RP11-835H20	 5	 9	21		NA	NA	NA
RP11-48D14	 5	10	21	X	 20291696	 20465002	 20378349
RP11-287E8	 5	11	21	X	 37764813	 37765140	 37764976
RP11-107C19	 5	12	21	X	 48043396	 48203755	 48123575
RP11-183F2	 5	13	21	X	 69231089	 69231284	 69231186
RP11-246G22	 5	14	21	X	 82543053	 82716671	 82629862
RP11-77D22	 5	15	21	X	 92691036	 92821036	 92756036
RP11-147G1	 5	16	21	X	 64371203	 64510788	 64440995
RP11-34J1	 5	17	21	X	134907919	135057582	134982750
RP11-112H23	 5	18	21	X	136873081	137037931	136955506
RP11-221G13	 5	19	21	X	149205306	149205691	149205498
RP11-363G10	 5	20	21	X	 51717395	 51903673	 51810534
CTD-2006G2	 5	21	21	X	100807555	100923894	100865724
CTD-2051F22	 5	22	21	X	 43564279	 43565298	 43564788
RP11-80F18	 5	23	21	X	136763722	136911075	136837398
RP11-88F12	 5	24	21	X	 92511356	 92668313	 92589834
RP11-89G18	 5	25	21	X	 99853090	100008263	 99930676
RP11-89L23	 5	 1	22	X	 30355118	 30496214	 30425666
RP11-90F9	 5	 2	22	X	 13613213	 13743213	 13678213
RP11-90L17	 5	 3	22	X	117985978	118133913	118059945
RP11-276H7	 5	 4	22	01	 16179671	 16309671	 16244671
RP11-280N16	 5	 5	22	16	 82240146	 82429945	 82335045
RP11-282P15	 5	 6	22	15	 77888759	 78048385	 77968572
RP11-283G6	 5	 7	22	12	 26122382	 26326610	 26224496
RP11-285A1	 5	 8	22	15	 76072276	 76279484	 76175880
RP11-286D5	 5	 9	22	04	142966527	143144965	143055746
RP11-297A16	 5	10	22	10	 35293873	 35442144	 35368008
RP11-297M24	 5	11	22	04	174544214	174714986	174629600
RP11-297O4	 5	12	22	01	109501414	109670655	109586034
RP11-299G20	 5	13	22		NA	NA	NA
RP11-301K6	 5	14	22	02	158281995	158449096	158365545
RP11-303I4	 5	15	22	02	 80715783	 80867025	 80791404
RP11-317E13	 5	16	22	19	 47268068	 47443199	 47355633
RP11-318E23	 5	17	22	01	 28801528	 28950310	 28875919
RP11-318G21	 5	18	22	13	 77297642	 77480979	 77389310
RP11-319K17	 5	19	22	12	 18556866	 18726113	 18641489
RP11-320N7	 5	20	22	12	  3997825	  4189702	  4093763
RP11-321N4	 5	21	22	06	 86222125	 86351135	 86286630
RP11-331G8	 5	22	22	10	101601095	101761847	101681471
RP11-332C17	 5	23	22	05	 55066142	 55272599	 55169370
RP11-333B24	 5	24	22	08	 38260477	 38453623	 38357050
RP11-334P12	 5	25	22	09	 32342352	 32454044	 32398198
RP11-336P12	 5	 1	23	09	125698693	125854825	125776759
RP11-339F13	 5	 2	23	07	 55029593	 55154846	 55092219
RP11-721P9	 5	 3	23	17	 58042984	 58213666	 58128325
RP11-727M5	 5	 4	23	01	103857106	104049664	103953385
RP11-729C24	 5	 5	23	05	131816997	131977071	131897034
RP11-730K20	 5	 6	23	11	 64723295	 64896754	 64810024
RP11-738E22	 5	 7	23	04	 57593237	 57796711	 57694974
RP11-745J15	 5	 8	23	07	 55899481	 55938356	 55918918
RP11-775D22	 5	 9	23	07	129266363	129449716	129358039
RP11-778P8	 5	10	23	18	   600984	   771970	   686477
RP11-782H1	 5	11	23	19	 17985862	 18157188	 18071525
RP11-787I22	 5	12	23	06	109354293	109484293	109419293
RP11-791J7	 5	13	23	11	124917744	124984768	124951256
RP11-793J2	 5	14	23	18	 59694849	 59886251	 59790550
RP11-815P21	 5	15	23	14	105149437	105159201	105154319
RP11-856B14	 5	16	23	11	 65043481	 65254877	 65149179
RP11-861A13	 5	17	23	03	109212058	109389893	109300975
RP11-866E20	 5	18	23	18	 55690397	 55884029	 55787213
RP11-872D17	 5	19	23	11	 56768733	 56958984	 56863858
RP11-881M11	 5	20	23	11	 60417794	 60621331	 60519562
RP11-1137G4	 5	21	23	19	  6859583	  6995048	  6927315
RP11-17K19	 5	22	23	05	131910695	132085910	131998302
RP11-56D20	 5	23	23		NA	NA	NA
RP11-65K20	 5	24	23	20	 54299290	 54460761	 54380025
RP11-77C3	 5	25	23	20	  1437290	  1627256	  1532273
RP11-88N2_2	 5	 1	24	21	 43556393	 43769964	 43663178
RP11-288G11	 5	 2	24	10	134340939	134549003	134444971
RP11-289N10	 5	 3	24	03	123243312	123407474	123325393
RP11-291L19	 5	 4	24	01	 45518445	 45655593	 45587019
RP11-291P10	 5	 5	24	03	 81469186	 81649525	 81559355
RP11-295I5	 5	 6	24	12	 25121735	 25317791	 25219763
RP11-298E9	 5	 7	24	10	  3131935	  3295007	  3213471
RP11-325K4	 5	 8	24	16	 55369591	 55559304	 55464447
RP11-326I11	 5	 9	24	04	185682071	185878287	185780179
RP11-332F10	 5	10	24	04	 40593591	 40751599	 40672595
RP11-334N15	 5	11	24	02	168466065	168668066	168567065
RP11-338C15	 5	12	24	01	209172388	209237484	209204936
RP11-342M3_2	 5	13	24	10	 80780233	 80947467	 80863850
RP11-354M1	 5	14	24	16	 67247880	 67432825	 67340352
RP11-356I18	 5	15	24	17	   707754	   880135	   793944
RP11-357P18	 5	16	24	01	203848863	204029268	203939065
RP11-361L15	 5	17	24	16	 65476514	 65660416	 65568465
RP11-365H22	 5	18	24	04	 52501045	 52679030	 52590037
RP11-368G2	 5	19	24	04	 89275729	 89457606	 89366667
RP11-384M15	 5	20	24	16	 70533938	 70708777	 70621357
RP11-386B13	 5	21	24	04	186294567	186445829	186370198
RP11-386G11	 5	22	24	12	 47664567	 47838967	 47751767
RP11-389D21	 5	23	24	11	 18330597	 18491374	 18410985
RP11-392A22	 5	24	24	03	157881169	158057242	157969205
RP11-396K3	 5	25	24	07	 71922030	 72133581	 72027805
RP11-627I23	 5	 1	25	02	190945900	191120026	191032963
RP11-629O1	 5	 2	25	08	134535921	134725130	134630525
RP11-635A1	 5	 3	25	04	149271897	149379862	149325879
RP11-645N11	 5	 4	25	07	102158398	102314240	102236319
RP11-655A7	 5	 5	25	02	189533777	189705653	189619715
RP11-661A3	 5	 6	25	08	 59655134	 59857023	 59756078
CTB-31J3	 5	 7	25	04	190471998	190472339	190472168
CTB-77L23	 5	 8	25	08	  1004849	  1005174	  1005011
CTB-41L13	 5	 9	25	09	   222268	   336205	   279236
CTB-23B11	 5	10	25	10	   332786	   334048	   333417
RP11-651K21	 5	11	25	11	131037498	131254195	131145846
CTC-200D12	 5	12	25	14	106175185	106175506	106175345
RP11-69G4_1	 6	 1	 1	02	182670510	182868798	182769654
RP11-30M1_1	 6	 2	 1	02	195293720	195479196	195386458
RP11-57C6_1	 6	 3	 1	02	201453608	201620494	201537051
RP11-225L15_1	 6	 4	 1	02	207216188	207216506	207216347
RP11-53G6_1	 6	 5	 1	02	220617776	220618102	220617939
RP11-247E23_1	 6	 6	 1	02	223503065	223633065	223568065
RP11-542D13	 6	 7	 1	02	 97564599	 97795025	 97679812
CTD-2084O7	 6	 8	 1	02	 47597334	 47727334	 47662334
CTD-2120O13	 6	 9	 1	02	201908953	201909164	201909058
RP11-79A11	 6	10	 1	02	151147447	151313669	151230558
RP11-79C17	 6	11	 1	02	174027482	174188084	174107783
RP11-79K7	 6	12	 1	02	109701502	109869691	109785596
RP11-80L22	 6	13	 1	02	161357702	161523948	161440825
RP11-81F17	 6	14	 1	02	171232191	171390500	171311345
RP11-81H1	 6	15	 1	02	138812118	138980360	138896239
RP11-81L7_2	 6	16	 1	02	 57065869	 57218868	 57142368
RP11-81N1	 6	17	 1	02	170871808	171012981	170942394
RP11-81P3	 6	18	 1	02	201557652	201712021	201634836
RP11-89O10	 6	19	 1	02	105486606	105667622	105577114
RP11-89B13	 6	20	 1	02	197234086	197389970	197312028
RP11-89F19	 6	21	 1	02	 38371382	 38541004	 38456193
RP11-89J19	 6	22	 1	02	 97507068	 97666063	 97586565
RP11-89L3	 6	23	 1	02	146734712	146878159	146806435
RP11-89N23	 6	24	 1	02	241744278	241908306	241826292
RP11-239C17	 6	25	 1	04	 26067738	 26178949	 26123343
RP11-210B2	 6	 1	 2	04	 28605123	 28605524	 28605323
RP11-53F2	 6	 2	 2	04	 29347252	 29491912	 29419582
RP11-53F9	 6	 3	 2	04	 30483014	 30613014	 30548014
RP11-180G13	 6	 4	 2	04	 30666325	 30834085	 30750205
RP11-85B10	 6	 5	 2	04	 35451937	 35452381	 35452159
RP11-121C2	 6	 6	 2	04	 47644149	 47865564	 47754856
RP11-72P14	 6	 7	 2	04	 48178603	 48308603	 48243603
RP11-217B22_2	 6	 8	 2	04	 48744131	 48839424	 48791777
RP11-32K21	 6	 9	 2	04	 52870677	 52871018	 52870847
RP11-175I24	 6	10	 2	04	 53582533	 53712533	 53647533
RP11-80L11	 6	11	 2	04	 55035893	 55178329	 55107111
RP11-144I19	 6	12	 2	04	 76495364	 76647575	 76571469
RP11-17P19	 6	13	 2	04	 79222718	 79359277	 79290997
RP11-131O10	 6	14	 2	04	 83332028	 83332197	 83332112
RP11-11P12	 6	15	 2	04	 83957805	 84122920	 84040362
RP11-87J14	 6	16	 2	04	 84641001	 84771001	 84706001
RP11-283H13	 6	17	 2	04	 85163504	 85163847	 85163675
RP11-144B4	 6	18	 2	04	 98637209	 98784302	 98710755
RP11-85I10	 6	19	 2	04	100586064	100586266	100586165
RP11-110C16	 6	20	 2	04	103205367	103358818	103282092
RP11-18D18	 6	21	 2	04	112622693	112752693	112687693
RP11-131K16	 6	22	 2	04	121784379	121784735	121784557
RP11-6K22	 6	23	 2	04	120282908	120456762	120369835
RP11-79I8	 6	24	 2	05	 20798444	 20959340	 20878892
RP11-79K4	 6	25	 2	05	140345818	140518162	140431990
RP11-80D2	 6	 1	 3	05	 87318907	 87448907	 87383907
RP11-81D21	 6	 2	 3	05	136572678	136733682	136653180
RP11-81L1	 6	 3	 3	05	122442254	122602832	122522543
RP11-81P9	 6	 4	 3	05	 14669927	 14839486	 14754706
RP11-89P1	 6	 5	 3	05	160359092	160509502	160434297
RP11-89N22	 6	 6	 3	05	  3963012	  4093012	  4028012
RP11-90A15	 6	 7	 3	05	117468807	117612239	117540523
RP11-90E15	 6	 8	 3	05	 25999396	 26168302	 26083849
RP11-90G17	 6	 9	 3	05	 25142886	 25310682	 25226784
RP11-90M19	 6	10	 3	05	 97928034	 98106170	 98017102
RP11-91G17	 6	11	 3	05	153948255	154125685	154036970
RP11-91E14	 6	12	 3	05	 23312504	 23444477	 23378490
RP11-91E20	 6	13	 3	05	 24486450	 24659598	 24573024
RP11-19C10	 6	14	 3	05	147210085	147210439	147210262
RP11-13F18	 6	15	 3	06	  1462375	  1633159	  1547767
RP11-24N8	 6	16	 3	06	  5617862	  5789302	  5703582
RP11-3D15	 6	17	 3	06	 21715614	 21863528	 21789571
RP11-53I19	 6	18	 3	06	 23410227	 23554431	 23482329
RP11-224B15	 6	19	 3	06	 23689545	 23689902	 23689723
RP11-52C20_2	 6	20	 3	06	 23943949	 24112567	 24028258
RP11-54H13	 6	21	 3	06	 32689826	 32876613	 32783219
RP11-119C22	 6	22	 3	06	 33848331	 34028435	 33938383
RP11-451E18	 6	23	 3	06	 51252527	 51423711	 51338119
RP11-449D13	 6	24	 3	07	 43237716	 43367716	 43302716
RP11-451M14	 6	25	 3	07	 77131839	 77305519	 77218679
RP11-240A17	 6	 1	 4	08	  1524456	  1524873	  1524664
RP11-121F7	 6	 2	 4	08	  3194954	  3324954	  3259954
RP11-140K14	 6	 3	 4	08	  4357589	  4537723	  4447656
RP11-236O1	 6	 4	 4	08	 15679519	 15679964	 15679741
RP11-182G2	 6	 5	 4	08	 15693947	 15694316	 15694131
RP11-233H21	 6	 6	 4	08	 19736277	 19753858	 19745067
RP11-93D21	 6	 7	 4	08	 20368744	 20498744	 20433744
RP11-110I16	 6	 8	 4	08	 21516148	 21646148	 21581148
RP11-288N10	 6	 9	 4	08	 23478554	 23478938	 23478746
RP11-5J20	 6	10	 4	08	 29353234	 29507616	 29430425
RP11-279J6	 6	11	 4	08	 29954453	 30120938	 30037695
RP11-57I3	 6	12	 4	08	 32531941	 32692374	 32612157
RP11-258M15	 6	13	 4	08	 33641085	 33802158	 33721621
RP11-237M13	 6	14	 4	08	 35697130	 35871741	 35784435
RP11-235D8	 6	15	 4	08	 37800785	 37930785	 37865785
RP11-268N2	 6	16	 4	08	 49230341	 49360341	 49295341
RP11-83O14	 6	17	 4	08	 53185951	 53186368	 53186159
RP11-221P7	 6	18	 4	08	 53717674	 53717924	 53717799
RP11-127B4	 6	19	 4	08	 55311049	 55311384	 55311216
RP11-172D2	 6	20	 4	08	 55849539	 55979539	 55914539
RP11-258B14	 6	21	 4	08	 61264084	 61264454	 61264269
RP11-99O22	 6	22	 4	10	 12334291	 12334593	 12334442
RP11-61P15	 6	23	 4	10	 13747454	 13911792	 13829623
RP11-19L14	 6	24	 4	10	 15593234	 15735479	 15664356
RP11-25E5	 6	25	 4	10	 18461491	 18618808	 18540149
RP11-73E18	 6	 1	 5	10	 22830006	 22960006	 22895006
RP11-60J16	 6	 2	 5	10	 20600401	 20771065	 20685733
RP11-181I11	 6	 3	 5	10	 30613300	 30613638	 30613469
RP11-149K18	 6	 4	 5	10	 35929689	 35930027	 35929858
RP11-70B16	 6	 5	 5	10	 34351481	 34351719	 34351600
RP11-127L3	 6	 6	 5	10	 44156734	 44182022	 44169378
RP11-48O11	 6	 7	 5	10	 43459315	 43595093	 43527204
RP11-92I18	 6	 8	 5	10	 50248132	 50413097	 50330614
RP11-33O2	 6	 9	 5	10	 67940034	 68070034	 68005034
RP11-99D16	 6	10	 5	10	 69643018	 69835324	 69739171
RP11-6P16	 6	11	 5	10	 70824040	 71006065	 70915052
RP11-41F17	 6	12	 5	10	 72037734	 72167734	 72102734
RP11-29P24	 6	13	 5	10	 72234905	 72420417	 72327661
RP11-50K4	 6	14	 5	10	 72895457	 73051498	 72973477
RP11-93O23	 6	15	 5	10	 82162331	 82331976	 82247153
RP11-32M14	 6	16	 5	10	 85385096	 85385400	 85385248
RP11-9M11	 6	17	 5	10	 88540902	 88670902	 88605902
RP11-90B18	 6	18	 5	10	 92873286	 93022726	 92948006
RP11-79M5	 6	19	 5	10	 96972981	 97159607	 97066294
RP11-123G19	 6	20	 5	10	 99157574	 99316215	 99236894
RP11-89H13	 6	21	 5	11	119511255	119672813	119592034
RP11-89P5	 6	22	 5	11	120091053	120251056	120171054
RP11-89P14_2	 6	23	 5	11	 18150643	 18280643	 18215643
RP11-90F13	 6	24	 5	11	 34768183	 34949951	 34859067
RP11-90K17	 6	25	 5	11	 85137538	 85342103	 85239820
RP11-91I5	 6	 1	 6	11	 14837356	 14991118	 14914237
RP11-622B13	 6	 2	 6	11	  5607922	  5737922	  5672922
RP11-715M10	 6	 3	 6	11	  6940920	  7136017	  7038468
RP11-848A21	 6	 4	 6	11	 57818205	 57948205	 57883205
RP11-449B21	 6	 5	 6	11	 83472691	 83658032	 83565361
RP11-18B9	 6	 6	 6	11	 40244954	 40374954	 40309954
RP11-102N4	 6	 7	 6	11	 36665880	 36835322	 36750601
RP11-627F21	 6	 8	 6	11	 57805136	 57935136	 57870136
RP11-44J5	 6	 9	 6	11	 72178375	 72350721	 72264548
RP11-19P3	 6	10	 6	11	 84347321	 84517431	 84432376
RP11-16K5	 6	11	 6	11	 95569596	 95712678	 95641137
RP11-100J10	 6	12	 6	11	112570339	112735821	112653080
RP11-11C15	 6	13	 6	11	122953485	123110831	123032158
RP11-53C3	 6	14	 6	12	 26255247	 26385247	 26320247
RP11-84J4	 6	15	 6	12	 28002290	 28002758	 28002524
RP11-78F16	 6	16	 6	12	 30740663	 30870663	 30805663
RP11-56J24	 6	17	 6	12	 31959002	 32128568	 32043785
RP11-29G23	 6	18	 6	12	 43908780	 43909199	 43908989
RP11-112M10	 6	19	 6	12	 49754564	 49884564	 49819564
RP11-79B13	 6	20	 6	14	 67744257	 67904880	 67824568
RP11-80L10	 6	21	 6	14	 79602555	 79779416	 79690985
RP11-81D11	 6	22	 6	14	 64128313	 64294463	 64211388
RP11-81F13	 6	23	 6	14	 36297743	 36467869	 36382806
RP11-88L4	 6	24	 6	14	 98453237	 98629253	 98541245
RP11-88N14	 6	25	 6	14	 39694531	 39886628	 39790579
RP11-91C17	 6	 1	 7	14	 31674735	 31849664	 31762199
RP11-115A12	 6	 2	 7	14	 20070776	 20220348	 20145562
RP11-451O22	 6	 3	 7	14	 89130447	 89312317	 89221382
RP11-63D17	 6	 4	 7	14	 77495925	 77673059	 77584492
RP11-218M19	 6	 5	 7	15	 21363543	 21364709	 21364126
RP11-171C8	 6	 6	 7	15	 22908050	 23068800	 22988425
RP11-226C3	 6	 7	 7		NA	NA	NA
RP11-88J10_1	 6	 8	 7	15	 41591918	 41763430	 41677674
RP11-117J16	 6	 9	 7	15	 40121666	 40290274	 40205970
RP11-133K1	 6	10	 7	15	 38241119	 38400125	 38320622
RP11-62L9	 6	11	 7	15	 37684087	 37828708	 37756397
RP11-66L23_1	 6	12	 7	15	 49300995	 49448561	 49374778
RP11-120O11	 6	13	 7	15	 57586567	 57757359	 57671963
RP11-18B17	 6	14	 7	15	 58576754	 58576945	 58576849
RP11-203F9	 6	15	 7	15	 58262560	 58401616	 58332088
RP11-53I4	 6	16	 7	15	 63023709	 63024157	 63023933
RP11-100N8	 6	17	 7	15	 61375336	 61540452	 61457894
RP11-207J8	 6	18	 7	15	 65816865	 65980527	 65898696
RP11-49H23	 6	19	 7	18	 64908973	 65089302	 64999137
RP11-53N15	 6	20	 7	18	 70195435	 70195693	 70195564
RP11-4B17	 6	21	 7	18	 72860583	 72990583	 72925583
RP11-7H17	 6	22	 7	18	 75216360	 75402240	 75309300
RP11-104N11	 6	23	 7	18	 33436610	 33608704	 33522657
CTD-2070A5	 6	24	 7	18	 49306984	 49307127	 49307055
RP11-89B14	 6	25	 7	18	 49043178	 49173178	 49108178
RP11-89P6	 6	 1	 8	18	  5665407	  5795407	  5730407
RP11-90A21	 6	 2	 8	18	 59860785	 60053371	 59957078
RP11-90E3	 6	 3	 8	02	 91611882	 91741882	 91676882
RP11-90G13	 6	 4	 8		NA	NA	NA
RP11-90B5_2	 6	 5	 8	18	 32375884	 32552502	 32464193
RP11-54G9	 6	 6	 8	19	  3006443	  3177704	  3092073
RP11-84C17	 6	 7	 8	19	  7777646	  7778013	  7777829
RP11-31N2	 6	 8	 8	19	 12553161	 12683161	 12618161
RP11-121I1	 6	 9	 8	19	 16006668	 16184014	 16095341
RP11-107O2	 6	10	 8	19	 14886464	 14886789	 14886626
RP11-206O6	 6	11	 8	19	 33315121	 33315441	 33315281
RP11-18J23	 6	12	 8	19	 48075706	 48076061	 48075883
RP11-19H11	 6	13	 8	19	 48973202	 48973538	 48973370
RP11-126L20	 6	14	 8	19	 50595496	 50725496	 50660496
RP11-43B2	 6	15	 8	19	 52665374	 52665729	 52665551
RP11-39J16	 6	16	 8	19	 54419827	 54588818	 54504322
RP11-35J17	 6	17	 8	19	 58760268	 58925754	 58843011
RP11-1B18	 6	18	 8	02	  8639083	  8792166	  8715624
RP11-1D5	 6	19	 8	17	  7918591	  8048591	  7983591
RP11-1G10	 6	20	 8	06	 14104046	 14279036	 14191541
RP11-2M12	 6	21	 8	15	 72002162	 72164226	 72083194
RP11-3B7	 6	22	 8	03	 49222550	 49393337	 49307943
RP11-3N16	 6	23	 8	19	 53269618	 53431708	 53350663
RP11-10L12_1	 6	24	 8	04	103981738	104172809	104077273
RP11-11J14	 6	25	 8		NA	NA	NA
RP11-12H2	 6	 1	 9	01	225605102	225800494	225702798
RP11-14B21_2	 6	 2	 9	21	 31204588	 31376316	 31290452
RP11-16B19	 6	 3	 9	21	 44958869	 45143207	 45051038
RP11-16N5	 6	 4	 9	03	106690111	106843652	106766881
RP11-25J3	 6	 5	 9	12	 74178809	 74333763	 74256286
RP11-27H1	 6	 6	 9	03	139886320	139997424	139941872
RP11-29N12	 6	 7	 9	15	 69211346	 69371886	 69291616
RP11-30J11	 6	 8	 9	08	 95287469	 95463204	 95375336
RP11-34F13	 6	 9	 9	15	 65763710	 65946571	 65855140
RP11-34O10	 6	10	 9	17	 18140795	 18318886	 18229840
RP11-51I5	 6	11	 9	02	 73958688	 74132347	 74045517
RP11-54A4	 6	12	 9	01	147258287	147441282	147349784
RP11-54C4	 6	13	 9	05	151093464	151263828	151178646
RP11-58A11	 6	14	 9	01	  6423652	  6599675	  6511663
RP11-59H1_2	 6	15	 9	12	 12766218	 12961341	 12863779
RP11-61E5	 6	16	 9	09	 71891102	 72021102	 71956102
RP11-349N23	 6	17	 9	18	 22611634	 22781317	 22696475
RP11-352P21	 6	18	 9	17	 64948449	 65112794	 65030621
RP11-354K1	 6	19	 9	01	208088891	208303132	208196011
RP11-355B11	 6	20	 9	02	 61571774	 61731466	 61651620
RP11-355H10	 6	21	 9	02	 15965374	 16164335	 16064854
RP11-357L2	 6	22	 9	02	160303301	160536544	160419922
RP11-370H3	 6	23	 9	X	117639705	117769705	117704705
RP11-373I6	 6	24	 9	03	190980069	191160124	191070096
RP11-378I6	 6	25	 9	09	 19869747	 20016958	 19943352
RP11-380J17	 6	 1	10	10	129673562	129796619	129735090
RP11-383B15	 6	 2	10	19	  3499580	  3706453	  3603016
RP11-383I5	 6	 3	10	02	158014895	158182906	158098900
RP11-394E1	 6	 4	10	02	206475319	206581412	206528365
RP11-395A23	 6	 5	10	02	231129740	231301872	231215806
RP11-397A2	 6	 6	10	04	 41012263	 41187976	 41100119
RP11-398O21	 6	 7	10	03	101790209	101969975	101880092
RP11-400K9	 6	 8	10	08	 54472063	 54667856	 54569959
RP11-400O10_1	 6	 9	10	Y	  2692881	  2821914	  2757397
RP11-418C2	 6	10	10	12	 11807595	 11977544	 11892569
RP11-420G6	 6	11	10	06	  2641222	  2815840	  2728531
RP11-423F16	 6	12	10	19	 56315908	 56503574	 56409741
RP11-425G1	 6	13	10	17	 34153267	 34349308	 34251287
RP11-425P5	 6	14	10	07	  6040701	  6253528	  6147114
RP11-427I6	 6	15	10	03	128793305	128983062	128888183
RP11-298O1	 6	16	10	20	 34949766	 35141727	 35045746
RP11-435I11	 6	17	10	08	 90943420	 91126303	 91034861
RP11-502K10	 6	18	10	16	 67635259	 67816094	 67725676
RP11-531A24	 6	19	10	08	 73980123	 74155352	 74067737
RP11-421C4_2	 6	20	10		NA	NA	NA
RP11-664N22	 6	21	10	02	    44073	   230847	   137460
RP11-652O18	 6	22	10	11	   149520	   296175	   222847
RP11-569D9_2	 6	23	10	13	113930806	114103243	114017024
RP11-277L10	 6	24	10	15	 99785815	 99952147	 99868981
RP11-133L7	 6	25	10	16	 88453529	 88637968	 88545748
RP11-241A16	 6	 1	11	18	 75884723	 76049932	 75967327
RP11-262F7	 6	 2	11	19	 61686833	 61852337	 61769585
RP11-1056I4	 6	 3	11	07	 72881890	 73084218	 72983054
RP11-262P20	 6	 4	11	04	  1847456	  2040900	  1944178
RP11-347D3	 6	 5	11	X	  8398298	  8605280	  8501789
RP11-465O5	 6	 6	11	17	 15046980	 15223450	 15135215
RP11-102E22_2	 6	 7	11	11	 44098955	 44271172	 44185063
RP11-1056I10	 6	 8	11	20	 10466685	 10674022	 10570353
RP11-1D19	 6	 9	11	03	196354095	196559735	196456915
RP11-1L4	 6	10	11	18	 23701725	 23871610	 23786667
RP11-6B6	 6	11	11	01	202239375	202402714	202321044
RP11-8D7	 6	12	11	13	110060634	110209675	110135154
RP11-10A19	 6	13	11	06	 32843694	 33023853	 32933773
RP11-11K16	 6	14	11	13	 31924066	 32090317	 32007191
RP11-422A6	 6	15	11	02	 15631937	 15768805	 15700371
RP11-424J10	 6	16	11	15	 71349769	 71563895	 71456832
RP11-425M5	 6	17	11	20	 35521258	 35715683	 35618470
RP11-426M1	 6	18	11	01	 12040823	 12192335	 12116579
RP11-428B4	 6	19	11	04	100084744	100197057	100140900
RP11-428O23	 6	20	11	17	 31799961	 31981478	 31890719
RP11-456P18	 6	21	11	01	158496620	158708282	158602451
RP11-459I19	 6	22	11	02	219352144	219558999	219455571
RP11-461O14	 6	23	11	05	137734102	137920380	137827241
RP11-464E15	 6	24	11	03	150169183	150333259	150251221
RP11-465N4	 6	25	11	01	198600139	198804859	198702499
RP11-469O11	 6	 1	12	04	166601702	166807588	166704645
RP11-491D6	 6	 2	12	03	 37034149	 37136520	 37085334
RP11-492P7	 6	 3	12	19	 51987985	 52169539	 52078762
RP11-499A10	 6	 4	12	12	 43051701	 43222392	 43137046
RP11-500M8	 6	 5	12	12	  4485584	  4674532	  4580058
RP11-501O7	 6	 6	12	02	 36681266	 36764922	 36723094
RP11-506D12	 6	 7	12	17	 46251786	 46333070	 46292428
RP11-525O22	 6	 8	12	08	 17783655	 17971653	 17877654
RP11-528N4	 6	 9	12	15	 88050516	 88247296	 88148906
RP11-534L20	 6	10	12	01	203028089	203135779	203081934
RP11-536C5	 6	11	12	01	156828090	156998925	156913507
RP11-537K8	 6	12	12	15	 62081999	 62256344	 62169171
RP11-542C16	 6	13	12	17	  7122588	  7223586	  7173087
RP11-671P4	 6	14	12	X	133236540	133431430	133333985
RP11-680F8	 6	15	12	15	 27723989	 27912107	 27818048
RP11-684N3	 6	16	12	11	131715372	131906576	131810974
RP11-687A13	 6	17	12	08	 63959208	 64140886	 64050047
RP11-687M15	 6	18	12	19	 51793958	 52003415	 51898686
RP11-694N4	 6	19	12	18	  3170432	  3362489	  3266460
CTB-68F18	 6	20	12	17	   117304	   117528	   117416
CTB-74G18	 6	21	12	18	   211936	   212039	   211987
CTB-129F16	 6	22	12	19	   241269	   241523	   241396
CTD-3018K1	 6	23	12	22	 49311620	 49441620	 49376620
CTC-225F6	 6	24	12		NA	NA	NA
RP1-240G13	 6	25	12	05	180610748	180611420	180611084
RP11-69G4_1	 6	13	13	02	182670510	182868798	182769654
RP11-30M1_1	 6	14	13	02	195293720	195479196	195386458
RP11-57C6_1	 6	15	13	02	201453608	201620494	201537051
RP11-225L15_1	 6	16	13	02	207216188	207216506	207216347
RP11-53G6_1	 6	17	13	02	220617776	220618102	220617939
RP11-247E23_1	 6	18	13	02	223503065	223633065	223568065
RP11-542D13	 6	19	13	02	 97564599	 97795025	 97679812
CTD-2084O7	 6	20	13	02	 47597334	 47727334	 47662334
CTD-2120O13	 6	21	13	02	201908953	201909164	201909058
RP11-79A11	 6	22	13	02	151147447	151313669	151230558
RP11-79C17	 6	23	13	02	174027482	174188084	174107783
RP11-79K7	 6	24	13	02	109701502	109869691	109785596
RP11-80L22	 6	25	13	02	161357702	161523948	161440825
RP11-81F17	 6	 1	14	02	171232191	171390500	171311345
RP11-81H1	 6	 2	14	02	138812118	138980360	138896239
RP11-81L7_2	 6	 3	14	02	 57065869	 57218868	 57142368
RP11-81N1	 6	 4	14	02	170871808	171012981	170942394
RP11-81P3	 6	 5	14	02	201557652	201712021	201634836
RP11-89O10	 6	 6	14	02	105486606	105667622	105577114
RP11-89B13	 6	 7	14	02	197234086	197389970	197312028
RP11-89F19	 6	 8	14	02	 38371382	 38541004	 38456193
RP11-89J19	 6	 9	14	02	 97507068	 97666063	 97586565
RP11-89L3	 6	10	14	02	146734712	146878159	146806435
RP11-89N23	 6	11	14	02	241744278	241908306	241826292
RP11-239C17	 6	12	14	04	 26067738	 26178949	 26123343
RP11-210B2	 6	13	14	04	 28605123	 28605524	 28605323
RP11-53F2	 6	14	14	04	 29347252	 29491912	 29419582
RP11-53F9	 6	15	14	04	 30483014	 30613014	 30548014
RP11-180G13	 6	16	14	04	 30666325	 30834085	 30750205
RP11-85B10	 6	17	14	04	 35451937	 35452381	 35452159
RP11-121C2	 6	18	14	04	 47644149	 47865564	 47754856
RP11-72P14	 6	19	14	04	 48178603	 48308603	 48243603
RP11-217B22_2	 6	20	14	04	 48744131	 48839424	 48791777
RP11-32K21	 6	21	14	04	 52870677	 52871018	 52870847
RP11-175I24	 6	22	14	04	 53582533	 53712533	 53647533
RP11-80L11	 6	23	14	04	 55035893	 55178329	 55107111
RP11-144I19	 6	24	14	04	 76495364	 76647575	 76571469
RP11-17P19	 6	25	14	04	 79222718	 79359277	 79290997
RP11-131O10	 6	 1	15	04	 83332028	 83332197	 83332112
RP11-11P12	 6	 2	15	04	 83957805	 84122920	 84040362
RP11-87J14	 6	 3	15	04	 84641001	 84771001	 84706001
RP11-283H13	 6	 4	15	04	 85163504	 85163847	 85163675
RP11-144B4	 6	 5	15	04	 98637209	 98784302	 98710755
RP11-85I10	 6	 6	15	04	100586064	100586266	100586165
RP11-110C16	 6	 7	15	04	103205367	103358818	103282092
RP11-18D18	 6	 8	15	04	112622693	112752693	112687693
RP11-131K16	 6	 9	15	04	121784379	121784735	121784557
RP11-6K22	 6	10	15	04	120282908	120456762	120369835
RP11-79I8	 6	11	15	05	 20798444	 20959340	 20878892
RP11-79K4	 6	12	15	05	140345818	140518162	140431990
RP11-80D2	 6	13	15	05	 87318907	 87448907	 87383907
RP11-81D21	 6	14	15	05	136572678	136733682	136653180
RP11-81L1	 6	15	15	05	122442254	122602832	122522543
RP11-81P9	 6	16	15	05	 14669927	 14839486	 14754706
RP11-89P1	 6	17	15	05	160359092	160509502	160434297
RP11-89N22	 6	18	15	05	  3963012	  4093012	  4028012
RP11-90A15	 6	19	15	05	117468807	117612239	117540523
RP11-90E15	 6	20	15	05	 25999396	 26168302	 26083849
RP11-90G17	 6	21	15	05	 25142886	 25310682	 25226784
RP11-90M19	 6	22	15	05	 97928034	 98106170	 98017102
RP11-91G17	 6	23	15	05	153948255	154125685	154036970
RP11-91E14	 6	24	15	05	 23312504	 23444477	 23378490
RP11-91E20	 6	25	15	05	 24486450	 24659598	 24573024
RP11-19C10	 6	 1	16	05	147210085	147210439	147210262
RP11-13F18	 6	 2	16	06	  1462375	  1633159	  1547767
RP11-24N8	 6	 3	16	06	  5617862	  5789302	  5703582
RP11-3D15	 6	 4	16	06	 21715614	 21863528	 21789571
RP11-53I19	 6	 5	16	06	 23410227	 23554431	 23482329
RP11-224B15	 6	 6	16	06	 23689545	 23689902	 23689723
RP11-52C20_2	 6	 7	16	06	 23943949	 24112567	 24028258
RP11-54H13	 6	 8	16	06	 32689826	 32876613	 32783219
RP11-119C22	 6	 9	16	06	 33848331	 34028435	 33938383
RP11-451E18	 6	10	16	06	 51252527	 51423711	 51338119
RP11-449D13	 6	11	16	07	 43237716	 43367716	 43302716
RP11-451M14	 6	12	16	07	 77131839	 77305519	 77218679
RP11-240A17	 6	13	16	08	  1524456	  1524873	  1524664
RP11-121F7	 6	14	16	08	  3194954	  3324954	  3259954
RP11-140K14	 6	15	16	08	  4357589	  4537723	  4447656
RP11-236O1	 6	16	16	08	 15679519	 15679964	 15679741
RP11-182G2	 6	17	16	08	 15693947	 15694316	 15694131
RP11-233H21	 6	18	16	08	 19736277	 19753858	 19745067
RP11-93D21	 6	19	16	08	 20368744	 20498744	 20433744
RP11-110I16	 6	20	16	08	 21516148	 21646148	 21581148
RP11-288N10	 6	21	16	08	 23478554	 23478938	 23478746
RP11-5J20	 6	22	16	08	 29353234	 29507616	 29430425
RP11-279J6	 6	23	16	08	 29954453	 30120938	 30037695
RP11-57I3	 6	24	16	08	 32531941	 32692374	 32612157
RP11-258M15	 6	25	16	08	 33641085	 33802158	 33721621
RP11-237M13	 6	 1	17	08	 35697130	 35871741	 35784435
RP11-235D8	 6	 2	17	08	 37800785	 37930785	 37865785
RP11-268N2	 6	 3	17	08	 49230341	 49360341	 49295341
RP11-83O14	 6	 4	17	08	 53185951	 53186368	 53186159
RP11-221P7	 6	 5	17	08	 53717674	 53717924	 53717799
RP11-127B4	 6	 6	17	08	 55311049	 55311384	 55311216
RP11-172D2	 6	 7	17	08	 55849539	 55979539	 55914539
RP11-258B14	 6	 8	17	08	 61264084	 61264454	 61264269
RP11-99O22	 6	 9	17	10	 12334291	 12334593	 12334442
RP11-61P15	 6	10	17	10	 13747454	 13911792	 13829623
RP11-19L14	 6	11	17	10	 15593234	 15735479	 15664356
RP11-25E5	 6	12	17	10	 18461491	 18618808	 18540149
RP11-73E18	 6	13	17	10	 22830006	 22960006	 22895006
RP11-60J16	 6	14	17	10	 20600401	 20771065	 20685733
RP11-181I11	 6	15	17	10	 30613300	 30613638	 30613469
RP11-149K18	 6	16	17	10	 35929689	 35930027	 35929858
RP11-70B16	 6	17	17	10	 34351481	 34351719	 34351600
RP11-127L3	 6	18	17	10	 44156734	 44182022	 44169378
RP11-48O11	 6	19	17	10	 43459315	 43595093	 43527204
RP11-92I18	 6	20	17	10	 50248132	 50413097	 50330614
RP11-33O2	 6	21	17	10	 67940034	 68070034	 68005034
RP11-99D16	 6	22	17	10	 69643018	 69835324	 69739171
RP11-6P16	 6	23	17	10	 70824040	 71006065	 70915052
RP11-41F17	 6	24	17	10	 72037734	 72167734	 72102734
RP11-29P24	 6	25	17	10	 72234905	 72420417	 72327661
RP11-50K4	 6	 1	18	10	 72895457	 73051498	 72973477
RP11-93O23	 6	 2	18	10	 82162331	 82331976	 82247153
RP11-32M14	 6	 3	18	10	 85385096	 85385400	 85385248
RP11-9M11	 6	 4	18	10	 88540902	 88670902	 88605902
RP11-90B18	 6	 5	18	10	 92873286	 93022726	 92948006
RP11-79M5	 6	 6	18	10	 96972981	 97159607	 97066294
RP11-123G19	 6	 7	18	10	 99157574	 99316215	 99236894
RP11-89H13	 6	 8	18	11	119511255	119672813	119592034
RP11-89P5	 6	 9	18	11	120091053	120251056	120171054
RP11-89P14_2	 6	10	18	11	 18150643	 18280643	 18215643
RP11-90F13	 6	11	18	11	 34768183	 34949951	 34859067
RP11-90K17	 6	12	18	11	 85137538	 85342103	 85239820
RP11-91I5	 6	13	18	11	 14837356	 14991118	 14914237
RP11-622B13	 6	14	18	11	  5607922	  5737922	  5672922
RP11-715M10	 6	15	18	11	  6940920	  7136017	  7038468
RP11-848A21	 6	16	18	11	 57818205	 57948205	 57883205
RP11-449B21	 6	17	18	11	 83472691	 83658032	 83565361
RP11-18B9	 6	18	18	11	 40244954	 40374954	 40309954
RP11-102N4	 6	19	18	11	 36665880	 36835322	 36750601
RP11-627F21	 6	20	18	11	 57805136	 57935136	 57870136
RP11-44J5	 6	21	18	11	 72178375	 72350721	 72264548
RP11-19P3	 6	22	18	11	 84347321	 84517431	 84432376
RP11-16K5	 6	23	18	11	 95569596	 95712678	 95641137
RP11-100J10	 6	24	18	11	112570339	112735821	112653080
RP11-11C15	 6	25	18	11	122953485	123110831	123032158
RP11-53C3	 6	 1	19	12	 26255247	 26385247	 26320247
RP11-84J4	 6	 2	19	12	 28002290	 28002758	 28002524
RP11-78F16	 6	 3	19	12	 30740663	 30870663	 30805663
RP11-56J24	 6	 4	19	12	 31959002	 32128568	 32043785
RP11-29G23	 6	 5	19	12	 43908780	 43909199	 43908989
RP11-112M10	 6	 6	19	12	 49754564	 49884564	 49819564
RP11-79B13	 6	 7	19	14	 67744257	 67904880	 67824568
RP11-80L10	 6	 8	19	14	 79602555	 79779416	 79690985
RP11-81D11	 6	 9	19	14	 64128313	 64294463	 64211388
RP11-81F13	 6	10	19	14	 36297743	 36467869	 36382806
RP11-88L4	 6	11	19	14	 98453237	 98629253	 98541245
RP11-88N14	 6	12	19	14	 39694531	 39886628	 39790579
RP11-91C17	 6	13	19	14	 31674735	 31849664	 31762199
RP11-115A12	 6	14	19	14	 20070776	 20220348	 20145562
RP11-451O22	 6	15	19	14	 89130447	 89312317	 89221382
RP11-63D17	 6	16	19	14	 77495925	 77673059	 77584492
RP11-218M19	 6	17	19	15	 21363543	 21364709	 21364126
RP11-171C8	 6	18	19	15	 22908050	 23068800	 22988425
RP11-226C3	 6	19	19		NA	NA	NA
RP11-88J10_1	 6	20	19	15	 41591918	 41763430	 41677674
RP11-117J16	 6	21	19	15	 40121666	 40290274	 40205970
RP11-133K1	 6	22	19	15	 38241119	 38400125	 38320622
RP11-62L9	 6	23	19	15	 37684087	 37828708	 37756397
RP11-66L23_1	 6	24	19	15	 49300995	 49448561	 49374778
RP11-120O11	 6	25	19	15	 57586567	 57757359	 57671963
RP11-18B17	 6	 1	20	15	 58576754	 58576945	 58576849
RP11-203F9	 6	 2	20	15	 58262560	 58401616	 58332088
RP11-53I4	 6	 3	20	15	 63023709	 63024157	 63023933
RP11-100N8	 6	 4	20	15	 61375336	 61540452	 61457894
RP11-207J8	 6	 5	20	15	 65816865	 65980527	 65898696
RP11-49H23	 6	 6	20	18	 64908973	 65089302	 64999137
RP11-53N15	 6	 7	20	18	 70195435	 70195693	 70195564
RP11-4B17	 6	 8	20	18	 72860583	 72990583	 72925583
RP11-7H17	 6	 9	20	18	 75216360	 75402240	 75309300
RP11-104N11	 6	10	20	18	 33436610	 33608704	 33522657
CTD-2070A5	 6	11	20	18	 49306984	 49307127	 49307055
RP11-89B14	 6	12	20	18	 49043178	 49173178	 49108178
RP11-89P6	 6	13	20	18	  5665407	  5795407	  5730407
RP11-90A21	 6	14	20	18	 59860785	 60053371	 59957078
RP11-90E3	 6	15	20	02	 91611882	 91741882	 91676882
RP11-90G13	 6	16	20		NA	NA	NA
RP11-90B5_2	 6	17	20	18	 32375884	 32552502	 32464193
RP11-54G9	 6	18	20	19	  3006443	  3177704	  3092073
RP11-84C17	 6	19	20	19	  7777646	  7778013	  7777829
RP11-31N2	 6	20	20	19	 12553161	 12683161	 12618161
RP11-121I1	 6	21	20	19	 16006668	 16184014	 16095341
RP11-107O2	 6	22	20	19	 14886464	 14886789	 14886626
RP11-206O6	 6	23	20	19	 33315121	 33315441	 33315281
RP11-18J23	 6	24	20	19	 48075706	 48076061	 48075883
RP11-19H11	 6	25	20	19	 48973202	 48973538	 48973370
RP11-126L20	 6	 1	21	19	 50595496	 50725496	 50660496
RP11-43B2	 6	 2	21	19	 52665374	 52665729	 52665551
RP11-39J16	 6	 3	21	19	 54419827	 54588818	 54504322
RP11-35J17	 6	 4	21	19	 58760268	 58925754	 58843011
RP11-1B18	 6	 5	21	02	  8639083	  8792166	  8715624
RP11-1D5	 6	 6	21	17	  7918591	  8048591	  7983591
RP11-1G10	 6	 7	21	06	 14104046	 14279036	 14191541
RP11-2M12	 6	 8	21	15	 72002162	 72164226	 72083194
RP11-3B7	 6	 9	21	03	 49222550	 49393337	 49307943
RP11-3N16	 6	10	21	19	 53269618	 53431708	 53350663
RP11-10L12_1	 6	11	21	04	103981738	104172809	104077273
RP11-11J14	 6	12	21		NA	NA	NA
RP11-12H2	 6	13	21	01	225605102	225800494	225702798
RP11-14B21_2	 6	14	21	21	 31204588	 31376316	 31290452
RP11-16B19	 6	15	21	21	 44958869	 45143207	 45051038
RP11-16N5	 6	16	21	03	106690111	106843652	106766881
RP11-25J3	 6	17	21	12	 74178809	 74333763	 74256286
RP11-27H1	 6	18	21	03	139886320	139997424	139941872
RP11-29N12	 6	19	21	15	 69211346	 69371886	 69291616
RP11-30J11	 6	20	21	08	 95287469	 95463204	 95375336
RP11-34F13	 6	21	21	15	 65763710	 65946571	 65855140
RP11-34O10	 6	22	21	17	 18140795	 18318886	 18229840
RP11-51I5	 6	23	21	02	 73958688	 74132347	 74045517
RP11-54A4	 6	24	21	01	147258287	147441282	147349784
RP11-54C4	 6	25	21	05	151093464	151263828	151178646
RP11-58A11	 6	 1	22	01	  6423652	  6599675	  6511663
RP11-59H1_2	 6	 2	22	12	 12766218	 12961341	 12863779
RP11-61E5	 6	 3	22	09	 71891102	 72021102	 71956102
RP11-349N23	 6	 4	22	18	 22611634	 22781317	 22696475
RP11-352P21	 6	 5	22	17	 64948449	 65112794	 65030621
RP11-354K1	 6	 6	22	01	208088891	208303132	208196011
RP11-355B11	 6	 7	22	02	 61571774	 61731466	 61651620
RP11-355H10	 6	 8	22	02	 15965374	 16164335	 16064854
RP11-357L2	 6	 9	22	02	160303301	160536544	160419922
RP11-370H3	 6	10	22	X	117639705	117769705	117704705
RP11-373I6	 6	11	22	03	190980069	191160124	191070096
RP11-378I6	 6	12	22	09	 19869747	 20016958	 19943352
RP11-380J17	 6	13	22	10	129673562	129796619	129735090
RP11-383B15	 6	14	22	19	  3499580	  3706453	  3603016
RP11-383I5	 6	15	22	02	158014895	158182906	158098900
RP11-394E1	 6	16	22	02	206475319	206581412	206528365
RP11-395A23	 6	17	22	02	231129740	231301872	231215806
RP11-397A2	 6	18	22	04	 41012263	 41187976	 41100119
RP11-398O21	 6	19	22	03	101790209	101969975	101880092
RP11-400K9	 6	20	22	08	 54472063	 54667856	 54569959
RP11-400O10_1	 6	21	22	Y	  2692881	  2821914	  2757397
RP11-418C2	 6	22	22	12	 11807595	 11977544	 11892569
RP11-420G6	 6	23	22	06	  2641222	  2815840	  2728531
RP11-423F16	 6	24	22	19	 56315908	 56503574	 56409741
RP11-425G1	 6	25	22	17	 34153267	 34349308	 34251287
RP11-425P5	 6	 1	23	07	  6040701	  6253528	  6147114
RP11-427I6	 6	 2	23	03	128793305	128983062	128888183
RP11-298O1	 6	 3	23	20	 34949766	 35141727	 35045746
RP11-435I11	 6	 4	23	08	 90943420	 91126303	 91034861
RP11-502K10	 6	 5	23	16	 67635259	 67816094	 67725676
RP11-531A24	 6	 6	23	08	 73980123	 74155352	 74067737
RP11-421C4_2	 6	 7	23		NA	NA	NA
RP11-664N22	 6	 8	23	02	    44073	   230847	   137460
RP11-652O18	 6	 9	23	11	   149520	   296175	   222847
RP11-569D9_2	 6	10	23	13	113930806	114103243	114017024
RP11-277L10	 6	11	23	15	 99785815	 99952147	 99868981
RP11-133L7	 6	12	23	16	 88453529	 88637968	 88545748
RP11-241A16	 6	13	23	18	 75884723	 76049932	 75967327
RP11-262F7	 6	14	23	19	 61686833	 61852337	 61769585
RP11-1056I4	 6	15	23	07	 72881890	 73084218	 72983054
RP11-262P20	 6	16	23	04	  1847456	  2040900	  1944178
RP11-347D3	 6	17	23	X	  8398298	  8605280	  8501789
RP11-465O5	 6	18	23	17	 15046980	 15223450	 15135215
RP11-102E22_2	 6	19	23	11	 44098955	 44271172	 44185063
RP11-1056I10	 6	20	23	20	 10466685	 10674022	 10570353
RP11-1D19	 6	21	23	03	196354095	196559735	196456915
RP11-1L4	 6	22	23	18	 23701725	 23871610	 23786667
RP11-6B6	 6	23	23	01	202239375	202402714	202321044
RP11-8D7	 6	24	23	13	110060634	110209675	110135154
RP11-10A19	 6	25	23	06	 32843694	 33023853	 32933773
RP11-11K16	 6	 1	24	13	 31924066	 32090317	 32007191
RP11-422A6	 6	 2	24	02	 15631937	 15768805	 15700371
RP11-424J10	 6	 3	24	15	 71349769	 71563895	 71456832
RP11-425M5	 6	 4	24	20	 35521258	 35715683	 35618470
RP11-426M1	 6	 5	24	01	 12040823	 12192335	 12116579
RP11-428B4	 6	 6	24	04	100084744	100197057	100140900
RP11-428O23	 6	 7	24	17	 31799961	 31981478	 31890719
RP11-456P18	 6	 8	24	01	158496620	158708282	158602451
RP11-459I19	 6	 9	24	02	219352144	219558999	219455571
RP11-461O14	 6	10	24	05	137734102	137920380	137827241
RP11-464E15	 6	11	24	03	150169183	150333259	150251221
RP11-465N4	 6	12	24	01	198600139	198804859	198702499
RP11-469O11	 6	13	24	04	166601702	166807588	166704645
RP11-491D6	 6	14	24	03	 37034149	 37136520	 37085334
RP11-492P7	 6	15	24	19	 51987985	 52169539	 52078762
RP11-499A10	 6	16	24	12	 43051701	 43222392	 43137046
RP11-500M8	 6	17	24	12	  4485584	  4674532	  4580058
RP11-501O7	 6	18	24	02	 36681266	 36764922	 36723094
RP11-506D12	 6	19	24	17	 46251786	 46333070	 46292428
RP11-525O22	 6	20	24	08	 17783655	 17971653	 17877654
RP11-528N4	 6	21	24	15	 88050516	 88247296	 88148906
RP11-534L20	 6	22	24	01	203028089	203135779	203081934
RP11-536C5	 6	23	24	01	156828090	156998925	156913507
RP11-537K8	 6	24	24	15	 62081999	 62256344	 62169171
RP11-542C16	 6	25	24	17	  7122588	  7223586	  7173087
RP11-671P4	 6	 1	25	X	133236540	133431430	133333985
RP11-680F8	 6	 2	25	15	 27723989	 27912107	 27818048
RP11-684N3	 6	 3	25	11	131715372	131906576	131810974
RP11-687A13	 6	 4	25	08	 63959208	 64140886	 64050047
RP11-687M15	 6	 5	25	19	 51793958	 52003415	 51898686
RP11-694N4	 6	 6	25	18	  3170432	  3362489	  3266460
CTB-68F18	 6	 7	25	17	   117304	   117528	   117416
CTB-74G18	 6	 8	25	18	   211936	   212039	   211987
CTB-129F16	 6	 9	25	19	   241269	   241523	   241396
CTD-3018K1	 6	10	25	22	 49311620	 49441620	 49376620
CTC-225F6	 6	11	25		NA	NA	NA
RP1-240G13	 6	12	25	05	180610748	180611420	180611084
RP11-89K16	 7	 1	 1	01	 23839712	 24012090	 23925901
RP11-89O18	 7	 2	 1	01	 38621286	 38787238	 38704262
RP11-89F7	 7	 3	 1	01	 19926631	 20086560	 20006595
RP11-89F10	 7	 4	 1		NA	NA	NA
RP11-89N3	 7	 5	 1	01	206417554	206613451	206515502
RP11-89N10	 7	 6	 1	01	 38105322	 38235322	 38170322
RP11-90J3	 7	 7	 1	01	117116156	117274081	117195118
RP11-90N15	 7	 8	 1	01	 98919513	 99075843	 98997678
RP11-91N1	 7	 9	 1	01	184688030	184843198	184765614
RP11-91K5	 7	10	 1	01	 86669378	 86811559	 86740468
RP11-91K17	 7	11	 1	01	173437900	173621598	173529749
RP11-91C5	 7	12	 1	01	242509745	242668792	242589268
RP11-88B10	 7	13	 1	01	 74352566	 74530598	 74441582
RP11-91M14	 7	14	 1	01	236649463	236831624	236740543
RP11-185P14_1	 7	15	 1	02	  9547577	  9547954	  9547765
RP11-81F24_1	 7	16	 1	02	 15177860	 15178217	 15178038
RP11-171A13	 7	17	 1	02	 19176523	 19306523	 19241523
RP11-72H12	 7	18	 1	02	 28814235	 28976646	 28895440
RP11-84M16_1	 7	19	 1	02	 85988496	 85988850	 85988673
RP11-8C18_1	 7	20	 1	02	105912073	106042073	105977073
RP11-218F21_1	 7	21	 1	02	112714665	112714965	112714815
RP11-67G15_1	 7	22	 1	02	127677441	127816311	127746876
RP11-9L19_1	 7	23	 1	02	133997687	134169585	134083636
RP11-29N17_1	 7	24	 1	02	141479850	141609850	141544850
CTD-2199G5	 7	25	 1	03	 53697245	 53827245	 53762245
RP11-79K17	 7	 1	 2	03	 58758998	 58887561	 58823279
RP11-79O17	 7	 2	 2	03	170680195	170810195	170745195
RP11-79C12	 7	 3	 2		NA	NA	NA
RP11-79G24	 7	 4	 2	03	163022425	163167218	163094821
RP11-79M2	 7	 5	 2	03	123351114	123538059	123444586
RP11-81N21	 7	 6	 2	03	 44369382	 44545708	 44457545
RP11-88H6	 7	 7	 2	03	192493858	192676944	192585401
RP11-88P6	 7	 8	 2	03	188693479	188860124	188776801
RP11-89A12	 7	 9	 2	03	 68124783	 68296185	 68210484
RP11-89K24	 7	10	 2	03	 54700836	 54830836	 54765836
RP11-89B3	 7	11	 2	03	180795915	180964832	180880373
RP11-90N21	 7	12	 2	03	158817681	158979205	158898443
RP11-91B7	 7	13	 2	03	168998474	169156089	169077281
RP11-91F17	 7	14	 2	03	167549993	167697600	167623796
RP11-91P19	 7	15	 2	03	 46655434	 46847262	 46751348
RP11-91M15	 7	16	 2	03	 96443143	 96627928	 96535535
RP11-91I6	 7	17	 2	03	 23036245	 23190491	 23113368
RP11-574C8	 7	18	 2	03	118871138	119079303	118975220
RP11-91K9	 7	19	 2	03	178971544	179129183	179050363
RP11-69L7	 7	20	 2	04	   752619	   906613	   829616
RP11-237C24	 7	21	 2	04	  4538586	  4538856	  4538721
RP11-97H19	 7	22	 2	04	  6879990	  7009990	  6944990
RP11-101J14	 7	23	 2	04	  8096434	  8269961	  8183197
RP11-22L20	 7	24	 2	05	 55925160	 56066344	 55995752
RP11-190C5	 7	25	 2	05	 57604743	 57604993	 57604868
RP11-174I22	 7	 1	 3	05	 62938849	 62939173	 62939011
RP11-87D20	 7	 2	 3	05	 66078534	 66078861	 66078697
RP11-40N8	 7	 3	 3	05	 67274446	 67274799	 67274622
RP11-172K14	 7	 4	 3	05	 74563429	 74563728	 74563578
RP11-252I13	 7	 5	 3	05	106956474	107135339	107045906
RP11-13O21	 7	 6	 3	05	111669994	111846228	111758111
RP11-58G19	 7	 7	 3	05	113663712	113804301	113734006
RP11-73N22	 7	 8	 3	05	117015415	117015749	117015582
RP11-265M23	 7	 9	 3	05	122505608	122677181	122591394
RP11-209F21	 7	10	 3	05	124913780	124914154	124913967
RP11-109B15	 7	11	 3	05	151552343	151730137	151641240
RP11-170L13	 7	12	 3	05	155123958	155288478	155206218
RP11-47O12	 7	13	 3	05	156615433	156773306	156694369
RP11-82E8	 7	14	 3	05	157651610	157651988	157651799
RP11-62G13	 7	15	 3	05	160654723	160806043	160730383
RP11-210K16	 7	16	 3	05	160671381	160686880	160679130
RP11-105L4	 7	17	 3	05	172937353	173088063	173012708
RP11-125L2	 7	18	 3	05	173447702	173616629	173532165
RP11-51D11	 7	19	 3	05	179112541	179112945	179112743
RP11-13H10	 7	20	 3	05	  4351713	  4533623	  4442668
RP11-114K6	 7	21	 3	05	 94201672	 94370338	 94286005
RP11-467A2	 7	22	 3	05	 72108607	 72276723	 72192665
RP11-77E2	 7	23	 3	07	107112166	107279614	107195890
RP11-12L9	 7	24	 3	07	111943780	112104490	112024135
RP11-110C11	 7	25	 3	07	115008147	115158349	115083248
RP11-95L16	 7	 1	 4	07	115351579	115481579	115416579
RP11-3L10	 7	 2	 4	07	120631254	120795956	120713605
RP11-48O1	 7	 3	 4	07	121434699	121564699	121499699
RP11-118J20	 7	 4	 4	07	132850218	133018477	132934347
RP11-137O4	 7	 5	 4	07	137552004	137723618	137637811
RP11-188A12	 7	 6	 4	07	143039542	143039935	143039738
RP11-86L18	 7	 7	 4	07	153645376	153645775	153645575
RP11-106C6	 7	 8	 4	07	147678480	147853627	147766053
CTD-2027I18	 7	 9	 4	07	150137757	150343539	150240648
RP11-80J22	 7	10	 4	07	154063095	154225470	154144282
RP11-80L24	 7	11	 4	07	 55650380	 55784518	 55717449
RP11-80P24	 7	12	 4	07	101197438	101375426	101286432
RP11-81B1	 7	13	 4	07	148065444	148195444	148130444
RP11-81F15	 7	14	 4	07	 27566855	 27746114	 27656484
RP11-81H15	 7	15	 4	07	 27566856	 27746125	 27656490
RP11-89P11	 7	16	 4	07	147485335	147638644	147561989
RP11-90C3	 7	17	 4	07	 64115109	 64274360	 64194734
RP11-90C15	 7	18	 4	07	 45154815	 45314911	 45234863
RP11-90H9	 7	19	 4	07	 92153659	 92317869	 92235764
RP11-90J13	 7	20	 4	07	 31631283	 31802477	 31716880
RP11-90L21	 7	21	 4	07	120708290	120870296	120789293
RP11-32M4	 7	22	 4	09	107508104	107638104	107573104
RP11-81P13_1	 7	23	 4	09	110123103	110306968	110215035
RP11-4O1	 7	24	 4	09	111819315	112008483	111913899
RP11-10I9	 7	25	 4	09	113124898	113306830	113215864
RP11-9M16	 7	 1	 5	09	114206979	114367618	114287298
RP11-46E19	 7	 2	 5	09	114733021	114885449	114809235
RP11-216L13	 7	 3	 5	09	136891804	137073807	136982805
CTD-2097K16	 7	 4	 5	09	 21957827	 21958227	 21958027
RP11-79E21	 7	 5	 5	09	 32109918	 32256768	 32183343
RP11-79J13	 7	 6	 5	09	 81467826	 81642948	 81555387
RP11-79K11	 7	 7	 5	09	 29942964	 30116164	 30029564
RP11-79B9	 7	 8	 5	09	 14010093	 14171677	 14090885
RP11-81P5_2	 7	 9	 5	09	132115449	132308214	132211831
RP11-88F16	 7	10	 5	09	114723832	114912451	114818141
RP11-88P16	 7	11	 5	09	  1658005	  1816675	  1737340
RP11-89C16	 7	12	 5	09	 10760841	 10933256	 10847048
RP11-89K20	 7	13	 5	09	 70637780	 70796742	 70717261
RP11-89H6	 7	14	 5	09	 12644083	 12774083	 12709083
RP11-91E3	 7	15	 5	09	  9554543	  9689968	  9622255
RP11-451E16	 7	16	 5	09	118116150	118310825	118213487
RP11-451O4	 7	17	 5	09	134516033	134646033	134581033
RP11-10D13	 7	18	 5	10	   214399	   366376	   290387
RP11-180C18	 7	19	 5	10	  1518383	  1518466	  1518424
RP11-23O12_1	 7	20	 5	10	  3658177	  3829073	  3743625
RP11-215H8	 7	21	 5	11	 78637747	 78638088	 78637917
RP11-40G3	 7	22	 5	11	 82944934	 83074934	 83009934
RP11-275O16	 7	23	 5	11	 83238616	 83238960	 83238788
RP11-131C11	 7	24	 5	11	 84986813	 85172914	 85079863
RP11-42G23	 7	25	 5	11	 89953756	 90083756	 90018756
RP11-163O18	 7	 1	 6	11	 92905803	 93087588	 92996695
RP11-276O11	 7	 2	 6	11	105262408	105262775	105262591
RP11-42L18	 7	 3	 6	11	107422086	107586712	107504399
RP11-2F21	 7	 4	 6	11	109417425	109601340	109509382
RP11-49A9	 7	 5	 6	11	109828117	109979883	109904000
RP11-47N15	 7	 6	 6	11	111597475	111791409	111694442
RP11-279M1	 7	 7	 6	11	113774463	113774838	113774650
RP11-32A17	 7	 8	 6	11	120466222	120567408	120516815
RP11-145I11	 7	 9	 6	11	121670407	121828933	121749670
RP11-87O12	 7	10	 6	11	122698285	122828285	122763285
RP11-20M1	 7	11	 6	11	125827486	125957486	125892486
RP11-112M22	 7	12	 6	11	127647353	127788923	127718138
RP11-17M17	 7	13	 6	11	132052507	132205819	132129163
RP11-79A4	 7	14	 6	11	 48644474	 48801171	 48722822
RP11-79G4_2	 7	15	 6	11	 41558232	 41710577	 41634404
RP11-79B7	 7	16	 6	11	 77441076	 77548213	 77494644
RP11-79N15_2	 7	17	 6	11	 15256088	 15424709	 15340398
RP11-80F20	 7	18	 6	11	 86533396	 86705573	 86619484
RP11-80N22	 7	19	 6	11	 65805679	 65980427	 65893053
RP11-91F3	 7	20	 6	13	 62865405	 63023277	 62944341
RP11-91J7	 7	21	 6	13	 52272205	 52443084	 52357644
RP11-91O1	 7	22	 6	13	 89774076	 89904076	 89839076
RP11-91K18	 7	23	 6	13	 35802749	 35965115	 35883932
RP11-91E24	 7	24	 6	13	104485442	104642484	104563963
RP11-451O10	 7	25	 6	13	 69110652	 69275204	 69192928
RP11-125A5	 7	 1	 7	14	 28581577	 28768137	 28674857
RP11-2K1	 7	 2	 7	14	 30869243	 31053560	 30961401
RP11-37F23	 7	 3	 7	14	 31343434	 31473434	 31408434
RP11-29A7	 7	 4	 7	14	 33639264	 33788462	 33713863
RP11-26M6	 7	 5	 7	14	 34404822	 34591592	 34498207
RP11-23D3	 7	 6	 7	14	 39757221	 39912087	 39834654
RP11-205K20	 7	 7	 7	14	 54683746	 54813746	 54748746
RP11-105H21	 7	 8	 7	14	 55257573	 55440666	 55349119
RP11-10P7	 7	 9	 7	14	 55968549	 56129687	 56049118
RP11-64I19	 7	10	 7	14	 60551315	 60681315	 60616315
RP11-14C21	 7	11	 7	14	 63712416	 63865860	 63789138
RP11-63G22	 7	12	 7	14	 64450951	 64468781	 64459866
RP11-84G6	 7	13	 7	14	 87697387	 87697728	 87697557
RP11-79J20	 7	14	 7	14	 88818800	 88987041	 88902920
RP11-16O4	 7	15	 7	14	 90296988	 90466301	 90381644
RP11-140I4	 7	16	 7	14	 91603661	 91733661	 91668661
RP11-188G21	 7	17	 7	14	 92239062	 92239415	 92239238
RP11-160P21	 7	18	 7	14	 93737849	 93867849	 93802849
RP11-52N13	 7	19	 7	17	 40074206	 40258757	 40166481
RP11-234J24	 7	20	 7	17	 42655422	 42655823	 42655622
RP11-36J16	 7	21	 7	17	 44155347	 44288205	 44221776
RP11-131C4	 7	22	 7	17	 47644854	 47645096	 47644975
RP11-118K23	 7	23	 7	17	 55106279	 55106740	 55106509
RP11-84E24	 7	24	 7	17	 67512626	 67693011	 67602818
RP11-273K13	 7	25	 7	17	 15398209	 15560308	 15479258
CTD-2148K8	 7	 1	 8	16	    87754	   217754	   152754
CTD-2156K16	 7	 2	 8	17	 37720729	 37720861	 37720795
RP11-79K15	 7	 3	 8	17	 28977091	 29147086	 29062088
RP11-79L19	 7	 4	 8	17	 74187849	 74317849	 74252849
RP11-81D7	 7	 5	 8	17	 59885662	 60066618	 59976140
RP11-91M1	 7	 6	 8	17	 69709369	 69878101	 69793735
RP11-91C8	 7	 7	 8	17	   621712	   793056	   707384
RP11-587F22	 7	 8	 8	17	  3172026	  3340566	  3256296
RP11-582C6	 7	 9	 8	17	  2912016	  3092354	  3002185
RP11-88C10	 7	10	 8	18	   636459	   636636	   636547
RP11-55N14	 7	11	 8	18	  2734752	  2908488	  2821620
RP11-59E12	 7	12	 8	18	 19624108	 19811533	 19717820
RP11-165M24	 7	13	 8	17	 77587046	 77588058	 77587552
RP11-111H24	 7	14	 8	18	 23277257	 23441415	 23359336
RP11-90B5_1	 7	15	 8	18	 32375884	 32552502	 32464193
RP11-265I6	 7	16	 8	18	 35983406	 36149481	 36066443
RP11-19L3	 7	17	 8	18	 42182657	 42182988	 42182822
RP11-89A2	 7	18	 8	22	 24445961	 24605516	 24525738
RP11-90D17	 7	19	 8	22	 28119797	 28294964	 28207380
RP11-91K24	 7	20	 8	22	 25694195	 25865941	 25780068
RP11-449B17	 7	21	 8	22	 32691710	 32821710	 32756710
RP11-270O2	 7	22	 8	X	 15328337	 15328638	 15328487
RP11-124H12	 7	23	 8	X	 31561116	 31721501	 31641308
RP11-24P8	 7	24	 8	X	 42664749	 42815007	 42739878
RP11-8G18	 7	25	 8	X	 46829138	 46959138	 46894138
RP11-75H8	 7	 1	 9	X	 53789965	 53919965	 53854965
RP11-149I10	 7	 2	 9	X	 66108293	 66108672	 66108482
RP11-71D21	 7	 3	 9	X	102373541	102538462	102456001
RP11-91J20	 7	 4	 9	X	 74278977	 74438728	 74358852
RP11-267D20	 7	 5	 9	X	135655489	135655787	135655638
RP11-142M16	 7	 6	 9	X	148896146	149039701	148967923
RP11-130N6	 7	 7	 9	X	148085755	148086020	148085887
CTD-2002E24	 7	 8	 9	X	 37225265	 37374624	 37299944
CTD-2015J18	 7	 9	 9	X	128278223	128418374	128348298
CTD-2108A3	 7	10	 9	X	153164662	153294662	153229662
RP11-80N6	 7	11	 9	X	 17081375	 17248474	 17164924
RP11-88N12	 7	12	 9	X	 87967936	 88120150	 88044043
RP11-89B5	 7	13	 9	X	 10489312	 10636701	 10563006
RP11-89N19	 7	14	 9	X	116594467	116741334	116667900
RP11-90I7	 7	15	 9	X	 63877784	 64041067	 63959425
RP11-90N17	 7	16	 9	X	 62376425	 62536559	 62456492
RP11-278E23_2	 7	17	 9	22	 19862623	 19958793	 19910708
RP11-282K6	 7	18	 9	01	 43319854	 43513621	 43416737
RP11-283C16	 7	19	 9	10	 16704497	 16787347	 16745922
RP11-284G5	 7	20	 9	01	201037276	201211297	201124286
RP11-285I14	 7	21	 9	15	 86128546	 86296408	 86212477
RP11-288H12	 7	22	 9	06	160404429	160552680	160478554
RP11-297B9	 7	23	 9	22	 22928662	 23142856	 23035759
RP11-297N1	 7	24	 9	18	 24490875	 24656657	 24573766
RP11-298P3	 7	25	 9	13	 31870506	 31950012	 31910259
RP11-300I6	 7	 1	10	11	 69162461	 69323966	 69243213
RP11-302B13	 7	 2	10	12	 47561980	 47666571	 47614275
RP11-304M13	 7	 3	10	17	 15362704	 15560308	 15461506
RP11-317P15	 7	 4	10	01	179294656	179441703	179368179
RP11-318E3	 7	 5	10	10	  5818906	  6029761	  5924333
RP11-318L13	 7	 6	10	02	136463175	136626310	136544742
RP11-320M2	 7	 7	10	02	 10426142	 10626633	 10526387
RP11-321E21	 7	 8	10	12	106705572	106880240	106792906
RP11-322F4	 7	 9	10	02	110050730	110257187	110153958
RP11-332A4	 7	10	10	20	 35073121	 35152344	 35112732
RP11-332J15	 7	11	10	05	  6731028	  6935570	  6833299
RP11-333O1	 7	12	10	02	 12733636	 12937354	 12835495
RP11-336D7	 7	13	10	07	 99901464	100000340	 99950902
RP11-338K17	 7	14	10	12	122617458	122835935	122726696
RP11-339F22	 7	15	10	02	113424578	113622370	113523474
RP11-727A23	 7	16	10	11	 82518598	 82693504	 82606051
RP11-728F11	 7	17	10	11	117131495	117316421	117223958
RP11-729G3	 7	18	10	18	 46732287	 46888494	 46810390
RP11-738B7	 7	19	10	07	128942748	129119310	129031029
RP11-744N12	 7	20	10	11	128023639	128241032	128132335
RP11-745M24	 7	21	10	04	 77150022	 77280022	 77215022
RP11-778F12	 7	22	10	20	 29604813	 29774692	 29689752
RP11-779O18	 7	23	10	05	172039636	172233578	172136607
RP11-783K16	 7	24	10	11	 63751866	 63918223	 63835044
RP11-789C17	 7	25	10	18	  8281529	  8462855	  8372192
RP11-793E15	 7	 1	11	03	 46091466	 46288745	 46190105
RP11-794I14	 7	 2	11	20	 57295019	 57483207	 57389113
RP11-852E15	 7	 3	11	03	 45830571	 46040343	 45935457
RP11-858M6	 7	 4	11	18	 46393097	 46626939	 46510018
RP11-863H1	 7	 5	11	12	 60980691	 61184668	 61082679
RP11-867O8	 7	 6	11	11	 64783199	 65002760	 64892979
RP11-874A11	 7	 7	11	01	 10311591	 10503096	 10407343
RP11-887P2	 7	 8	11	12	 92456005	 92626274	 92541139
RP11-1145F21	 7	 9	11	02	202790941	202953495	202872218
RP11-56D10	 7	10	11	07	106044012	106207536	106125774
RP11-62N23_2	 7	11	11	17	 34979166	 35136396	 35057781
RP11-66A14_2	 7	12	11	04	122831999	123020921	122926460
RP11-84C16_2	 7	13	11	19	 49913270	 50122986	 50018128
RP11-100C23	 7	14	11	07	 72929705	 73136892	 73033298
RP11-288G13	 7	15	11	01	202196323	202242944	202219633
RP11-290G6	 7	16	11	05	161436945	161646751	161541848
RP11-291O7	 7	17	11	X	 69504458	 69701994	 69603226
RP11-294K24	 7	18	11	01	198817702	198985874	198901788
RP11-295K3	 7	19	11	11	  1585407	  1785280	  1685343
RP11-299P2	 7	20	11	18	 58927478	 59074166	 59000822
RP11-326F6	 7	21	11	04	  6974149	  7108219	  7041184
RP11-328G15	 7	22	11	03	185731824	185827864	185779844
RP11-332L18	 7	23	11	01	220241954	220431370	220336662
RP11-335O13	 7	24	11	01	199759424	199936564	199847994
RP11-339B21	 7	25	11	09	128142637	128327081	128234859
RP11-343H5	 7	 1	12	01	203133779	203329264	203231521
RP11-355L4	 7	 2	12	04	 57612947	 57791522	 57702234
RP11-356J5	 7	 3	12	11	111524706	111690384	111607545
RP11-359C4	 7	 4	12	X	 14999020	 15199686	 15099353
RP11-363E6	 7	 5	12	08	 82212279	 82429526	 82320902
RP11-367M19	 7	 6	12	04	 75079120	 75211860	 75145490
RP11-369L1	 7	 7	12	10	 61282628	 61473357	 61377992
RP11-385J6	 7	 8	12	02	109897028	110052730	109974879
RP11-386D8	 7	 9	12	09	111107934	111289375	111198654
RP11-388C12	 7	10	12	17	 78199999	 78311473	 78255736
RP11-391A7	 7	11	12	02	 63601861	 63820697	 63711279
RP11-395P17	 7	12	12	09	127940528	128134584	128037556
RP11-398H1	 7	13	12	04	129112623	129188873	129150748
RP11-629B11	 7	14	12	04	 75305093	 75471256	 75388174
RP11-630D6	 7	15	12	04	 77252572	 77432905	 77342738
RP11-642A1	 7	16	12	08	141602644	141809117	141705880
RP11-654A16	 7	17	12	15	 97155541	 97346559	 97251050
RP11-657D19	 7	18	12	X	  7975427	  8138066	  8056746
RP11-662B19	 7	19	12	08	 28645021	 28844142	 28744581
CTC-196I5	 7	20	12	06	   180642	   180912	   180777
CTC-261I1	 7	21	12	08	146080744	146081698	146081221
CTB-135I17	 7	22	12	09	138256186	138256276	138256231
CTC-261B16	 7	23	12	10	135165361	135165811	135165586
CTB-124K20	 7	24	12	12	   210042	   210374	   210208
CTB-191K2	 7	25	12	16	    85244	    85427	    85335
RP11-89K16	 7	13	13	01	 23839712	 24012090	 23925901
RP11-89O18	 7	14	13	01	 38621286	 38787238	 38704262
RP11-89F7	 7	15	13	01	 19926631	 20086560	 20006595
RP11-89F10	 7	16	13		NA	NA	NA
RP11-89N3	 7	17	13	01	206417554	206613451	206515502
RP11-89N10	 7	18	13	01	 38105322	 38235322	 38170322
RP11-90J3	 7	19	13	01	117116156	117274081	117195118
RP11-90N15	 7	20	13	01	 98919513	 99075843	 98997678
RP11-91N1	 7	21	13	01	184688030	184843198	184765614
RP11-91K5	 7	22	13	01	 86669378	 86811559	 86740468
RP11-91K17	 7	23	13	01	173437900	173621598	173529749
RP11-91C5	 7	24	13	01	242509745	242668792	242589268
RP11-88B10	 7	25	13	01	 74352566	 74530598	 74441582
RP11-91M14	 7	 1	14	01	236649463	236831624	236740543
RP11-185P14_1	 7	 2	14	02	  9547577	  9547954	  9547765
RP11-81F24_1	 7	 3	14	02	 15177860	 15178217	 15178038
RP11-171A13	 7	 4	14	02	 19176523	 19306523	 19241523
RP11-72H12	 7	 5	14	02	 28814235	 28976646	 28895440
RP11-84M16_1	 7	 6	14	02	 85988496	 85988850	 85988673
RP11-8C18_1	 7	 7	14	02	105912073	106042073	105977073
RP11-218F21_1	 7	 8	14	02	112714665	112714965	112714815
RP11-67G15_1	 7	 9	14	02	127677441	127816311	127746876
RP11-9L19_1	 7	10	14	02	133997687	134169585	134083636
RP11-29N17_1	 7	11	14	02	141479850	141609850	141544850
CTD-2199G5	 7	12	14	03	 53697245	 53827245	 53762245
RP11-79K17	 7	13	14	03	 58758998	 58887561	 58823279
RP11-79O17	 7	14	14	03	170680195	170810195	170745195
RP11-79C12	 7	15	14		NA	NA	NA
RP11-79G24	 7	16	14	03	163022425	163167218	163094821
RP11-79M2	 7	17	14	03	123351114	123538059	123444586
RP11-81N21	 7	18	14	03	 44369382	 44545708	 44457545
RP11-88H6	 7	19	14	03	192493858	192676944	192585401
RP11-88P6	 7	20	14	03	188693479	188860124	188776801
RP11-89A12	 7	21	14	03	 68124783	 68296185	 68210484
RP11-89K24	 7	22	14	03	 54700836	 54830836	 54765836
RP11-89B3	 7	23	14	03	180795915	180964832	180880373
RP11-90N21	 7	24	14	03	158817681	158979205	158898443
RP11-91B7	 7	25	14	03	168998474	169156089	169077281
RP11-91F17	 7	 1	15	03	167549993	167697600	167623796
RP11-91P19	 7	 2	15	03	 46655434	 46847262	 46751348
RP11-91M15	 7	 3	15	03	 96443143	 96627928	 96535535
RP11-91I6	 7	 4	15	03	 23036245	 23190491	 23113368
RP11-574C8	 7	 5	15	03	118871138	119079303	118975220
RP11-91K9	 7	 6	15	03	178971544	179129183	179050363
RP11-69L7	 7	 7	15	04	   752619	   906613	   829616
RP11-237C24	 7	 8	15	04	  4538586	  4538856	  4538721
RP11-97H19	 7	 9	15	04	  6879990	  7009990	  6944990
RP11-101J14	 7	10	15	04	  8096434	  8269961	  8183197
RP11-22L20	 7	11	15	05	 55925160	 56066344	 55995752
RP11-190C5	 7	12	15	05	 57604743	 57604993	 57604868
RP11-174I22	 7	13	15	05	 62938849	 62939173	 62939011
RP11-87D20	 7	14	15	05	 66078534	 66078861	 66078697
RP11-40N8	 7	15	15	05	 67274446	 67274799	 67274622
RP11-172K14	 7	16	15	05	 74563429	 74563728	 74563578
RP11-252I13	 7	17	15	05	106956474	107135339	107045906
RP11-13O21	 7	18	15	05	111669994	111846228	111758111
RP11-58G19	 7	19	15	05	113663712	113804301	113734006
RP11-73N22	 7	20	15	05	117015415	117015749	117015582
RP11-265M23	 7	21	15	05	122505608	122677181	122591394
RP11-209F21	 7	22	15	05	124913780	124914154	124913967
RP11-109B15	 7	23	15	05	151552343	151730137	151641240
RP11-170L13	 7	24	15	05	155123958	155288478	155206218
RP11-47O12	 7	25	15	05	156615433	156773306	156694369
RP11-82E8	 7	 1	16	05	157651610	157651988	157651799
RP11-62G13	 7	 2	16	05	160654723	160806043	160730383
RP11-210K16	 7	 3	16	05	160671381	160686880	160679130
RP11-105L4	 7	 4	16	05	172937353	173088063	173012708
RP11-125L2	 7	 5	16	05	173447702	173616629	173532165
RP11-51D11	 7	 6	16	05	179112541	179112945	179112743
RP11-13H10	 7	 7	16	05	  4351713	  4533623	  4442668
RP11-114K6	 7	 8	16	05	 94201672	 94370338	 94286005
RP11-467A2	 7	 9	16	05	 72108607	 72276723	 72192665
RP11-77E2	 7	10	16	07	107112166	107279614	107195890
RP11-12L9	 7	11	16	07	111943780	112104490	112024135
RP11-110C11	 7	12	16	07	115008147	115158349	115083248
RP11-95L16	 7	13	16	07	115351579	115481579	115416579
RP11-3L10	 7	14	16	07	120631254	120795956	120713605
RP11-48O1	 7	15	16	07	121434699	121564699	121499699
RP11-118J20	 7	16	16	07	132850218	133018477	132934347
RP11-137O4	 7	17	16	07	137552004	137723618	137637811
RP11-188A12	 7	18	16	07	143039542	143039935	143039738
RP11-86L18	 7	19	16	07	153645376	153645775	153645575
RP11-106C6	 7	20	16	07	147678480	147853627	147766053
CTD-2027I18	 7	21	16	07	150137757	150343539	150240648
RP11-80J22	 7	22	16	07	154063095	154225470	154144282
RP11-80L24	 7	23	16	07	 55650380	 55784518	 55717449
RP11-80P24	 7	24	16	07	101197438	101375426	101286432
RP11-81B1	 7	25	16	07	148065444	148195444	148130444
RP11-81F15	 7	 1	17	07	 27566855	 27746114	 27656484
RP11-81H15	 7	 2	17	07	 27566856	 27746125	 27656490
RP11-89P11	 7	 3	17	07	147485335	147638644	147561989
RP11-90C3	 7	 4	17	07	 64115109	 64274360	 64194734
RP11-90C15	 7	 5	17	07	 45154815	 45314911	 45234863
RP11-90H9	 7	 6	17	07	 92153659	 92317869	 92235764
RP11-90J13	 7	 7	17	07	 31631283	 31802477	 31716880
RP11-90L21	 7	 8	17	07	120708290	120870296	120789293
RP11-32M4	 7	 9	17	09	107508104	107638104	107573104
RP11-81P13_1	 7	10	17	09	110123103	110306968	110215035
RP11-4O1	 7	11	17	09	111819315	112008483	111913899
RP11-10I9	 7	12	17	09	113124898	113306830	113215864
RP11-9M16	 7	13	17	09	114206979	114367618	114287298
RP11-46E19	 7	14	17	09	114733021	114885449	114809235
RP11-216L13	 7	15	17	09	136891804	137073807	136982805
CTD-2097K16	 7	16	17	09	 21957827	 21958227	 21958027
RP11-79E21	 7	17	17	09	 32109918	 32256768	 32183343
RP11-79J13	 7	18	17	09	 81467826	 81642948	 81555387
RP11-79K11	 7	19	17	09	 29942964	 30116164	 30029564
RP11-79B9	 7	20	17	09	 14010093	 14171677	 14090885
RP11-81P5_2	 7	21	17	09	132115449	132308214	132211831
RP11-88F16	 7	22	17	09	114723832	114912451	114818141
RP11-88P16	 7	23	17	09	  1658005	  1816675	  1737340
RP11-89C16	 7	24	17	09	 10760841	 10933256	 10847048
RP11-89K20	 7	25	17	09	 70637780	 70796742	 70717261
RP11-89H6	 7	 1	18	09	 12644083	 12774083	 12709083
RP11-91E3	 7	 2	18	09	  9554543	  9689968	  9622255
RP11-451E16	 7	 3	18	09	118116150	118310825	118213487
RP11-451O4	 7	 4	18	09	134516033	134646033	134581033
RP11-10D13	 7	 5	18	10	   214399	   366376	   290387
RP11-180C18	 7	 6	18	10	  1518383	  1518466	  1518424
RP11-23O12_1	 7	 7	18	10	  3658177	  3829073	  3743625
RP11-215H8	 7	 8	18	11	 78637747	 78638088	 78637917
RP11-40G3	 7	 9	18	11	 82944934	 83074934	 83009934
RP11-275O16	 7	10	18	11	 83238616	 83238960	 83238788
RP11-131C11	 7	11	18	11	 84986813	 85172914	 85079863
RP11-42G23	 7	12	18	11	 89953756	 90083756	 90018756
RP11-163O18	 7	13	18	11	 92905803	 93087588	 92996695
RP11-276O11	 7	14	18	11	105262408	105262775	105262591
RP11-42L18	 7	15	18	11	107422086	107586712	107504399
RP11-2F21	 7	16	18	11	109417425	109601340	109509382
RP11-49A9	 7	17	18	11	109828117	109979883	109904000
RP11-47N15	 7	18	18	11	111597475	111791409	111694442
RP11-279M1	 7	19	18	11	113774463	113774838	113774650
RP11-32A17	 7	20	18	11	120466222	120567408	120516815
RP11-145I11	 7	21	18	11	121670407	121828933	121749670
RP11-87O12	 7	22	18	11	122698285	122828285	122763285
RP11-20M1	 7	23	18	11	125827486	125957486	125892486
RP11-112M22	 7	24	18	11	127647353	127788923	127718138
RP11-17M17	 7	25	18	11	132052507	132205819	132129163
RP11-79A4	 7	 1	19	11	 48644474	 48801171	 48722822
RP11-79G4_2	 7	 2	19	11	 41558232	 41710577	 41634404
RP11-79B7	 7	 3	19	11	 77441076	 77548213	 77494644
RP11-79N15_2	 7	 4	19	11	 15256088	 15424709	 15340398
RP11-80F20	 7	 5	19	11	 86533396	 86705573	 86619484
RP11-80N22	 7	 6	19	11	 65805679	 65980427	 65893053
RP11-91F3	 7	 7	19	13	 62865405	 63023277	 62944341
RP11-91J7	 7	 8	19	13	 52272205	 52443084	 52357644
RP11-91O1	 7	 9	19	13	 89774076	 89904076	 89839076
RP11-91K18	 7	10	19	13	 35802749	 35965115	 35883932
RP11-91E24	 7	11	19	13	104485442	104642484	104563963
RP11-451O10	 7	12	19	13	 69110652	 69275204	 69192928
RP11-125A5	 7	13	19	14	 28581577	 28768137	 28674857
RP11-2K1	 7	14	19	14	 30869243	 31053560	 30961401
RP11-37F23	 7	15	19	14	 31343434	 31473434	 31408434
RP11-29A7	 7	16	19	14	 33639264	 33788462	 33713863
RP11-26M6	 7	17	19	14	 34404822	 34591592	 34498207
RP11-23D3	 7	18	19	14	 39757221	 39912087	 39834654
RP11-205K20	 7	19	19	14	 54683746	 54813746	 54748746
RP11-105H21	 7	20	19	14	 55257573	 55440666	 55349119
RP11-10P7	 7	21	19	14	 55968549	 56129687	 56049118
RP11-64I19	 7	22	19	14	 60551315	 60681315	 60616315
RP11-14C21	 7	23	19	14	 63712416	 63865860	 63789138
RP11-63G22	 7	24	19	14	 64450951	 64468781	 64459866
RP11-84G6	 7	25	19	14	 87697387	 87697728	 87697557
RP11-79J20	 7	 1	20	14	 88818800	 88987041	 88902920
RP11-16O4	 7	 2	20	14	 90296988	 90466301	 90381644
RP11-140I4	 7	 3	20	14	 91603661	 91733661	 91668661
RP11-188G21	 7	 4	20	14	 92239062	 92239415	 92239238
RP11-160P21	 7	 5	20	14	 93737849	 93867849	 93802849
RP11-52N13	 7	 6	20	17	 40074206	 40258757	 40166481
RP11-234J24	 7	 7	20	17	 42655422	 42655823	 42655622
RP11-36J16	 7	 8	20	17	 44155347	 44288205	 44221776
RP11-131C4	 7	 9	20	17	 47644854	 47645096	 47644975
RP11-118K23	 7	10	20	17	 55106279	 55106740	 55106509
RP11-84E24	 7	11	20	17	 67512626	 67693011	 67602818
RP11-273K13	 7	12	20	17	 15398209	 15560308	 15479258
CTD-2148K8	 7	13	20	16	    87754	   217754	   152754
CTD-2156K16	 7	14	20	17	 37720729	 37720861	 37720795
RP11-79K15	 7	15	20	17	 28977091	 29147086	 29062088
RP11-79L19	 7	16	20	17	 74187849	 74317849	 74252849
RP11-81D7	 7	17	20	17	 59885662	 60066618	 59976140
RP11-91M1	 7	18	20	17	 69709369	 69878101	 69793735
RP11-91C8	 7	19	20	17	   621712	   793056	   707384
RP11-587F22	 7	20	20	17	  3172026	  3340566	  3256296
RP11-582C6	 7	21	20	17	  2912016	  3092354	  3002185
RP11-88C10	 7	22	20	18	   636459	   636636	   636547
RP11-55N14	 7	23	20	18	  2734752	  2908488	  2821620
RP11-59E12	 7	24	20	18	 19624108	 19811533	 19717820
RP11-165M24	 7	25	20	17	 77587046	 77588058	 77587552
RP11-111H24	 7	 1	21	18	 23277257	 23441415	 23359336
RP11-90B5_1	 7	 2	21	18	 32375884	 32552502	 32464193
RP11-265I6	 7	 3	21	18	 35983406	 36149481	 36066443
RP11-19L3	 7	 4	21	18	 42182657	 42182988	 42182822
RP11-89A2	 7	 5	21	22	 24445961	 24605516	 24525738
RP11-90D17	 7	 6	21	22	 28119797	 28294964	 28207380
RP11-91K24	 7	 7	21	22	 25694195	 25865941	 25780068
RP11-449B17	 7	 8	21	22	 32691710	 32821710	 32756710
RP11-270O2	 7	 9	21	X	 15328337	 15328638	 15328487
RP11-124H12	 7	10	21	X	 31561116	 31721501	 31641308
RP11-24P8	 7	11	21	X	 42664749	 42815007	 42739878
RP11-8G18	 7	12	21	X	 46829138	 46959138	 46894138
RP11-75H8	 7	13	21	X	 53789965	 53919965	 53854965
RP11-149I10	 7	14	21	X	 66108293	 66108672	 66108482
RP11-71D21	 7	15	21	X	102373541	102538462	102456001
RP11-91J20	 7	16	21	X	 74278977	 74438728	 74358852
RP11-267D20	 7	17	21	X	135655489	135655787	135655638
RP11-142M16	 7	18	21	X	148896146	149039701	148967923
RP11-130N6	 7	19	21	X	148085755	148086020	148085887
CTD-2002E24	 7	20	21	X	 37225265	 37374624	 37299944
CTD-2015J18	 7	21	21	X	128278223	128418374	128348298
CTD-2108A3	 7	22	21	X	153164662	153294662	153229662
RP11-80N6	 7	23	21	X	 17081375	 17248474	 17164924
RP11-88N12	 7	24	21	X	 87967936	 88120150	 88044043
RP11-89B5	 7	25	21	X	 10489312	 10636701	 10563006
RP11-89N19	 7	 1	22	X	116594467	116741334	116667900
RP11-90I7	 7	 2	22	X	 63877784	 64041067	 63959425
RP11-90N17	 7	 3	22	X	 62376425	 62536559	 62456492
RP11-278E23_2	 7	 4	22	22	 19862623	 19958793	 19910708
RP11-282K6	 7	 5	22	01	 43319854	 43513621	 43416737
RP11-283C16	 7	 6	22	10	 16704497	 16787347	 16745922
RP11-284G5	 7	 7	22	01	201037276	201211297	201124286
RP11-285I14	 7	 8	22	15	 86128546	 86296408	 86212477
RP11-288H12	 7	 9	22	06	160404429	160552680	160478554
RP11-297B9	 7	10	22	22	 22928662	 23142856	 23035759
RP11-297N1	 7	11	22	18	 24490875	 24656657	 24573766
RP11-298P3	 7	12	22	13	 31870506	 31950012	 31910259
RP11-300I6	 7	13	22	11	 69162461	 69323966	 69243213
RP11-302B13	 7	14	22	12	 47561980	 47666571	 47614275
RP11-304M13	 7	15	22	17	 15362704	 15560308	 15461506
RP11-317P15	 7	16	22	01	179294656	179441703	179368179
RP11-318E3	 7	17	22	10	  5818906	  6029761	  5924333
RP11-318L13	 7	18	22	02	136463175	136626310	136544742
RP11-320M2	 7	19	22	02	 10426142	 10626633	 10526387
RP11-321E21	 7	20	22	12	106705572	106880240	106792906
RP11-322F4	 7	21	22	02	110050730	110257187	110153958
RP11-332A4	 7	22	22	20	 35073121	 35152344	 35112732
RP11-332J15	 7	23	22	05	  6731028	  6935570	  6833299
RP11-333O1	 7	24	22	02	 12733636	 12937354	 12835495
RP11-336D7	 7	25	22	07	 99901464	100000340	 99950902
RP11-338K17	 7	 1	23	12	122617458	122835935	122726696
RP11-339F22	 7	 2	23	02	113424578	113622370	113523474
RP11-727A23	 7	 3	23	11	 82518598	 82693504	 82606051
RP11-728F11	 7	 4	23	11	117131495	117316421	117223958
RP11-729G3	 7	 5	23	18	 46732287	 46888494	 46810390
RP11-738B7	 7	 6	23	07	128942748	129119310	129031029
RP11-744N12	 7	 7	23	11	128023639	128241032	128132335
RP11-745M24	 7	 8	23	04	 77150022	 77280022	 77215022
RP11-778F12	 7	 9	23	20	 29604813	 29774692	 29689752
RP11-779O18	 7	10	23	05	172039636	172233578	172136607
RP11-783K16	 7	11	23	11	 63751866	 63918223	 63835044
RP11-789C17	 7	12	23	18	  8281529	  8462855	  8372192
RP11-793E15	 7	13	23	03	 46091466	 46288745	 46190105
RP11-794I14	 7	14	23	20	 57295019	 57483207	 57389113
RP11-852E15	 7	15	23	03	 45830571	 46040343	 45935457
RP11-858M6	 7	16	23	18	 46393097	 46626939	 46510018
RP11-863H1	 7	17	23	12	 60980691	 61184668	 61082679
RP11-867O8	 7	18	23	11	 64783199	 65002760	 64892979
RP11-874A11	 7	19	23	01	 10311591	 10503096	 10407343
RP11-887P2	 7	20	23	12	 92456005	 92626274	 92541139
RP11-1145F21	 7	21	23	02	202790941	202953495	202872218
RP11-56D10	 7	22	23	07	106044012	106207536	106125774
RP11-62N23_2	 7	23	23	17	 34979166	 35136396	 35057781
RP11-66A14_2	 7	24	23	04	122831999	123020921	122926460
RP11-84C16_2	 7	25	23	19	 49913270	 50122986	 50018128
RP11-100C23	 7	 1	24	07	 72929705	 73136892	 73033298
RP11-288G13	 7	 2	24	01	202196323	202242944	202219633
RP11-290G6	 7	 3	24	05	161436945	161646751	161541848
RP11-291O7	 7	 4	24	X	 69504458	 69701994	 69603226
RP11-294K24	 7	 5	24	01	198817702	198985874	198901788
RP11-295K3	 7	 6	24	11	  1585407	  1785280	  1685343
RP11-299P2	 7	 7	24	18	 58927478	 59074166	 59000822
RP11-326F6	 7	 8	24	04	  6974149	  7108219	  7041184
RP11-328G15	 7	 9	24	03	185731824	185827864	185779844
RP11-332L18	 7	10	24	01	220241954	220431370	220336662
RP11-335O13	 7	11	24	01	199759424	199936564	199847994
RP11-339B21	 7	12	24	09	128142637	128327081	128234859
RP11-343H5	 7	13	24	01	203133779	203329264	203231521
RP11-355L4	 7	14	24	04	 57612947	 57791522	 57702234
RP11-356J5	 7	15	24	11	111524706	111690384	111607545
RP11-359C4	 7	16	24	X	 14999020	 15199686	 15099353
RP11-363E6	 7	17	24	08	 82212279	 82429526	 82320902
RP11-367M19	 7	18	24	04	 75079120	 75211860	 75145490
RP11-369L1	 7	19	24	10	 61282628	 61473357	 61377992
RP11-385J6	 7	20	24	02	109897028	110052730	109974879
RP11-386D8	 7	21	24	09	111107934	111289375	111198654
RP11-388C12	 7	22	24	17	 78199999	 78311473	 78255736
RP11-391A7	 7	23	24	02	 63601861	 63820697	 63711279
RP11-395P17	 7	24	24	09	127940528	128134584	128037556
RP11-398H1	 7	25	24	04	129112623	129188873	129150748
RP11-629B11	 7	 1	25	04	 75305093	 75471256	 75388174
RP11-630D6	 7	 2	25	04	 77252572	 77432905	 77342738
RP11-642A1	 7	 3	25	08	141602644	141809117	141705880
RP11-654A16	 7	 4	25	15	 97155541	 97346559	 97251050
RP11-657D19	 7	 5	25	X	  7975427	  8138066	  8056746
RP11-662B19	 7	 6	25	08	 28645021	 28844142	 28744581
CTC-196I5	 7	 7	25	06	   180642	   180912	   180777
CTC-261I1	 7	 8	25	08	146080744	146081698	146081221
CTB-135I17	 7	 9	25	09	138256186	138256276	138256231
CTC-261B16	 7	10	25	10	135165361	135165811	135165586
CTB-124K20	 7	11	25	12	   210042	   210374	   210208
CTB-191K2	 7	12	25	16	    85244	    85427	    85335
RP11-38I11_1	 8	 1	 1	02	184317488	184317887	184317687
RP11-34N13_1	 8	 2	 1	02	198715379	198845379	198780379
RP11-47E6_1	 8	 3	 1	02	204397712	204575312	204486512
RP11-4B6_1	 8	 4	 1	02	218084294	218214294	218149294
RP11-23G2_1	 8	 5	 1	02	221750872	221916763	221833817
RP11-183N7_1	 8	 6	 1	02	224418350	224577926	224498138
RP11-282G6	 8	 7	 1	02	 16419641	 16609221	 16514431
CTD-2103M12	 8	 8	 1	02	 61061318	 61061621	 61061469
CTD-2129F15	 8	 9	 1	02	198755160	198885160	198820160
RP11-79C11	 8	10	 1	02	 78363155	 78513694	 78438424
RP11-79E23	 8	11	 1	02	169873886	170021919	169947902
RP11-79K21	 8	12	 1	02	 61000551	 61130551	 61065551
RP11-81F3_1	 8	13	 1	02	 86778860	 86947122	 86862991
RP11-81F21	 8	14	 1	02	205196388	205358567	205277477
RP11-81H7	 8	15	 1	02	129727844	129895284	129811564
RP11-81L13	 8	16	 1	02	 60217568	 60385684	 60301626
RP11-81P1	 8	17	 1	02	158505389	158666145	158585767
RP11-88B6	 8	18	 1	02	129446050	129610528	129528289
RP11-89O22	 8	19	 1	02	103955141	104116436	104035788
RP11-89B17	 8	20	 1	02	132114576	132288736	132201656
RP11-89J7	 8	21	 1	02	 58965780	 59131035	 59048407
RP11-89L1	 8	22	 1	02	 99805154	 99972103	 99888628
RP11-89L13	 8	23	 1	02	161190075	161361752	161275913
RP11-89P7	 8	24	 1	02	189085551	189234156	189159853
RP11-194B9	 8	25	 1	04	 28028903	 28029368	 28029135
RP11-205G3	 8	 1	 2	04	 29186139	 29186569	 29186354
RP11-266E24	 8	 2	 2	04	 30188947	 30345696	 30267321
RP11-205N12	 8	 3	 2	04	 30394483	 30539647	 30467065
RP11-176I4	 8	 4	 2	04	 33086961	 33087410	 33087185
RP11-60D24	 8	 5	 2	04	 35445763	 35593917	 35519840
RP11-109P3	 8	 6	 2	04	 48256922	 48386922	 48321922
RP11-217B22_1	 8	 7	 2	04	 48744131	 48839424	 48791777
RP11-7J22	 8	 8	 2	04	 56972670	 57102670	 57037670
RP11-210D19	 8	 9	 2	04	 53219499	 53219878	 53219688
RP11-98G22	 8	10	 2	04	 54612989	 54781924	 54697456
RP11-135H2	 8	11	 2	04	 56387192	 56517192	 56452192
RP11-105F22	 8	12	 2	04	 77298754	 77455857	 77377305
RP11-121P22	 8	13	 2	04	 81565011	 81565182	 81565096
RP11-67G24	 8	14	 2	04	 82780760	 82924914	 82852837
RP11-7G22	 8	15	 2	04	 84523609	 84723458	 84623533
RP11-185B5	 8	16	 2	04	 84973229	 85127874	 85050551
RP11-36G19	 8	17	 2	04	 85326515	 85488343	 85407429
RP11-203M9	 8	18	 2	04	 99691070	 99821070	 99756070
RP11-183B1	 8	19	 2	04	101465490	101465573	101465531
RP11-42H6	 8	20	 2	04	111569952	111749862	111659907
RP11-260E23	 8	21	 2	04	114597571	114732854	114665212
RP11-119K21	 8	22	 2	04	115125629	115126131	115125880
RP11-18F11	 8	23	 2	04	120315862	120316202	120316032
RP11-79I10	 8	24	 2	05	 80611785	 80765346	 80688565
RP11-79L17_1	 8	25	 2	05	 11256926	 11429967	 11343446
RP11-81B23	 8	 1	 3	05	 18874717	 19046234	 18960475
RP11-81H9	 8	 2	 3	05	 81369998	 81550493	 81460245
RP11-81L23	 8	 3	 3	05	128772601	128933634	128853117
RP11-88D22	 8	 4	 3	05	 91109216	 91285973	 91197594
RP11-89L24	 8	 5	 3	05	111765524	111895524	111830524
RP11-90A9	 8	 6	 3	05	 79882590	 80063088	 79972839
RP11-90C21	 8	 7	 3	05	165262925	165426112	165344518
RP11-90G5	 8	 8	 3	05	121620355	121783825	121702090
RP11-90B23	 8	 9	 3	05	 16794671	 16968719	 16881695
RP11-90J17	 8	10	 3	05	101202195	101358599	101280397
RP11-91C10	 8	11	 3	05	 67318235	 67501700	 67409967
RP11-91E18	 8	12	 3	05	 73195933	 73368703	 73282318
RP11-480H11	 8	13	 3	05	 65059159	 65239118	 65149138
RP11-89J5	 8	14	 3	05	167258705	167397283	167327994
RP11-53P21	 8	15	 3		NA	NA	NA
RP11-168G4	 8	16	 3	06	  6939046	  7074354	  7006700
RP11-273J1	 8	17	 3	06	 22030456	 22212156	 22121306
RP11-52C20_1	 8	18	 3	06	 23943949	 24112567	 24028258
RP11-145M23	 8	19	 3	06	 24851393	 24981393	 24916393
RP11-2P4	 8	20	 3	06	 27927908	 28090141	 28009024
RP11-197P9	 8	21	 3	06	 35173145	 35303145	 35238145
RP11-139J19	 8	22	 3	06	 36373491	 36373700	 36373595
RP11-451C12	 8	23	 3	07	  7518792	  7693028	  7605910
RP11-451M8	 8	24	 3	07	 68573147	 68752059	 68662603
CTD-2386C3	 8	25	 3	07	 45470343	 45600343	 45535343
RP11-82K8	 8	 1	 4	08	  2080312	  2080710	  2080511
RP11-113B7	 8	 2	 4	08	  4218951	  4386750	  4302850
RP11-112O8	 8	 3	 4	08	  4695768	  4825768	  4760768
RP11-274K12	 8	 4	 4	08	 16009760	 16162045	 16085902
RP11-51C1	 8	 5	 4	08	 19287220	 19417220	 19352220
RP11-191P9	 8	 6	 4	08	 19651026	 19798273	 19724649
RP11-50E20	 8	 7	 4	08	 21234342	 21381126	 21307734
RP11-274M9	 8	 8	 4	08	 22610551	 22772522	 22691536
RP11-204M16	 8	 9	 4	08	 23257418	 23431673	 23344545
RP11-280C9	 8	10	 4	08	 30010627	 30140627	 30075627
RP11-287N19	 8	11	 4	08	 30555588	 30555979	 30555783
RP11-122D17	 8	12	 4	08	 32698574	 32873156	 32785865
RP11-274F14	 8	13	 4	08	 35592272	 35592609	 35592440
RP11-210F15	 8	14	 4	08	 36514167	 36514552	 36514359
RP11-265K5	 8	15	 4	08	 38227281	 38404631	 38315956
RP11-149G12	 8	16	 4	08	 52311110	 52311498	 52311304
RP11-175H20	 8	17	 4	08	 53409885	 53410129	 53410007
RP11-105K5	 8	18	 4	08	 54576653	 54759124	 54667888
RP11-99M6	 8	19	 4	08	 55664938	 55794938	 55729938
RP11-213K11	 8	20	 4	08	 57085223	 57085685	 57085454
RP11-264K12	 8	21	 4	08	 61527194	 61696319	 61611756
RP11-40D12	 8	22	 4	10	 13729752	 13730163	 13729957
RP11-22K18	 8	23	 4	10	 14490874	 14646667	 14568770
RP11-22B24	 8	24	 4	10	 18175248	 18305248	 18240248
RP11-66F24	 8	25	 4	10	 22702297	 22872927	 22787612
RP11-230A13	 8	 1	 5	10	 21628707	 21629064	 21628885
RP11-34I5	 8	 2	 5	10	 21413644	 21559356	 21486500
RP11-35O12	 8	 3	 5	10	 31695857	 31825857	 31760857
RP11-18E15	 8	 4	 5	10	 35815049	 35945049	 35880049
RP11-45L17	 8	 5	 5	10	 33170221	 33316036	 33243128
RP11-20J15_1	 8	 6	 5	10	 44024289	 44208763	 44116526
RP11-44L5	 8	 7	 5	02	187174618	187333311	187253964
RP11-240K9	 8	 8	 5	10	 52622006	 52622381	 52622193
RP11-280H23	 8	 9	 5	10	 68945041	 68945373	 68945207
RP11-86K9	 8	10	 5	10	 69928257	 70089130	 70008693
RP11-52K17	 8	11	 5	10	 71179303	 71334759	 71257031
RP11-104F15	 8	12	 5	10	 71750332	 71959156	 71854744
RP11-58O1	 8	13	 5	10	 72645812	 72803738	 72724775
RP11-28E3	 8	14	 5	10	 73411586	 73573433	 73492509
RP11-284D10	 8	15	 5	10	 85385096	 85385400	 85385248
RP11-129G17	 8	16	 5	10	 89981471	 90065888	 90023679
RP11-67L13	 8	17	 5	10	 92652928	 92798908	 92725918
RP11-166J24	 8	18	 5	10	 92760392	 92911338	 92835865
RP11-8D20	 8	19	 5	10	 98087971	 98088185	 98088078
RP11-83C5	 8	20	 5	10	 99185990	 99207113	 99196551
RP11-89D4	 8	21	 5	11	  7249882	  7402046	  7325964
RP11-89P13	 8	22	 5	11	 15593727	 15757673	 15675700
RP11-90A13	 8	23	 5	11	130889653	131037498	130963575
RP11-90P9	 8	24	 5	11	  4449978	  4621209	  4535593
RP11-91L11	 8	25	 5	11	 28613386	 28765193	 28689289
RP11-91K7	 8	 1	 6	11	 14691671	 14830538	 14761104
RP11-645I8	 8	 2	 6	11	  6071592	  6234222	  6152907
RP11-846G12	 8	 3	 6	11	 55857499	 56032605	 55945052
RP11-93A12	 8	 4	 6	11	  6367288	  6497288	  6432288
RP11-451G8	 8	 5	 6	11	115244761	115401085	115322923
RP11-220C23	 8	 6	 6	11	 40928674	 41089547	 41009110
RP11-128F16	 8	 7	 6	11	 36008515	 36008725	 36008620
RP11-627K20	 8	 8	 6		NA	NA	NA
RP11-115O9	 8	 9	 6	11	 76010612	 76198113	 76104362
RP11-1E8	 8	10	 6	11	 81471572	 81648709	 81560140
RP11-40B14	 8	11	 6	11	 99932372	100132253	100032312
RP11-3F7	 8	12	 6	11	111494466	111668996	111581731
RP11-50B3	 8	13	 6	11	125439767	125597484	125518625
RP11-64N21	 8	14	 6	12	 27315557	 27487329	 27401443
RP11-100P18	 8	15	 6	12	 30116438	 30306713	 30211575
RP11-73I12	 8	16	 6	12	 31300994	 31457338	 31379166
RP11-38F11	 8	17	 6	12	 32988635	 32989024	 32988829
RP11-25K5	 8	18	 6	12	 48131563	 48290408	 48210985
RP11-32K17	 8	19	 6	12	 50298254	 50298678	 50298466
RP11-79B15	 8	20	 6	14	 67744328	 67904823	 67824575
RP11-81D1	 8	21	 6	14	 55780849	 55937660	 55859254
RP11-81F9	 8	22	 6	14	 22732488	 22893122	 22812805
RP11-88D14	 8	23	 6	14	 36949212	 37079212	 37014212
RP11-88L10	 8	24	 6	14	 60704697	 60870460	 60787578
RP11-88N20	 8	25	 6	14	 86622673	 86772926	 86697799
RP11-98N22	 8	 1	 7	14	 19570807	 19730566	 19650686
RP11-91A4	 8	 2	 7	14	 44806459	 44965275	 44885867
RP11-44K16_1	 8	 3	 7	14	 63974853	 64135779	 64055316
RP11-516D7	 8	 4	 7		NA	NA	NA
RP11-87I21	 8	 5	 7	15	 22774695	 22774822	 22774758
RP11-51D17	 8	 6	 7	01	  4190086	  4190380	  4190233
RP11-27P20	 8	 7	 7	15	 42546116	 42705594	 42625855
RP11-2D17	 8	 8	 7	15	 40414739	 40579640	 40497189
RP11-239O2	 8	 9	 7	15	 39657766	 39658166	 39657966
RP11-18C1	 8	10	 7	15	 38367401	 38500172	 38433786
RP11-46O11	 8	11	 7	15	 37758232	 37926660	 37842446
RP11-66L23_2	 8	12	 7	15	 49300995	 49448561	 49374778
RP11-13J23	 8	13	 7	15	 58718215	 58848215	 58783215
RP11-74K1	 8	14	 7	15	 58530515	 58660515	 58595515
RP11-107I6	 8	15	 7	15	 62840341	 62970341	 62905341
RP11-42F24	 8	16	 7	15	 61213925	 61214280	 61214102
RP11-50N10	 8	17	 7	15	 62184974	 62344402	 62264688
RP11-70A7	 8	18	 7	15	 64104470	 64276305	 64190387
RP11-57F7	 8	19	 7	18	 66823675	 66981738	 66902706
RP11-61A18	 8	20	 7	18	 72100759	 72260109	 72180434
RP11-130J1	 8	21	 7	18	 73111343	 73111607	 73111475
RP11-87C15	 8	22	 7	18	 75965205	 75965502	 75965353
RP11-411B10	 8	23	 7	18	 13988747	 14143336	 14066041
RP11-79G5	 8	24	 7	18	 31408781	 31588529	 31498655
RP11-89N1	 8	25	 7	18	 75901987	 76089909	 75995948
RP11-90A7	 8	 1	 8	18	 64748796	 64929179	 64838987
RP11-90E1	 8	 2	 8	18	 39604360	 39787183	 39695771
RP11-90G7	 8	 3	 8	18	 24344610	 24526449	 24435529
RP11-90B3	 8	 4	 8	18	 60191596	 60361640	 60276618
RP11-90L3	 8	 5	 8	18	 73414295	 73593885	 73504090
RP11-211I3	 8	 6	 8	19	  4900356	  4900698	  4900527
RP11-19I2	 8	 7	 8	19	 11643289	 11816303	 11729796
RP11-201F4	 8	 8	 8	19	 13701917	 13702167	 13702042
RP11-56K21	 8	 9	 8	19	 14304115	 14499695	 14401905
RP11-88I12	 8	10	 8	19	 19022980	 19023254	 19023117
RP11-152P7	 8	11	 8	19	 33377712	 33507712	 33442712
RP11-210C7	 8	12	 8	19	 48859097	 49031129	 48945113
RP11-21J15	 8	13	 8	19	 49726601	 49900222	 49813411
RP11-2J15	 8	14	 8	19	 51665795	 51835146	 51750470
RP11-17I20	 8	15	 8	19	 53768000	 53947555	 53857777
RP11-236B14	 8	16	 8	19	 55230306	 55230687	 55230496
RP11-87L13	 8	17	 8	19	 60725260	 60725509	 60725384
RP11-1C1	 8	18	 8	05	 10414806	 10562476	 10488641
RP11-1E1	 8	19	 8	04	 78334427	 78481013	 78407720
RP11-2E11	 8	20	 8	07	129578374	129745611	129661992
RP11-2P5	 8	21	 8	13	 40367433	 40566000	 40466716
RP11-3J10	 8	22	 8	09	 37745914	 37935185	 37840549
RP11-3P4	 8	23	 8		NA	NA	NA
RP11-10L12_2	 8	24	 8	04	103981738	104172809	104077273
RP11-11L20	 8	25	 8	03	150087000	150248635	150167817
RP11-12L14	 8	 1	 9	03	184871857	185039723	184955790
RP11-14P21	 8	 2	 9	12	 97543837	 97700309	 97622073
RP11-16H23_2	 8	 3	 9	10	105726308	105868279	105797293
RP11-16O1	 8	 4	 9	10	 17791752	 17921752	 17856752
RP11-26B22	 8	 5	 9	02	161885405	162055102	161970253
RP11-29B2_2	 8	 6	 9	13	102007251	102165732	102086491
RP11-30F17	 8	 7	 9	19	  6351095	  6519297	  6435196
RP11-33A1	 8	 8	 9	03	170187576	170352571	170270073
RP11-34F20	 8	 9	 9	13	 49478678	 49633565	 49556121
RP11-35C1	 8	10	 9	01	203968889	204163182	204066035
RP11-52A20	 8	11	 9	01	163951431	164121058	164036244
RP11-54B9	 8	12	 9	01	163348043	163508931	163428487
RP11-57M20	 8	13	 9	11	 76603134	 76810520	 76706827
RP11-58M12	 8	14	 9	05	 98207480	 98352590	 98280035
RP11-60A21	 8	15	 9	05	 38404162	 38567633	 38485897
RP11-61K12	 8	16	 9	03	128108623	128260757	128184690
RP11-350J20	 8	17	 9	06	150131711	150320395	150226053
RP11-353D18	 8	18	 9		NA	NA	NA
RP11-354N7	 8	19	 9	16	 67318521	 67478802	 67398661
RP11-355D13_2	 8	20	 9	15	 41409157	 41591921	 41500539
RP11-357J12	 8	21	 9	17	 24407918	 24572918	 24490418
RP11-358M11	 8	22	 9	15	 55282700	 55538706	 55410703
RP11-370K13	 8	23	 9	03	 38134055	 38316283	 38225169
RP11-376O21	 8	24	 9	09	  8242694	  8411017	  8326855
RP11-380I10	 8	25	 9	08	 28078637	 28260371	 28169504
RP11-380J4	 8	 1	10	03	143114117	143304421	143209269
RP11-383B24	 8	 2	10	10	 76063371	 76229145	 76146258
RP11-384O14	 8	 3	10	03	138149349	138332938	138241143
RP11-394J1	 8	 4	10	12	 95077478	 95174473	 95125975
RP11-395B24	 8	 5	10	22	 40114402	 40289100	 40201751
RP11-397O8	 8	 6	10	13	101118196	101265803	101191999
RP11-399O19	 8	 7	10	10	 90596402	 90783731	 90690066
RP11-400N9	 8	 8	10	02	233896360	234111007	234003683
RP11-401H24	 8	 9	10	01	 27567686	 27742564	 27655125
RP11-418I17	 8	10	10	12	 60689753	 60835137	 60762445
RP11-421G21	 8	11	10	01	 37842971	 37972971	 37907971
RP11-425B8	 8	12	10	10	 22721527	 22813984	 22767755
RP11-425L10	 8	13	10	11	 46359781	 46429924	 46394852
RP11-427A14	 8	14	10	04	  9449045	  9457893	  9453469
RP11-429B14	 8	15	10	15	 87725432	 87936225	 87830828
RP11-363L24	 8	16	10	08	 31053113	 31243056	 31148084
RP11-496I9_2	 8	17	10	11	   446970	   635941	   541455
RP11-529K1	 8	18	10	16	 68870717	 69066728	 68968722
RP11-951K18	 8	19	10	05	 68373095	 68563479	 68468287
RP11-462C5	 8	20	10	01	244672315	244867674	244769994
RP11-463B12	 8	21	10	02	240631265	240802685	240716975
RP11-283I3_2	 8	22	10	12	   152512	   329906	   241209
RP11-12J5	 8	23	10	X	 37425148	 37587740	 37506444
RP11-344L6	 8	24	10	16	    75836	    85427	    80631
RP11-629C16	 8	25	10	17	   373081	   560333	   466707
RP11-430E19	 8	 1	11	01	    17844	   167209	    92526
RP11-530N10	 8	 2	11	20	     9943	   201577	   105760
RP11-349P21	 8	 3	11	07	 72929648	 73091332	 73010490
RP11-1057H19	 8	 4	11	22	 17685254	 17859197	 17772225
RP11-606J16	 8	 5	11	X	  8277359	  8432115	  8354737
RP11-762A3	 8	 6	11	08	116554762	116737845	116646303
RP11-104M24	 8	 7	11	11	 44161678	 44314207	 44237942
RP11-46A23_2	 8	 8	11	X	 30874687	 31028427	 30951557
RP11-1I15	 8	 9	11	15	 32125281	 32275708	 32200494
RP11-2C24	 8	10	11	16	 30539936	 30747839	 30643887
RP11-7O6	 8	11	11	18	 45508884	 45672713	 45590798
RP11-9B11	 8	12	11	17	 37572622	 37769855	 37671238
RP11-10E18	 8	13	11	13	 95065290	 95243477	 95154383
RP11-11N7	 8	14	11	01	241288042	241412612	241350327
RP11-422P24	 8	15	11	01	150704923	150880750	150792836
RP11-425J9	 8	16	11	03	 46857872	 47052592	 46955232
RP11-426L16	 8	17	11	01	112902105	113095711	112998908
RP11-427E2	 8	18	11	02	 11423637	 11559236	 11491436
RP11-428N17	 8	19	11	20	 13888575	 14030396	 13959485
RP11-430H12	 8	20	11	01	 65690486	 65873601	 65782043
RP11-459E5	 8	21	11	08	 22606718	 22761666	 22684192
RP11-460N20	 8	22	11	07	 63840576	 64043973	 63942274
RP11-463H12	 8	23	11	04	 55654370	 55790821	 55722595
RP11-465K1	 8	24	11	01	 94918908	 95101073	 95009990
RP11-466J14	 8	25	11	10	 96427539	 96633528	 96530533
RP11-471J7	 8	 1	12	09	 19743257	 19903157	 19823207
RP11-491K7	 8	 2	12	03	166908960	167080225	166994592
RP11-493K19	 8	 3	12	03	 49971212	 50188560	 50079886
RP11-499P9	 8	 4	12	02	 26364180	 26552960	 26458570
RP11-501E24	 8	 5	12	12	 21412728	 21592172	 21502450
RP11-504H5	 8	 6	12	18	 70049588	 70219028	 70134308
RP11-506E9	 8	 7	12	06	 53088389	 53171117	 53129753
RP11-528L24	 8	 8	12	05	 54380981	 54564482	 54472731
RP11-530D2	 8	 9	12	05	 43602134	 43795937	 43699035
RP11-535C7	 8	10	12	04	 52717092	 52868205	 52792648
RP11-536K7	 8	11	12	10	  5948266	  6139873	  6044069
RP11-538B23	 8	12	12	05	 79936318	 80082824	 80009571
RP11-542M13	 8	13	12	16	 84474067	 84662525	 84568296
RP11-680F3	 8	14	12	08	104071962	104253427	104162694
RP11-680G2	 8	15	12	08	 98975621	 99176043	 99075832
RP11-685J19	 8	16	12	02	181696916	181859537	181778226
RP11-687E1	 8	17	12	18	 37767203	 37948244	 37857723
RP11-693B19	 8	18	12	04	  2954854	  3156109	  3055481
RP11-696L21	 8	19	12	15	 66849647	 67039661	 66944654
CTB-50C4	 8	20	12	17	 77846127	 77846429	 77846278
CTB-75F20	 8	21	12	18	 75842808	 75842960	 75842884
CTC-325I23	 8	22	12	19	 63560107	 63560213	 63560160
CTC-839D20	 8	23	12		NA	NA	NA
RP1-24H17	 8	24	12	05	   561584	   561888	   561736
RP1-57H24	 8	25	12	06	170755960	170756340	170756150
RP11-38I11_1	 8	13	13	02	184317488	184317887	184317687
RP11-34N13_1	 8	14	13	02	198715379	198845379	198780379
RP11-47E6_1	 8	15	13	02	204397712	204575312	204486512
RP11-4B6_1	 8	16	13	02	218084294	218214294	218149294
RP11-23G2_1	 8	17	13	02	221750872	221916763	221833817
RP11-183N7_1	 8	18	13	02	224418350	224577926	224498138
RP11-282G6	 8	19	13	02	 16419641	 16609221	 16514431
CTD-2103M12	 8	20	13	02	 61061318	 61061621	 61061469
CTD-2129F15	 8	21	13	02	198755160	198885160	198820160
RP11-79C11	 8	22	13	02	 78363155	 78513694	 78438424
RP11-79E23	 8	23	13	02	169873886	170021919	169947902
RP11-79K21	 8	24	13	02	 61000551	 61130551	 61065551
RP11-81F3_1	 8	25	13	02	 86778860	 86947122	 86862991
RP11-81F21	 8	 1	14	02	205196388	205358567	205277477
RP11-81H7	 8	 2	14	02	129727844	129895284	129811564
RP11-81L13	 8	 3	14	02	 60217568	 60385684	 60301626
RP11-81P1	 8	 4	14	02	158505389	158666145	158585767
RP11-88B6	 8	 5	14	02	129446050	129610528	129528289
RP11-89O22	 8	 6	14	02	103955141	104116436	104035788
RP11-89B17	 8	 7	14	02	132114576	132288736	132201656
RP11-89J7	 8	 8	14	02	 58965780	 59131035	 59048407
RP11-89L1	 8	 9	14	02	 99805154	 99972103	 99888628
RP11-89L13	 8	10	14	02	161190075	161361752	161275913
RP11-89P7	 8	11	14	02	189085551	189234156	189159853
RP11-194B9	 8	12	14	04	 28028903	 28029368	 28029135
RP11-205G3	 8	13	14	04	 29186139	 29186569	 29186354
RP11-266E24	 8	14	14	04	 30188947	 30345696	 30267321
RP11-205N12	 8	15	14	04	 30394483	 30539647	 30467065
RP11-176I4	 8	16	14	04	 33086961	 33087410	 33087185
RP11-60D24	 8	17	14	04	 35445763	 35593917	 35519840
RP11-109P3	 8	18	14	04	 48256922	 48386922	 48321922
RP11-217B22_1	 8	19	14	04	 48744131	 48839424	 48791777
RP11-7J22	 8	20	14	04	 56972670	 57102670	 57037670
RP11-210D19	 8	21	14	04	 53219499	 53219878	 53219688
RP11-98G22	 8	22	14	04	 54612989	 54781924	 54697456
RP11-135H2	 8	23	14	04	 56387192	 56517192	 56452192
RP11-105F22	 8	24	14	04	 77298754	 77455857	 77377305
RP11-121P22	 8	25	14	04	 81565011	 81565182	 81565096
RP11-67G24	 8	 1	15	04	 82780760	 82924914	 82852837
RP11-7G22	 8	 2	15	04	 84523609	 84723458	 84623533
RP11-185B5	 8	 3	15	04	 84973229	 85127874	 85050551
RP11-36G19	 8	 4	15	04	 85326515	 85488343	 85407429
RP11-203M9	 8	 5	15	04	 99691070	 99821070	 99756070
RP11-183B1	 8	 6	15	04	101465490	101465573	101465531
RP11-42H6	 8	 7	15	04	111569952	111749862	111659907
RP11-260E23	 8	 8	15	04	114597571	114732854	114665212
RP11-119K21	 8	 9	15	04	115125629	115126131	115125880
RP11-18F11	 8	10	15	04	120315862	120316202	120316032
RP11-79I10	 8	11	15	05	 80611785	 80765346	 80688565
RP11-79L17_1	 8	12	15	05	 11256926	 11429967	 11343446
RP11-81B23	 8	13	15	05	 18874717	 19046234	 18960475
RP11-81H9	 8	14	15	05	 81369998	 81550493	 81460245
RP11-81L23	 8	15	15	05	128772601	128933634	128853117
RP11-88D22	 8	16	15	05	 91109216	 91285973	 91197594
RP11-89L24	 8	17	15	05	111765524	111895524	111830524
RP11-90A9	 8	18	15	05	 79882590	 80063088	 79972839
RP11-90C21	 8	19	15	05	165262925	165426112	165344518
RP11-90G5	 8	20	15	05	121620355	121783825	121702090
RP11-90B23	 8	21	15	05	 16794671	 16968719	 16881695
RP11-90J17	 8	22	15	05	101202195	101358599	101280397
RP11-91C10	 8	23	15	05	 67318235	 67501700	 67409967
RP11-91E18	 8	24	15	05	 73195933	 73368703	 73282318
RP11-480H11	 8	25	15	05	 65059159	 65239118	 65149138
RP11-89J5	 8	 1	16	05	167258705	167397283	167327994
RP11-53P21	 8	 2	16		NA	NA	NA
RP11-168G4	 8	 3	16	06	  6939046	  7074354	  7006700
RP11-273J1	 8	 4	16	06	 22030456	 22212156	 22121306
RP11-52C20_1	 8	 5	16	06	 23943949	 24112567	 24028258
RP11-145M23	 8	 6	16	06	 24851393	 24981393	 24916393
RP11-2P4	 8	 7	16	06	 27927908	 28090141	 28009024
RP11-197P9	 8	 8	16	06	 35173145	 35303145	 35238145
RP11-139J19	 8	 9	16	06	 36373491	 36373700	 36373595
RP11-451C12	 8	10	16	07	  7518792	  7693028	  7605910
RP11-451M8	 8	11	16	07	 68573147	 68752059	 68662603
CTD-2386C3	 8	12	16	07	 45470343	 45600343	 45535343
RP11-82K8	 8	13	16	08	  2080312	  2080710	  2080511
RP11-113B7	 8	14	16	08	  4218951	  4386750	  4302850
RP11-112O8	 8	15	16	08	  4695768	  4825768	  4760768
RP11-274K12	 8	16	16	08	 16009760	 16162045	 16085902
RP11-51C1	 8	17	16	08	 19287220	 19417220	 19352220
RP11-191P9	 8	18	16	08	 19651026	 19798273	 19724649
RP11-50E20	 8	19	16	08	 21234342	 21381126	 21307734
RP11-274M9	 8	20	16	08	 22610551	 22772522	 22691536
RP11-204M16	 8	21	16	08	 23257418	 23431673	 23344545
RP11-280C9	 8	22	16	08	 30010627	 30140627	 30075627
RP11-287N19	 8	23	16	08	 30555588	 30555979	 30555783
RP11-122D17	 8	24	16	08	 32698574	 32873156	 32785865
RP11-274F14	 8	25	16	08	 35592272	 35592609	 35592440
RP11-210F15	 8	 1	17	08	 36514167	 36514552	 36514359
RP11-265K5	 8	 2	17	08	 38227281	 38404631	 38315956
RP11-149G12	 8	 3	17	08	 52311110	 52311498	 52311304
RP11-175H20	 8	 4	17	08	 53409885	 53410129	 53410007
RP11-105K5	 8	 5	17	08	 54576653	 54759124	 54667888
RP11-99M6	 8	 6	17	08	 55664938	 55794938	 55729938
RP11-213K11	 8	 7	17	08	 57085223	 57085685	 57085454
RP11-264K12	 8	 8	17	08	 61527194	 61696319	 61611756
RP11-40D12	 8	 9	17	10	 13729752	 13730163	 13729957
RP11-22K18	 8	10	17	10	 14490874	 14646667	 14568770
RP11-22B24	 8	11	17	10	 18175248	 18305248	 18240248
RP11-66F24	 8	12	17	10	 22702297	 22872927	 22787612
RP11-230A13	 8	13	17	10	 21628707	 21629064	 21628885
RP11-34I5	 8	14	17	10	 21413644	 21559356	 21486500
RP11-35O12	 8	15	17	10	 31695857	 31825857	 31760857
RP11-18E15	 8	16	17	10	 35815049	 35945049	 35880049
RP11-45L17	 8	17	17	10	 33170221	 33316036	 33243128
RP11-20J15_1	 8	18	17	10	 44024289	 44208763	 44116526
RP11-44L5	 8	19	17	02	187174618	187333311	187253964
RP11-240K9	 8	20	17	10	 52622006	 52622381	 52622193
RP11-280H23	 8	21	17	10	 68945041	 68945373	 68945207
RP11-86K9	 8	22	17	10	 69928257	 70089130	 70008693
RP11-52K17	 8	23	17	10	 71179303	 71334759	 71257031
RP11-104F15	 8	24	17	10	 71750332	 71959156	 71854744
RP11-58O1	 8	25	17	10	 72645812	 72803738	 72724775
RP11-28E3	 8	 1	18	10	 73411586	 73573433	 73492509
RP11-284D10	 8	 2	18	10	 85385096	 85385400	 85385248
RP11-129G17	 8	 3	18	10	 89981471	 90065888	 90023679
RP11-67L13	 8	 4	18	10	 92652928	 92798908	 92725918
RP11-166J24	 8	 5	18	10	 92760392	 92911338	 92835865
RP11-8D20	 8	 6	18	10	 98087971	 98088185	 98088078
RP11-83C5	 8	 7	18	10	 99185990	 99207113	 99196551
RP11-89D4	 8	 8	18	11	  7249882	  7402046	  7325964
RP11-89P13	 8	 9	18	11	 15593727	 15757673	 15675700
RP11-90A13	 8	10	18	11	130889653	131037498	130963575
RP11-90P9	 8	11	18	11	  4449978	  4621209	  4535593
RP11-91L11	 8	12	18	11	 28613386	 28765193	 28689289
RP11-91K7	 8	13	18	11	 14691671	 14830538	 14761104
RP11-645I8	 8	14	18	11	  6071592	  6234222	  6152907
RP11-846G12	 8	15	18	11	 55857499	 56032605	 55945052
RP11-93A12	 8	16	18	11	  6367288	  6497288	  6432288
RP11-451G8	 8	17	18	11	115244761	115401085	115322923
RP11-220C23	 8	18	18	11	 40928674	 41089547	 41009110
RP11-128F16	 8	19	18	11	 36008515	 36008725	 36008620
RP11-627K20	 8	20	18		NA	NA	NA
RP11-115O9	 8	21	18	11	 76010612	 76198113	 76104362
RP11-1E8	 8	22	18	11	 81471572	 81648709	 81560140
RP11-40B14	 8	23	18	11	 99932372	100132253	100032312
RP11-3F7	 8	24	18	11	111494466	111668996	111581731
RP11-50B3	 8	25	18	11	125439767	125597484	125518625
RP11-64N21	 8	 1	19	12	 27315557	 27487329	 27401443
RP11-100P18	 8	 2	19	12	 30116438	 30306713	 30211575
RP11-73I12	 8	 3	19	12	 31300994	 31457338	 31379166
RP11-38F11	 8	 4	19	12	 32988635	 32989024	 32988829
RP11-25K5	 8	 5	19	12	 48131563	 48290408	 48210985
RP11-32K17	 8	 6	19	12	 50298254	 50298678	 50298466
RP11-79B15	 8	 7	19	14	 67744328	 67904823	 67824575
RP11-81D1	 8	 8	19	14	 55780849	 55937660	 55859254
RP11-81F9	 8	 9	19	14	 22732488	 22893122	 22812805
RP11-88D14	 8	10	19	14	 36949212	 37079212	 37014212
RP11-88L10	 8	11	19	14	 60704697	 60870460	 60787578
RP11-88N20	 8	12	19	14	 86622673	 86772926	 86697799
RP11-98N22	 8	13	19	14	 19570807	 19730566	 19650686
RP11-91A4	 8	14	19	14	 44806459	 44965275	 44885867
RP11-44K16_1	 8	15	19	14	 63974853	 64135779	 64055316
RP11-516D7	 8	16	19		NA	NA	NA
RP11-87I21	 8	17	19	15	 22774695	 22774822	 22774758
RP11-51D17	 8	18	19	01	  4190086	  4190380	  4190233
RP11-27P20	 8	19	19	15	 42546116	 42705594	 42625855
RP11-2D17	 8	20	19	15	 40414739	 40579640	 40497189
RP11-239O2	 8	21	19	15	 39657766	 39658166	 39657966
RP11-18C1	 8	22	19	15	 38367401	 38500172	 38433786
RP11-46O11	 8	23	19	15	 37758232	 37926660	 37842446
RP11-66L23_2	 8	24	19	15	 49300995	 49448561	 49374778
RP11-13J23	 8	25	19	15	 58718215	 58848215	 58783215
RP11-74K1	 8	 1	20	15	 58530515	 58660515	 58595515
RP11-107I6	 8	 2	20	15	 62840341	 62970341	 62905341
RP11-42F24	 8	 3	20	15	 61213925	 61214280	 61214102
RP11-50N10	 8	 4	20	15	 62184974	 62344402	 62264688
RP11-70A7	 8	 5	20	15	 64104470	 64276305	 64190387
RP11-57F7	 8	 6	20	18	 66823675	 66981738	 66902706
RP11-61A18	 8	 7	20	18	 72100759	 72260109	 72180434
RP11-130J1	 8	 8	20	18	 73111343	 73111607	 73111475
RP11-87C15	 8	 9	20	18	 75965205	 75965502	 75965353
RP11-411B10	 8	10	20	18	 13988747	 14143336	 14066041
RP11-79G5	 8	11	20	18	 31408781	 31588529	 31498655
RP11-89N1	 8	12	20	18	 75901987	 76089909	 75995948
RP11-90A7	 8	13	20	18	 64748796	 64929179	 64838987
RP11-90E1	 8	14	20	18	 39604360	 39787183	 39695771
RP11-90G7	 8	15	20	18	 24344610	 24526449	 24435529
RP11-90B3	 8	16	20	18	 60191596	 60361640	 60276618
RP11-90L3	 8	17	20	18	 73414295	 73593885	 73504090
RP11-211I3	 8	18	20	19	  4900356	  4900698	  4900527
RP11-19I2	 8	19	20	19	 11643289	 11816303	 11729796
RP11-201F4	 8	20	20	19	 13701917	 13702167	 13702042
RP11-56K21	 8	21	20	19	 14304115	 14499695	 14401905
RP11-88I12	 8	22	20	19	 19022980	 19023254	 19023117
RP11-152P7	 8	23	20	19	 33377712	 33507712	 33442712
RP11-210C7	 8	24	20	19	 48859097	 49031129	 48945113
RP11-21J15	 8	25	20	19	 49726601	 49900222	 49813411
RP11-2J15	 8	 1	21	19	 51665795	 51835146	 51750470
RP11-17I20	 8	 2	21	19	 53768000	 53947555	 53857777
RP11-236B14	 8	 3	21	19	 55230306	 55230687	 55230496
RP11-87L13	 8	 4	21	19	 60725260	 60725509	 60725384
RP11-1C1	 8	 5	21	05	 10414806	 10562476	 10488641
RP11-1E1	 8	 6	21	04	 78334427	 78481013	 78407720
RP11-2E11	 8	 7	21	07	129578374	129745611	129661992
RP11-2P5	 8	 8	21	13	 40367433	 40566000	 40466716
RP11-3J10	 8	 9	21	09	 37745914	 37935185	 37840549
RP11-3P4	 8	10	21		NA	NA	NA
RP11-10L12_2	 8	11	21	04	103981738	104172809	104077273
RP11-11L20	 8	12	21	03	150087000	150248635	150167817
RP11-12L14	 8	13	21	03	184871857	185039723	184955790
RP11-14P21	 8	14	21	12	 97543837	 97700309	 97622073
RP11-16H23_2	 8	15	21	10	105726308	105868279	105797293
RP11-16O1	 8	16	21	10	 17791752	 17921752	 17856752
RP11-26B22	 8	17	21	02	161885405	162055102	161970253
RP11-29B2_2	 8	18	21	13	102007251	102165732	102086491
RP11-30F17	 8	19	21	19	  6351095	  6519297	  6435196
RP11-33A1	 8	20	21	03	170187576	170352571	170270073
RP11-34F20	 8	21	21	13	 49478678	 49633565	 49556121
RP11-35C1	 8	22	21	01	203968889	204163182	204066035
RP11-52A20	 8	23	21	01	163951431	164121058	164036244
RP11-54B9	 8	24	21	01	163348043	163508931	163428487
RP11-57M20	 8	25	21	11	 76603134	 76810520	 76706827
RP11-58M12	 8	 1	22	05	 98207480	 98352590	 98280035
RP11-60A21	 8	 2	22	05	 38404162	 38567633	 38485897
RP11-61K12	 8	 3	22	03	128108623	128260757	128184690
RP11-350J20	 8	 4	22	06	150131711	150320395	150226053
RP11-353D18	 8	 5	22		NA	NA	NA
RP11-354N7	 8	 6	22	16	 67318521	 67478802	 67398661
RP11-355D13_2	 8	 7	22	15	 41409157	 41591921	 41500539
RP11-357J12	 8	 8	22	17	 24407918	 24572918	 24490418
RP11-358M11	 8	 9	22	15	 55282700	 55538706	 55410703
RP11-370K13	 8	10	22	03	 38134055	 38316283	 38225169
RP11-376O21	 8	11	22	09	  8242694	  8411017	  8326855
RP11-380I10	 8	12	22	08	 28078637	 28260371	 28169504
RP11-380J4	 8	13	22	03	143114117	143304421	143209269
RP11-383B24	 8	14	22	10	 76063371	 76229145	 76146258
RP11-384O14	 8	15	22	03	138149349	138332938	138241143
RP11-394J1	 8	16	22	12	 95077478	 95174473	 95125975
RP11-395B24	 8	17	22	22	 40114402	 40289100	 40201751
RP11-397O8	 8	18	22	13	101118196	101265803	101191999
RP11-399O19	 8	19	22	10	 90596402	 90783731	 90690066
RP11-400N9	 8	20	22	02	233896360	234111007	234003683
RP11-401H24	 8	21	22	01	 27567686	 27742564	 27655125
RP11-418I17	 8	22	22	12	 60689753	 60835137	 60762445
RP11-421G21	 8	23	22	01	 37842971	 37972971	 37907971
RP11-425B8	 8	24	22	10	 22721527	 22813984	 22767755
RP11-425L10	 8	25	22	11	 46359781	 46429924	 46394852
RP11-427A14	 8	 1	23	04	  9449045	  9457893	  9453469
RP11-429B14	 8	 2	23	15	 87725432	 87936225	 87830828
RP11-363L24	 8	 3	23	08	 31053113	 31243056	 31148084
RP11-496I9_2	 8	 4	23	11	   446970	   635941	   541455
RP11-529K1	 8	 5	23	16	 68870717	 69066728	 68968722
RP11-951K18	 8	 6	23	05	 68373095	 68563479	 68468287
RP11-462C5	 8	 7	23	01	244672315	244867674	244769994
RP11-463B12	 8	 8	23	02	240631265	240802685	240716975
RP11-283I3_2	 8	 9	23	12	   152512	   329906	   241209
RP11-12J5	 8	10	23	X	 37425148	 37587740	 37506444
RP11-344L6	 8	11	23	16	    75836	    85427	    80631
RP11-629C16	 8	12	23	17	   373081	   560333	   466707
RP11-430E19	 8	13	23	01	    17844	   167209	    92526
RP11-530N10	 8	14	23	20	     9943	   201577	   105760
RP11-349P21	 8	15	23	07	 72929648	 73091332	 73010490
RP11-1057H19	 8	16	23	22	 17685254	 17859197	 17772225
RP11-606J16	 8	17	23	X	  8277359	  8432115	  8354737
RP11-762A3	 8	18	23	08	116554762	116737845	116646303
RP11-104M24	 8	19	23	11	 44161678	 44314207	 44237942
RP11-46A23_2	 8	20	23	X	 30874687	 31028427	 30951557
RP11-1I15	 8	21	23	15	 32125281	 32275708	 32200494
RP11-2C24	 8	22	23	16	 30539936	 30747839	 30643887
RP11-7O6	 8	23	23	18	 45508884	 45672713	 45590798
RP11-9B11	 8	24	23	17	 37572622	 37769855	 37671238
RP11-10E18	 8	25	23	13	 95065290	 95243477	 95154383
RP11-11N7	 8	 1	24	01	241288042	241412612	241350327
RP11-422P24	 8	 2	24	01	150704923	150880750	150792836
RP11-425J9	 8	 3	24	03	 46857872	 47052592	 46955232
RP11-426L16	 8	 4	24	01	112902105	113095711	112998908
RP11-427E2	 8	 5	24	02	 11423637	 11559236	 11491436
RP11-428N17	 8	 6	24	20	 13888575	 14030396	 13959485
RP11-430H12	 8	 7	24	01	 65690486	 65873601	 65782043
RP11-459E5	 8	 8	24	08	 22606718	 22761666	 22684192
RP11-460N20	 8	 9	24	07	 63840576	 64043973	 63942274
RP11-463H12	 8	10	24	04	 55654370	 55790821	 55722595
RP11-465K1	 8	11	24	01	 94918908	 95101073	 95009990
RP11-466J14	 8	12	24	10	 96427539	 96633528	 96530533
RP11-471J7	 8	13	24	09	 19743257	 19903157	 19823207
RP11-491K7	 8	14	24	03	166908960	167080225	166994592
RP11-493K19	 8	15	24	03	 49971212	 50188560	 50079886
RP11-499P9	 8	16	24	02	 26364180	 26552960	 26458570
RP11-501E24	 8	17	24	12	 21412728	 21592172	 21502450
RP11-504H5	 8	18	24	18	 70049588	 70219028	 70134308
RP11-506E9	 8	19	24	06	 53088389	 53171117	 53129753
RP11-528L24	 8	20	24	05	 54380981	 54564482	 54472731
RP11-530D2	 8	21	24	05	 43602134	 43795937	 43699035
RP11-535C7	 8	22	24	04	 52717092	 52868205	 52792648
RP11-536K7	 8	23	24	10	  5948266	  6139873	  6044069
RP11-538B23	 8	24	24	05	 79936318	 80082824	 80009571
RP11-542M13	 8	25	24	16	 84474067	 84662525	 84568296
RP11-680F3	 8	 1	25	08	104071962	104253427	104162694
RP11-680G2	 8	 2	25	08	 98975621	 99176043	 99075832
RP11-685J19	 8	 3	25	02	181696916	181859537	181778226
RP11-687E1	 8	 4	25	18	 37767203	 37948244	 37857723
RP11-693B19	 8	 5	25	04	  2954854	  3156109	  3055481
RP11-696L21	 8	 6	25	15	 66849647	 67039661	 66944654
CTB-50C4	 8	 7	25	17	 77846127	 77846429	 77846278
CTB-75F20	 8	 8	25	18	 75842808	 75842960	 75842884
CTC-325I23	 8	 9	25	19	 63560107	 63560213	 63560160
CTC-839D20	 8	10	25		NA	NA	NA
RP1-24H17	 8	11	25	05	   561584	   561888	   561736
RP1-57H24	 8	12	25	06	170755960	170756340	170756150
RP11-224F8	 9	 1	 1	01	 20255686	 20256073	 20255879
RP11-139H5	 9	 2	 1	01	 22238872	 22410183	 22324527
RP11-57F20	 9	 3	 1	01	 23544768	 23723237	 23634002
RP11-285H13	 9	 4	 1	01	 26979869	 26980211	 26980040
RP11-4O6	 9	 5	 1	01	 27621535	 27783470	 27702502
RP11-104J13	 9	 6	 1	01	 31000822	 31001080	 31000951
RP11-210E5	 9	 7	 1	01	 56315143	 56479560	 56397351
RP11-12L18	 9	 8	 1	01	 58199244	 58369134	 58284189
RP11-110A23	 9	 9	 1	01	 61084838	 61256798	 61170818
RP11-69G14	 9	10	 1		NA	NA	NA
RP11-246N19	 9	11	 1	01	 64166728	 64325471	 64246099
RP11-86K19	 9	12	 1	01	 65549817	 65550196	 65550006
RP11-156M23	 9	13	 1	01	 96530060	 96530447	 96530253
RP11-156G15	 9	14	 1	01	101309426	101397571	101353498
RP11-182H2	 9	15	 1	01	101397325	101397571	101397448
RP11-91A21	 9	16	 1	01	106797472	106958243	106877857
RP11-260A24	 9	17	 1	01	110535961	110698007	110616984
RP11-284N8	 9	18	 1	01	110807794	111000977	110904385
RP11-8D14	 9	19	 1	01	157471000	157634916	157552958
RP11-80D6_1	 9	20	 1	01	161968761	162112834	162040797
RP11-234M3	 9	21	 1	01	163947742	163948091	163947916
RP11-167M6	 9	22	 1	01	164524458	164697238	164610848
RP11-171H24	 9	23	 1	01	164986073	164986431	164986252
RP11-165A8	 9	24	 1	01	167475764	167652623	167564193
RP11-91I23	 9	25	 1	02	 25729103	 25890581	 25809842
RP11-91M5	 9	 1	 2	02	201338302	201524963	201431632
RP11-91O10	 9	 2	 2	02	167040735	167206828	167123781
RP11-91A9	 9	 3	 2	02	173860137	174025709	173942923
RP11-91E9	 9	 4	 2	02	 14085007	 14248306	 14166656
RP11-91E19	 9	 5	 2	02	 69978001	 70137149	 70057575
RP11-163N23_2	 9	 6	 2	02	 36511019	 36641019	 36576019
RP11-119J12_2	 9	 7	 2	02	 45722682	 45896568	 45809625
RP11-81L7_3	 9	 8	 2	02	 57065869	 57218868	 57142368
RP11-87C16_2	 9	 9	 2	02	 73327095	 73327385	 73327240
RP11-113N17_2	 9	10	 2	02	 82523780	 82682205	 82602992
RP11-84M16_2	 9	11	 2	02	 85988496	 85988850	 85988673
RP11-50J20_2	 9	12	 2	02	160394495	160524495	160459495
RP11-218D15_2	 9	13	 2	02	171199763	171200132	171199947
RP11-95I17_2	 9	14	 2	02	179380658	179554232	179467445
RP11-69G4_2	 9	15	 2	02	182670510	182868798	182769654
RP11-30M1_2	 9	16	 2	02	195293720	195479196	195386458
RP11-57C6_2	 9	17	 2	02	201453608	201620494	201537051
RP11-201F21	 9	18	 2	02	236909555	237040914	236975234
RP11-451E14	 9	19	 2	02	 84094356	 84310169	 84202262
RP11-451E10	 9	20	 2	02	 63688170	 63854547	 63771358
RP11-451A6	 9	21	 2	02	  5857456	  6045303	  5951379
RP11-451C2	 9	22	 2	02	102076851	102228590	102152720
RP11-451A8	 9	23	 2	02	210972238	211141932	211057085
RP11-79E2_1	 9	24	 2	04	143001495	143146137	143073816
RP11-122I3	 9	25	 2	04	144705898	144872906	144789402
RP11-210F12	 9	 1	 3	04	147136851	147137255	147137053
RP11-82L8	 9	 2	 3	04	145155697	145285315	145220506
RP11-180J5	 9	 3	 3	04	147780091	147780473	147780282
RP11-77F4	 9	 4	 3	04	152415384	152545384	152480384
RP11-27H11	 9	 5	 3	04	159963477	160127119	160045298
RP11-41G4	 9	 6	 3	04	163045489	163045768	163045628
RP11-51H8	 9	 7	 3	04	168532619	168662619	168597619
RP11-130I2	 9	 8	 3	04	169652616	169653013	169652814
RP11-254A7	 9	 9	 3	04	170217901	170218065	170217983
RP11-272N13	 9	10	 3	04	172677509	172677729	172677619
RP11-244K2	 9	11	 3	04	182769217	182919319	182844268
RP11-85P1	 9	12	 3	04	184327430	184327837	184327633
RP11-196K13	 9	13	 3	04	185011644	185167555	185089599
RP11-13O14	 9	14	 3	04	185429832	185600513	185515172
RP11-228F3	 9	15	 3	04	186010451	186178332	186094391
RP11-256M13	 9	16	 3	04	185526204	185527209	185526706
CTD-2169F23	 9	17	 3	04	 55722016	 55854530	 55788273
RP11-79E19	 9	18	 3	04	166661611	166821571	166741591
RP11-79M7	 9	19	 3	04	 45876352	 46024486	 45950419
RP11-79E18	 9	20	 3	04	176732766	176908730	176820748
RP11-79I18	 9	21	 3	04	126075320	126253109	126164214
RP11-79K16	 9	22	 3	04	128425729	128578641	128502185
RP11-52B15	 9	23	 3	06	 89747264	 89877264	 89812264
RP11-113K7	 9	24	 3	06	 91999421	 92151378	 92075399
RP11-14I4	 9	25	 3	06	100566870	100721124	100643997
RP11-83A13	 9	 1	 4	06	103905587	103905895	103905741
RP11-165E15	 9	 2	 4	06	108343493	108537457	108440475
RP11-28L24	 9	 3	 4	06	112508532	112657556	112583044
RP11-177M14	 9	 4	 4	06	133473462	133625304	133549383
RP11-32P13	 9	 5	 4	06	136356906	136357238	136357072
RP11-40O24	 9	 6	 4	06	148731405	148731714	148731559
RP11-43B19	 9	 7	 4	06	160956179	161050983	161003581
CTD-2009C6	 9	 8	 4	06	 64287483	 64482173	 64384828
CTD-2057J2	 9	 9	 4	06	152404972	152523956	152464464
RP11-79I12	 9	10	 4	06	113560274	113759345	113659809
RP11-79M24	 9	11	 4	06	  1754013	  1926781	  1840397
RP11-79O24	 9	12	 4	06	 56208781	 56381084	 56294932
RP11-79B19	 9	13	 4	06	 21193948	 21323948	 21258948
RP11-79F13	 9	14	 4	06	 44649048	 44815782	 44732415
RP11-79F23	 9	15	 4	06	 95037848	 95195069	 95116458
RP11-88N6	 9	16	 4	06	 64906453	 65035381	 64970917
RP11-89G8	 9	17	 4	06	136180051	136330449	136255250
RP11-89D6	 9	18	 4	06	 57189192	 57319192	 57254192
RP11-89L17	 9	19	 4	06	 45129981	 45288442	 45209211
RP11-90H17	 9	20	 4	06	 46419528	 46569438	 46494483
RP11-90K15	 9	21	 4	06	 52410364	 52552289	 52481326
RP11-27I15	 9	22	 4	08	 93214222	 93370861	 93292541
RP11-10G10	 9	23	 4	08	101279027	101431772	101355399
RP11-142F22	 9	24	 4	08	100624092	100777935	100701013
RP11-287H4	 9	25	 4	08	 99900717	 99901043	 99900880
RP11-131O16	 9	 1	 5	08	 99117291	 99117617	 99117454
RP11-125O21	 9	 2	 5	08	 99396133	 99551453	 99473793
RP11-21H16	 9	 3	 5	08	135975721	136154996	136065358
RP11-122H7	 9	 4	 5	08	138370664	138543270	138456967
RP11-45M12	 9	 5	 5	08	  3899622	  4066807	  3983214
CTD-2060N3	 9	 6	 5	08	 32717555	 32816843	 32767199
CTD-2092I19	 9	 7	 5	08	121619374	121619656	121619515
RP11-79E1	 9	 8	 5	08	110313566	110473619	110393592
RP11-80P10	 9	 9	 5	08	 97773100	 97929978	 97851539
RP11-81B5	 9	10	 5	08	108637181	108788888	108713034
RP11-88J22	 9	11	 5	08	 94049727	 94241540	 94145633
RP11-88N8	 9	12	 5	08	 75573436	 75722961	 75648198
RP11-89A16	 9	13	 5	08	 66002195	 66192073	 66097134
RP11-89I14	 9	14	 5	08	 80748493	 80919039	 80833766
RP11-90D11	 9	15	 5	08	 96442878	 96616306	 96529592
RP11-90I3	 9	16	 5	08	 16716672	 16894504	 16805588
RP11-90O15	 9	17	 5	08	 86163395	 86293395	 86228395
RP11-90J21	 9	18	 5	08	  8837121	  9012651	  8924886
RP11-90P5_1	 9	19	 5	08	 38091018	 38226422	 38158720
RP11-91J19	 9	20	 5	08	   304159	   465319	   384739
RP11-46G13	 9	21	 5	10	115937504	116103603	116020553
RP11-51G15	 9	22	 5	10	120589963	120742850	120666406
RP11-48B22	 9	23	 5	10	121574308	121748305	121661306
RP11-257O17	 9	24	 5	10	122299116	122467435	122383275
RP11-255D5	 9	25	 5	10	123565566	123642548	123604057
RP11-70E19	 9	 1	 6	10	125047207	125217217	125132212
RP11-142I8	 9	 2	 6	10	133292205	133450482	133371343
RP11-316M21_1	 9	 3	 6	10	101835645	102030561	101933103
RP11-35J23	 9	 4	 6	10	 98029353	 98176262	 98102807
RP11-57C13	 9	 5	 6	10	 89241351	 89411287	 89326319
CTD-2130I7	 9	 6	 6	10	 30718048	 30796069	 30757058
RP11-79A15	 9	 7	 6	10	 89430656	 89601183	 89515919
RP11-80J20	 9	 8	 6	10	 18444579	 18626541	 18535560
RP11-81B9	 9	 9	 6	10	 23167614	 23358208	 23262911
RP11-81N7	 9	10	 6	10	 96195935	 96371474	 96283704
RP11-89A18	 9	11	 6	10	 76297511	 76472651	 76385081
RP11-89G20	 9	12	 6	10	107761235	107925579	107843407
RP11-89K18	 9	13	 6	10	  2837892	  2999961	  2918926
RP11-90K19	 9	14	 6	10	126193027	126352707	126272867
RP11-90O1	 9	15	 6	10	 97835227	 97991417	 97913322
RP11-90O7	 9	16	 6	10	 86468638	 86622763	 86545700
RP11-90J1	 9	17	 6	10	 96283496	 96453506	 96368501
RP11-90J11	 9	18	 6	10	109464019	109620344	109542181
RP11-91H5	 9	19	 6		NA	NA	NA
RP11-141N1	 9	20	 6	12	 91384464	 91514464	 91449464
RP11-82I16	 9	21	 6	12	 92401122	 92401502	 92401312
RP11-215G13	 9	22	 6	12	 93272738	 93273047	 93272892
RP11-282G15	 9	23	 6	12	 94497911	 94684237	 94591074
RP11-64J11	 9	24	 6	12	 95598643	 95766573	 95682608
RP11-165H12	 9	25	 6	12	 99314032	 99450581	 99382306
RP11-119J23	 9	 1	 7	12	113966849	114129875	114048362
RP11-78D24	 9	 2	 7	12	127287870	127428715	127358292
RP11-69L19	 9	 3	 7	12	127814028	127944028	127879028
RP11-119J21	 9	 4	 7	12	129202501	129332501	129267501
CTD-2043O8	 9	 5	 7	12	 47333592	 47333755	 47333673
RP11-79K1	 9	 6	 7	12	 45882229	 46036700	 45959464
RP11-88F24	 9	 7	 7	12	 60535531	 60713327	 60624429
RP11-88N10	 9	 8	 7	12	 86505403	 86675807	 86590605
RP11-89M22	 9	 9	 7	12	 70588952	 70736075	 70662513
RP11-89H19	 9	10	 7	12	 46473179	 46667329	 46570254
RP11-89P15	 9	11	 7	12	 70047718	 70221154	 70134436
RP11-89L4	 9	12	 7	12	 26702866	 26832866	 26767866
RP11-91B19	 9	13	 7	12	 20182506	 20360003	 20271254
RP11-91L17	 9	14	 7	12	 49473504	 49603504	 49538504
RP11-91K15	 9	15	 7	12	 39661902	 39833112	 39747507
RP11-91M21	 9	16	 7	12	113284246	113455747	113369996
RP11-91M22	 9	17	 7	12	103692722	103868789	103780755
RP11-91C4	 9	18	 7	12	 82656484	 82808527	 82732505
RP11-9B21	 9	19	 7	15	 96519678	 96649678	 96584678
RP11-152F13	 9	20	 7	15	 80867007	 81024206	 80945606
RP11-127C24	 9	21	 7	15	 37828756	 37993671	 37911213
RP11-78I21	 9	22	 7	15	 41490969	 41750990	 41620979
CTD-2018N9	 9	23	 7	15	 23134033	 23134373	 23134203
RP11-79A7	 9	24	 7	15	 90582758	 90741777	 90662267
RP11-88F10	 9	25	 7	15	 41591917	 41763432	 41677674
RP11-88P10	 9	 1	 8	15	 23717132	 23863007	 23790069
RP11-89O12_2	 9	 2	 8	15	 45626014	 45768850	 45697432
RP11-90A19	 9	 3	 8	15	 59011605	 59184166	 59097885
RP11-90B9	 9	 4	 8	15	 81302298	 81488674	 81395486
RP11-91J9	 9	 5	 8	15	 75682576	 75851855	 75767215
RP11-109D4	 9	 6	 8	16	 18569813	 18747519	 18658666
RP11-186E3	 9	 7	 8	16	 20095945	 20225945	 20160945
RP11-141E3	 9	 8	 8	16	 23458654	 23647789	 23553221
RP11-150K5	 9	 9	 8	16	 29825186	 29825404	 29825295
RP11-259N3	 9	10	 8	16	 47262234	 47416562	 47339398
RP11-20A10	 9	11	 8	16	 49199663	 49373681	 49286672
RP11-83H21	 9	12	 8	16	 63807392	 63807761	 63807576
RP11-3A9	 9	13	 8	16	 65204892	 65205285	 65205088
RP11-151M19	 9	14	 8	16	 66146466	 66300311	 66223388
RP11-52E21	 9	15	 8	16	 67833447	 67963447	 67898447
RP11-224E17_2	 9	16	 8	16	 67375999	 67426927	 67401463
RP11-14J15	 9	17	 8	16	 68192245	 68322245	 68257245
RP11-26F18	 9	18	 8	20	  3076069	  3238538	  3157303
RP11-235C20	 9	19	 8	20	  5034622	  5034936	  5034779
RP11-9G21	 9	20	 8	20	  6090695	  6091140	  6090917
RP11-26H9	 9	21	 8	20	  6654051	  6784051	  6719051
RP11-103H2	 9	22	 8	20	  9036863	  9212175	  9124519
RP11-40J24	 9	23	 8	20	 10989672	 10990059	 10989865
RP11-58B10	 9	24	 8	20	 24365445	 24538516	 24451980
RP11-160I20	 9	25	 8	20	 32920861	 33050861	 32985861
RP11-23B22	 9	 1	 9		NA	NA	NA
RP11-138A15	 9	 2	 9	20	 35465342	 35595342	 35530342
RP11-9M24	 9	 3	 9	20	 38315924	 38316258	 38316091
RP11-111H12	 9	 4	 9	20	 38940371	 39112443	 39026407
RP11-10D18	 9	 5	 9	20	 49929893	 50078481	 50004187
RP11-15M15	 9	 6	 9	20	 51109650	 51266870	 51188260
RP11-212M6	 9	 7	 9	20	 52438867	 52439220	 52439043
RP11-172C21	 9	 8	 9	20	 53305855	 53329123	 53317489
RP11-94A18	 9	 9	 9	20	 58192126	 58357017	 58274571
CTD-2060H18	 9	10	 9	20	 31637430	 31771899	 31704664
RP11-90E23	 9	11	 9	20	 11116884	 11280959	 11198921
RP11-91L1	 9	12	 9	20	 51421216	 51572829	 51497022
RP11-91I21	 9	13	 9	20	 31368560	 31498560	 31433560
RP11-91O7	 9	14	 9	20	 10970504	 11146808	 11058656
RP11-91G1	 9	15	 9	20	 20887436	 21068994	 20978215
RP11-451E24	 9	16	 9	20	 50602598	 50732598	 50667598
RP11-84C16_1	 9	17	 9	19	 49913270	 50122986	 50018128
RP11-86F24	 9	18	 9	01	100893632	101046499	100970065
RP11-88J11	 9	19	 9	13	 25754065	 25932626	 25843345
RP11-90K6	 9	20	 9	03	113501857	113661947	113581902
RP11-91I20_2	 9	21	 9	08	 61578650	 61769195	 61673922
RP11-92L12	 9	22	 9	02	210318927	210448927	210383927
RP11-101E13	 9	23	 9	01	189674427	189822405	189748416
RP11-101J8	 9	24	 9	01	155036448	155205201	155120824
RP11-104O19	 9	25	 9	17	  4001078	  4169913	  4085495
RP11-107C21	 9	 1	10	11	 18269749	 18436773	 18353261
RP11-109I2	 9	 2	10	01	 55221894	 55405411	 55313652
RP11-114B7	 9	 3	10	01	 32770496	 32943373	 32856934
RP11-126L15	 9	 4	10	07	100000140	100172498	100086319
RP11-128P23	 9	 5	10	09	 41775839	 43460972	 42618405
RP11-131N11	 9	 6	10	10	 62096763	 62257986	 62177374
RP11-134C3	 9	 7	10	01	 43709705	 43875298	 43792501
RP11-136P18	 9	 8	10	04	 78163000	 78345051	 78254025
RP11-138C1	 9	 9	10	05	 39226020	 39374663	 39300341
RP11-151O22	 9	10	10	19	 12850328	 13005526	 12927927
RP11-152K4	 9	11	10	05	 31218628	 31396320	 31307474
RP11-153A23	 9	12	10	17	 73516546	 73694284	 73605415
RP11-155G14	 9	13	10	07	127564256	127729346	127646801
RP11-157P1	 9	14	10	20	 60192233	 60385082	 60288657
RP11-166B2	 9	15	10	16	 11856221	 12029014	 11942617
RP11-456A17	 9	16	10	05	 78300928	 78493830	 78397379
RP11-459F6	 9	17	10	16	 56719828	 56928048	 56823938
RP11-460L11	 9	18	10	06	105252023	105382023	105317023
RP11-461N23	 9	19	10	13	 98652913	 98802391	 98727652
RP11-463M16	 9	20	10	17	 44137158	 44326794	 44231976
RP11-463O12	 9	21	10	12	121761723	121941477	121851600
RP11-480F4	 9	22	10	09	 93113295	 93281521	 93197408
RP11-482E8	 9	23	10	03	107669460	107870252	107769856
RP11-484P14	 9	24	10	06	100097007	100255305	100176156
RP11-486P13	 9	25	10	19	  4012214	  4197418	  4104816
RP11-490G8	 9	 1	11	12	 94308773	 94461533	 94385153
RP11-492D5	 9	 2	11	15	 71251895	 71360548	 71306221
RP11-502L5	 9	 3	11	03	 48127313	 48298626	 48212969
RP11-506G7	 9	 4	11	17	 38139918	 38327654	 38233786
RP11-506O24	 9	 5	11	01	161466494	161537853	161502173
RP11-507N20	 9	 6	11	12	121758191	121763727	121760959
RP11-512M8	 9	 7	11	12	121153003	121339958	121246480
RP11-514O12	 9	 8	11	06	167163968	167320905	167242436
RP11-527J8	 9	 9	11	02	 99445174	 99678291	 99561732
RP11-529C24	 9	10	11	10	 81853655	 82071278	 81962466
RP11-533F5	 9	11	11	04	 57389597	 57595237	 57492417
RP11-533L22	 9	12	11	07	 84536327	 84705318	 84620822
RP11-535C12	 9	13	11	11	 73191062	 73390468	 73290765
RP11-538J11	 9	14	11	02	 27351525	 27470373	 27410949
RP11-27L6	 9	15	11	11	 18397599	 18551777	 18474688
RP11-29P22	 9	16	11	18	  9391630	  9587352	  9489491
RP11-30H12	 9	17	11	10	104811503	104959528	104885515
RP11-32B5	 9	18	11	15	 19138465	 19296842	 19217653
RP11-34L23	 9	19	11	02	136287283	136465184	136376233
RP11-35D17	 9	20	11	01	210919186	211066770	210992978
RP11-54I20	 9	21	11	X	152226919	152418903	152322911
RP11-56D16	 9	22	11	09	127428520	127591867	127510193
RP11-58K22	 9	23	11	11	 44421674	 44614067	 44517870
RP11-61M18	 9	24	11	19	 58571097	 58732450	 58651773
RP11-62L18	 9	25	11	10	123214090	123388488	123301289
RP11-65B16	 9	 1	12	15	 66242135	 66416054	 66329094
RP11-82C9	 9	 2	12	03	170226793	170407775	170317284
RP11-83F13	 9	 3	12	02	 17701042	 17859965	 17780503
RP11-85F14	 9	 4	12	03	138038704	138228779	138133741
RP11-86N1	 9	 5	12	02	229552221	229719170	229635695
RP11-89G4_2	 9	 6	12	05	131752034	131921419	131836726
RP11-92B21	 9	 7	12	09	134517510	134693859	134605684
RP11-106G13	 9	 8	12	02	 26879347	 27048339	 26963843
RP11-109M19	 9	 9	12	16	 10587858	 10774231	 10681044
RP11-111K18	 9	10	12	07	 42613847	 42800593	 42707220
RP11-112C15	 9	11	12	01	 46338684	 46504602	 46421643
RP11-114L10	 9	12	12	07	141931613	142123518	142027565
RP11-116K5	 9	13	12	03	  5149552	  5305346	  5227449
RP11-702D16	 9	14	12	07	128384401	128555874	128470137
RP11-708D7	 9	15	12	02	 95039648	 95209509	 95124578
RP11-712D22	 9	16	12	11	124981773	125152144	125066958
RP11-722A15	 9	17	12	08	 26139586	 26315576	 26227581
RP11-728H8	 9	18	12	16	   754190	   902810	   828500
RP11-751L19	 9	19	12	04	  9397990	  9563211	  9480600
RP1-164D18	 9	20	12	07	   188213	   257574	   222893
RP1-44H16	 9	21	12	11	   235290	   235901	   235595
RP1-221K18	 9	22	12	12	132310575	132310722	132310648
RP1-154P1	 9	23	12	15	 99915194	100021943	 99968568
RP1-82O2	 9	24	12	20	    79508	    80145	    79826
P1-2H14	 9	25	12	21	 46777319	 46777434	 46777376
RP11-224F8	 9	13	13	01	 20255686	 20256073	 20255879
RP11-139H5	 9	14	13	01	 22238872	 22410183	 22324527
RP11-57F20	 9	15	13	01	 23544768	 23723237	 23634002
RP11-285H13	 9	16	13	01	 26979869	 26980211	 26980040
RP11-4O6	 9	17	13	01	 27621535	 27783470	 27702502
RP11-104J13	 9	18	13	01	 31000822	 31001080	 31000951
RP11-210E5	 9	19	13	01	 56315143	 56479560	 56397351
RP11-12L18	 9	20	13	01	 58199244	 58369134	 58284189
RP11-110A23	 9	21	13	01	 61084838	 61256798	 61170818
RP11-69G14	 9	22	13		NA	NA	NA
RP11-246N19	 9	23	13	01	 64166728	 64325471	 64246099
RP11-86K19	 9	24	13	01	 65549817	 65550196	 65550006
RP11-156M23	 9	25	13	01	 96530060	 96530447	 96530253
RP11-156G15	 9	 1	14	01	101309426	101397571	101353498
RP11-182H2	 9	 2	14	01	101397325	101397571	101397448
RP11-91A21	 9	 3	14	01	106797472	106958243	106877857
RP11-260A24	 9	 4	14	01	110535961	110698007	110616984
RP11-284N8	 9	 5	14	01	110807794	111000977	110904385
RP11-8D14	 9	 6	14	01	157471000	157634916	157552958
RP11-80D6_1	 9	 7	14	01	161968761	162112834	162040797
RP11-234M3	 9	 8	14	01	163947742	163948091	163947916
RP11-167M6	 9	 9	14	01	164524458	164697238	164610848
RP11-171H24	 9	10	14	01	164986073	164986431	164986252
RP11-165A8	 9	11	14	01	167475764	167652623	167564193
RP11-91I23	 9	12	14	02	 25729103	 25890581	 25809842
RP11-91M5	 9	13	14	02	201338302	201524963	201431632
RP11-91O10	 9	14	14	02	167040735	167206828	167123781
RP11-91A9	 9	15	14	02	173860137	174025709	173942923
RP11-91E9	 9	16	14	02	 14085007	 14248306	 14166656
RP11-91E19	 9	17	14	02	 69978001	 70137149	 70057575
RP11-163N23_2	 9	18	14	02	 36511019	 36641019	 36576019
RP11-119J12_2	 9	19	14	02	 45722682	 45896568	 45809625
RP11-81L7_3	 9	20	14	02	 57065869	 57218868	 57142368
RP11-87C16_2	 9	21	14	02	 73327095	 73327385	 73327240
RP11-113N17_2	 9	22	14	02	 82523780	 82682205	 82602992
RP11-84M16_2	 9	23	14	02	 85988496	 85988850	 85988673
RP11-50J20_2	 9	24	14	02	160394495	160524495	160459495
RP11-218D15_2	 9	25	14	02	171199763	171200132	171199947
RP11-95I17_2	 9	 1	15	02	179380658	179554232	179467445
RP11-69G4_2	 9	 2	15	02	182670510	182868798	182769654
RP11-30M1_2	 9	 3	15	02	195293720	195479196	195386458
RP11-57C6_2	 9	 4	15	02	201453608	201620494	201537051
RP11-201F21	 9	 5	15	02	236909555	237040914	236975234
RP11-451E14	 9	 6	15	02	 84094356	 84310169	 84202262
RP11-451E10	 9	 7	15	02	 63688170	 63854547	 63771358
RP11-451A6	 9	 8	15	02	  5857456	  6045303	  5951379
RP11-451C2	 9	 9	15	02	102076851	102228590	102152720
RP11-451A8	 9	10	15	02	210972238	211141932	211057085
RP11-79E2_1	 9	11	15	04	143001495	143146137	143073816
RP11-122I3	 9	12	15	04	144705898	144872906	144789402
RP11-210F12	 9	13	15	04	147136851	147137255	147137053
RP11-82L8	 9	14	15	04	145155697	145285315	145220506
RP11-180J5	 9	15	15	04	147780091	147780473	147780282
RP11-77F4	 9	16	15	04	152415384	152545384	152480384
RP11-27H11	 9	17	15	04	159963477	160127119	160045298
RP11-41G4	 9	18	15	04	163045489	163045768	163045628
RP11-51H8	 9	19	15	04	168532619	168662619	168597619
RP11-130I2	 9	20	15	04	169652616	169653013	169652814
RP11-254A7	 9	21	15	04	170217901	170218065	170217983
RP11-272N13	 9	22	15	04	172677509	172677729	172677619
RP11-244K2	 9	23	15	04	182769217	182919319	182844268
RP11-85P1	 9	24	15	04	184327430	184327837	184327633
RP11-196K13	 9	25	15	04	185011644	185167555	185089599
RP11-13O14	 9	 1	16	04	185429832	185600513	185515172
RP11-228F3	 9	 2	16	04	186010451	186178332	186094391
RP11-256M13	 9	 3	16	04	185526204	185527209	185526706
CTD-2169F23	 9	 4	16	04	 55722016	 55854530	 55788273
RP11-79E19	 9	 5	16	04	166661611	166821571	166741591
RP11-79M7	 9	 6	16	04	 45876352	 46024486	 45950419
RP11-79E18	 9	 7	16	04	176732766	176908730	176820748
RP11-79I18	 9	 8	16	04	126075320	126253109	126164214
RP11-79K16	 9	 9	16	04	128425729	128578641	128502185
RP11-52B15	 9	10	16	06	 89747264	 89877264	 89812264
RP11-113K7	 9	11	16	06	 91999421	 92151378	 92075399
RP11-14I4	 9	12	16	06	100566870	100721124	100643997
RP11-83A13	 9	13	16	06	103905587	103905895	103905741
RP11-165E15	 9	14	16	06	108343493	108537457	108440475
RP11-28L24	 9	15	16	06	112508532	112657556	112583044
RP11-177M14	 9	16	16	06	133473462	133625304	133549383
RP11-32P13	 9	17	16	06	136356906	136357238	136357072
RP11-40O24	 9	18	16	06	148731405	148731714	148731559
RP11-43B19	 9	19	16	06	160956179	161050983	161003581
CTD-2009C6	 9	20	16	06	 64287483	 64482173	 64384828
CTD-2057J2	 9	21	16	06	152404972	152523956	152464464
RP11-79I12	 9	22	16	06	113560274	113759345	113659809
RP11-79M24	 9	23	16	06	  1754013	  1926781	  1840397
RP11-79O24	 9	24	16	06	 56208781	 56381084	 56294932
RP11-79B19	 9	25	16	06	 21193948	 21323948	 21258948
RP11-79F13	 9	 1	17	06	 44649048	 44815782	 44732415
RP11-79F23	 9	 2	17	06	 95037848	 95195069	 95116458
RP11-88N6	 9	 3	17	06	 64906453	 65035381	 64970917
RP11-89G8	 9	 4	17	06	136180051	136330449	136255250
RP11-89D6	 9	 5	17	06	 57189192	 57319192	 57254192
RP11-89L17	 9	 6	17	06	 45129981	 45288442	 45209211
RP11-90H17	 9	 7	17	06	 46419528	 46569438	 46494483
RP11-90K15	 9	 8	17	06	 52410364	 52552289	 52481326
RP11-27I15	 9	 9	17	08	 93214222	 93370861	 93292541
RP11-10G10	 9	10	17	08	101279027	101431772	101355399
RP11-142F22	 9	11	17	08	100624092	100777935	100701013
RP11-287H4	 9	12	17	08	 99900717	 99901043	 99900880
RP11-131O16	 9	13	17	08	 99117291	 99117617	 99117454
RP11-125O21	 9	14	17	08	 99396133	 99551453	 99473793
RP11-21H16	 9	15	17	08	135975721	136154996	136065358
RP11-122H7	 9	16	17	08	138370664	138543270	138456967
RP11-45M12	 9	17	17	08	  3899622	  4066807	  3983214
CTD-2060N3	 9	18	17	08	 32717555	 32816843	 32767199
CTD-2092I19	 9	19	17	08	121619374	121619656	121619515
RP11-79E1	 9	20	17	08	110313566	110473619	110393592
RP11-80P10	 9	21	17	08	 97773100	 97929978	 97851539
RP11-81B5	 9	22	17	08	108637181	108788888	108713034
RP11-88J22	 9	23	17	08	 94049727	 94241540	 94145633
RP11-88N8	 9	24	17	08	 75573436	 75722961	 75648198
RP11-89A16	 9	25	17	08	 66002195	 66192073	 66097134
RP11-89I14	 9	 1	18	08	 80748493	 80919039	 80833766
RP11-90D11	 9	 2	18	08	 96442878	 96616306	 96529592
RP11-90I3	 9	 3	18	08	 16716672	 16894504	 16805588
RP11-90O15	 9	 4	18	08	 86163395	 86293395	 86228395
RP11-90J21	 9	 5	18	08	  8837121	  9012651	  8924886
RP11-90P5_1	 9	 6	18	08	 38091018	 38226422	 38158720
RP11-91J19	 9	 7	18	08	   304159	   465319	   384739
RP11-46G13	 9	 8	18	10	115937504	116103603	116020553
RP11-51G15	 9	 9	18	10	120589963	120742850	120666406
RP11-48B22	 9	10	18	10	121574308	121748305	121661306
RP11-257O17	 9	11	18	10	122299116	122467435	122383275
RP11-255D5	 9	12	18	10	123565566	123642548	123604057
RP11-70E19	 9	13	18	10	125047207	125217217	125132212
RP11-142I8	 9	14	18	10	133292205	133450482	133371343
RP11-316M21_1	 9	15	18	10	101835645	102030561	101933103
RP11-35J23	 9	16	18	10	 98029353	 98176262	 98102807
RP11-57C13	 9	17	18	10	 89241351	 89411287	 89326319
CTD-2130I7	 9	18	18	10	 30718048	 30796069	 30757058
RP11-79A15	 9	19	18	10	 89430656	 89601183	 89515919
RP11-80J20	 9	20	18	10	 18444579	 18626541	 18535560
RP11-81B9	 9	21	18	10	 23167614	 23358208	 23262911
RP11-81N7	 9	22	18	10	 96195935	 96371474	 96283704
RP11-89A18	 9	23	18	10	 76297511	 76472651	 76385081
RP11-89G20	 9	24	18	10	107761235	107925579	107843407
RP11-89K18	 9	25	18	10	  2837892	  2999961	  2918926
RP11-90K19	 9	 1	19	10	126193027	126352707	126272867
RP11-90O1	 9	 2	19	10	 97835227	 97991417	 97913322
RP11-90O7	 9	 3	19	10	 86468638	 86622763	 86545700
RP11-90J1	 9	 4	19	10	 96283496	 96453506	 96368501
RP11-90J11	 9	 5	19	10	109464019	109620344	109542181
RP11-91H5	 9	 6	19		NA	NA	NA
RP11-141N1	 9	 7	19	12	 91384464	 91514464	 91449464
RP11-82I16	 9	 8	19	12	 92401122	 92401502	 92401312
RP11-215G13	 9	 9	19	12	 93272738	 93273047	 93272892
RP11-282G15	 9	10	19	12	 94497911	 94684237	 94591074
RP11-64J11	 9	11	19	12	 95598643	 95766573	 95682608
RP11-165H12	 9	12	19	12	 99314032	 99450581	 99382306
RP11-119J23	 9	13	19	12	113966849	114129875	114048362
RP11-78D24	 9	14	19	12	127287870	127428715	127358292
RP11-69L19	 9	15	19	12	127814028	127944028	127879028
RP11-119J21	 9	16	19	12	129202501	129332501	129267501
CTD-2043O8	 9	17	19	12	 47333592	 47333755	 47333673
RP11-79K1	 9	18	19	12	 45882229	 46036700	 45959464
RP11-88F24	 9	19	19	12	 60535531	 60713327	 60624429
RP11-88N10	 9	20	19	12	 86505403	 86675807	 86590605
RP11-89M22	 9	21	19	12	 70588952	 70736075	 70662513
RP11-89H19	 9	22	19	12	 46473179	 46667329	 46570254
RP11-89P15	 9	23	19	12	 70047718	 70221154	 70134436
RP11-89L4	 9	24	19	12	 26702866	 26832866	 26767866
RP11-91B19	 9	25	19	12	 20182506	 20360003	 20271254
RP11-91L17	 9	 1	20	12	 49473504	 49603504	 49538504
RP11-91K15	 9	 2	20	12	 39661902	 39833112	 39747507
RP11-91M21	 9	 3	20	12	113284246	113455747	113369996
RP11-91M22	 9	 4	20	12	103692722	103868789	103780755
RP11-91C4	 9	 5	20	12	 82656484	 82808527	 82732505
RP11-9B21	 9	 6	20	15	 96519678	 96649678	 96584678
RP11-152F13	 9	 7	20	15	 80867007	 81024206	 80945606
RP11-127C24	 9	 8	20	15	 37828756	 37993671	 37911213
RP11-78I21	 9	 9	20	15	 41490969	 41750990	 41620979
CTD-2018N9	 9	10	20	15	 23134033	 23134373	 23134203
RP11-79A7	 9	11	20	15	 90582758	 90741777	 90662267
RP11-88F10	 9	12	20	15	 41591917	 41763432	 41677674
RP11-88P10	 9	13	20	15	 23717132	 23863007	 23790069
RP11-89O12_2	 9	14	20	15	 45626014	 45768850	 45697432
RP11-90A19	 9	15	20	15	 59011605	 59184166	 59097885
RP11-90B9	 9	16	20	15	 81302298	 81488674	 81395486
RP11-91J9	 9	17	20	15	 75682576	 75851855	 75767215
RP11-109D4	 9	18	20	16	 18569813	 18747519	 18658666
RP11-186E3	 9	19	20	16	 20095945	 20225945	 20160945
RP11-141E3	 9	20	20	16	 23458654	 23647789	 23553221
RP11-150K5	 9	21	20	16	 29825186	 29825404	 29825295
RP11-259N3	 9	22	20	16	 47262234	 47416562	 47339398
RP11-20A10	 9	23	20	16	 49199663	 49373681	 49286672
RP11-83H21	 9	24	20	16	 63807392	 63807761	 63807576
RP11-3A9	 9	25	20	16	 65204892	 65205285	 65205088
RP11-151M19	 9	 1	21	16	 66146466	 66300311	 66223388
RP11-52E21	 9	 2	21	16	 67833447	 67963447	 67898447
RP11-224E17_2	 9	 3	21	16	 67375999	 67426927	 67401463
RP11-14J15	 9	 4	21	16	 68192245	 68322245	 68257245
RP11-26F18	 9	 5	21	20	  3076069	  3238538	  3157303
RP11-235C20	 9	 6	21	20	  5034622	  5034936	  5034779
RP11-9G21	 9	 7	21	20	  6090695	  6091140	  6090917
RP11-26H9	 9	 8	21	20	  6654051	  6784051	  6719051
RP11-103H2	 9	 9	21	20	  9036863	  9212175	  9124519
RP11-40J24	 9	10	21	20	 10989672	 10990059	 10989865
RP11-58B10	 9	11	21	20	 24365445	 24538516	 24451980
RP11-160I20	 9	12	21	20	 32920861	 33050861	 32985861
RP11-23B22	 9	13	21		NA	NA	NA
RP11-138A15	 9	14	21	20	 35465342	 35595342	 35530342
RP11-9M24	 9	15	21	20	 38315924	 38316258	 38316091
RP11-111H12	 9	16	21	20	 38940371	 39112443	 39026407
RP11-10D18	 9	17	21	20	 49929893	 50078481	 50004187
RP11-15M15	 9	18	21	20	 51109650	 51266870	 51188260
RP11-212M6	 9	19	21	20	 52438867	 52439220	 52439043
RP11-172C21	 9	20	21	20	 53305855	 53329123	 53317489
RP11-94A18	 9	21	21	20	 58192126	 58357017	 58274571
CTD-2060H18	 9	22	21	20	 31637430	 31771899	 31704664
RP11-90E23	 9	23	21	20	 11116884	 11280959	 11198921
RP11-91L1	 9	24	21	20	 51421216	 51572829	 51497022
RP11-91I21	 9	25	21	20	 31368560	 31498560	 31433560
RP11-91O7	 9	 1	22	20	 10970504	 11146808	 11058656
RP11-91G1	 9	 2	22	20	 20887436	 21068994	 20978215
RP11-451E24	 9	 3	22	20	 50602598	 50732598	 50667598
RP11-84C16_1	 9	 4	22	19	 49913270	 50122986	 50018128
RP11-86F24	 9	 5	22	01	100893632	101046499	100970065
RP11-88J11	 9	 6	22	13	 25754065	 25932626	 25843345
RP11-90K6	 9	 7	22	03	113501857	113661947	113581902
RP11-91I20_2	 9	 8	22	08	 61578650	 61769195	 61673922
RP11-92L12	 9	 9	22	02	210318927	210448927	210383927
RP11-101E13	 9	10	22	01	189674427	189822405	189748416
RP11-101J8	 9	11	22	01	155036448	155205201	155120824
RP11-104O19	 9	12	22	17	  4001078	  4169913	  4085495
RP11-107C21	 9	13	22	11	 18269749	 18436773	 18353261
RP11-109I2	 9	14	22	01	 55221894	 55405411	 55313652
RP11-114B7	 9	15	22	01	 32770496	 32943373	 32856934
RP11-126L15	 9	16	22	07	100000140	100172498	100086319
RP11-128P23	 9	17	22	09	 41775839	 43460972	 42618405
RP11-131N11	 9	18	22	10	 62096763	 62257986	 62177374
RP11-134C3	 9	19	22	01	 43709705	 43875298	 43792501
RP11-136P18	 9	20	22	04	 78163000	 78345051	 78254025
RP11-138C1	 9	21	22	05	 39226020	 39374663	 39300341
RP11-151O22	 9	22	22	19	 12850328	 13005526	 12927927
RP11-152K4	 9	23	22	05	 31218628	 31396320	 31307474
RP11-153A23	 9	24	22	17	 73516546	 73694284	 73605415
RP11-155G14	 9	25	22	07	127564256	127729346	127646801
RP11-157P1	 9	 1	23	20	 60192233	 60385082	 60288657
RP11-166B2	 9	 2	23	16	 11856221	 12029014	 11942617
RP11-456A17	 9	 3	23	05	 78300928	 78493830	 78397379
RP11-459F6	 9	 4	23	16	 56719828	 56928048	 56823938
RP11-460L11	 9	 5	23	06	105252023	105382023	105317023
RP11-461N23	 9	 6	23	13	 98652913	 98802391	 98727652
RP11-463M16	 9	 7	23	17	 44137158	 44326794	 44231976
RP11-463O12	 9	 8	23	12	121761723	121941477	121851600
RP11-480F4	 9	 9	23	09	 93113295	 93281521	 93197408
RP11-482E8	 9	10	23	03	107669460	107870252	107769856
RP11-484P14	 9	11	23	06	100097007	100255305	100176156
RP11-486P13	 9	12	23	19	  4012214	  4197418	  4104816
RP11-490G8	 9	13	23	12	 94308773	 94461533	 94385153
RP11-492D5	 9	14	23	15	 71251895	 71360548	 71306221
RP11-502L5	 9	15	23	03	 48127313	 48298626	 48212969
RP11-506G7	 9	16	23	17	 38139918	 38327654	 38233786
RP11-506O24	 9	17	23	01	161466494	161537853	161502173
RP11-507N20	 9	18	23	12	121758191	121763727	121760959
RP11-512M8	 9	19	23	12	121153003	121339958	121246480
RP11-514O12	 9	20	23	06	167163968	167320905	167242436
RP11-527J8	 9	21	23	02	 99445174	 99678291	 99561732
RP11-529C24	 9	22	23	10	 81853655	 82071278	 81962466
RP11-533F5	 9	23	23	04	 57389597	 57595237	 57492417
RP11-533L22	 9	24	23	07	 84536327	 84705318	 84620822
RP11-535C12	 9	25	23	11	 73191062	 73390468	 73290765
RP11-538J11	 9	 1	24	02	 27351525	 27470373	 27410949
RP11-27L6	 9	 2	24	11	 18397599	 18551777	 18474688
RP11-29P22	 9	 3	24	18	  9391630	  9587352	  9489491
RP11-30H12	 9	 4	24	10	104811503	104959528	104885515
RP11-32B5	 9	 5	24	15	 19138465	 19296842	 19217653
RP11-34L23	 9	 6	24	02	136287283	136465184	136376233
RP11-35D17	 9	 7	24	01	210919186	211066770	210992978
RP11-54I20	 9	 8	24	X	152226919	152418903	152322911
RP11-56D16	 9	 9	24	09	127428520	127591867	127510193
RP11-58K22	 9	10	24	11	 44421674	 44614067	 44517870
RP11-61M18	 9	11	24	19	 58571097	 58732450	 58651773
RP11-62L18	 9	12	24	10	123214090	123388488	123301289
RP11-65B16	 9	13	24	15	 66242135	 66416054	 66329094
RP11-82C9	 9	14	24	03	170226793	170407775	170317284
RP11-83F13	 9	15	24	02	 17701042	 17859965	 17780503
RP11-85F14	 9	16	24	03	138038704	138228779	138133741
RP11-86N1	 9	17	24	02	229552221	229719170	229635695
RP11-89G4_2	 9	18	24	05	131752034	131921419	131836726
RP11-92B21	 9	19	24	09	134517510	134693859	134605684
RP11-106G13	 9	20	24	02	 26879347	 27048339	 26963843
RP11-109M19	 9	21	24	16	 10587858	 10774231	 10681044
RP11-111K18	 9	22	24	07	 42613847	 42800593	 42707220
RP11-112C15	 9	23	24	01	 46338684	 46504602	 46421643
RP11-114L10	 9	24	24	07	141931613	142123518	142027565
RP11-116K5	 9	25	24	03	  5149552	  5305346	  5227449
RP11-702D16	 9	 1	25	07	128384401	128555874	128470137
RP11-708D7	 9	 2	25	02	 95039648	 95209509	 95124578
RP11-712D22	 9	 3	25	11	124981773	125152144	125066958
RP11-722A15	 9	 4	25	08	 26139586	 26315576	 26227581
RP11-728H8	 9	 5	25	16	   754190	   902810	   828500
RP11-751L19	 9	 6	25	04	  9397990	  9563211	  9480600
RP1-164D18	 9	 7	25	07	   188213	   257574	   222893
RP1-44H16	 9	 8	25	11	   235290	   235901	   235595
RP1-221K18	 9	 9	25	12	132310575	132310722	132310648
RP1-154P1	 9	10	25	15	 99915194	100021943	 99968568
RP1-82O2	 9	11	25	20	    79508	    80145	    79826
P1-2H14	 9	12	25	21	 46777319	 46777434	 46777376
RP11-51B4_2	10	 1	 1		NA	NA	NA
RP11-65I22	10	 2	 1	01	199232706	199413864	199323285
RP11-70G20	10	 3	 1	01	200326964	200327254	200327109
RP11-155F3	10	 4	 1	01	201459681	201641559	201550620
RP11-219P13	10	 5	 1	01	202446965	202447335	202447150
RP11-145I13	10	 6	 1	01	203623431	203753431	203688431
RP11-192M1	10	 7	 1	01	222516399	222516739	222516569
RP11-155C15	10	 8	 1	01	230927584	231057584	230992584
RP11-194F13	10	 9	 1	01	238025750	238183502	238104626
RP11-212E22	10	10	 1	01	239198599	239198980	239198789
CTD-2010C4	10	11	 1	01	 64983382	 65084558	 65033970
CTD-2077L2	10	12	 1	01	148077375	148077819	148077597
RP11-79M15	10	13	 1	01	157484197	157614197	157549197
RP11-79M12	10	14	 1	01	205759609	205928728	205844168
RP11-79B11	10	15	 1	01	 64575648	 64734034	 64654841
RP11-79H5	10	16	 1	01	212474619	212655606	212565112
RP11-79I13	10	17	 1	01	 81419245	 81565588	 81492416
RP11-80D6_2	10	18	 1	01	161968761	162112834	162040797
RP11-81N17	10	19	 1	01	155159521	155311997	155235759
RP11-88D6	10	20	 1	01	117422762	117631324	117527043
RP11-88F22	10	21	 1	01	 79745835	 79947809	 79846822
RP11-88J24	10	22	 1	01	 37076899	 37251319	 37164109
RP11-88N18	10	23	 1	01	228034708	228191242	228112975
RP11-88N24	10	24	 1	01	 98665911	 98812494	 98739202
RP11-279L16	10	25	 1	03	 15213261	 15387250	 15300255
RP11-208G16	10	 1	 2	03	 22372628	 22514821	 22443724
RP11-41F5	10	 2	 2	03	 23709789	 23880449	 23795119
RP11-103N21	10	 3	 2	03	 29867263	 30018477	 29942870
RP11-209O16	10	 4	 2	03	 38244229	 38407861	 38326045
RP11-241P3	10	 5	 2	03	 42284364	 42440027	 42362195
RP11-129B22	10	 6	 2	03	 64013182	 64184359	 64098770
RP11-146E16	10	 7	 2	03	 67739513	 67813082	 67776297
RP11-8M11	10	 8	 2	03	 86131902	 86261902	 86196902
RP11-129G16	10	 9	 2		NA	NA	NA
RP11-129P2	10	10	 2	03	109086950	109087255	109087102
RP11-12P11	10	11	 2	03	112745660	112921068	112833364
RP11-162J10	10	12	 2	03	138894916	139071591	138983253
RP11-160A13	10	13	 2	03	144154808	144312333	144233570
RP11-72E23	10	14	 2	03	146541915	146689401	146615658
RP11-145F16	10	15	 2	03	151508469	151678834	151593651
RP11-80I14	10	16	 2	03	153590898	153735647	153663272
RP11-209H21	10	17	 2	03	160726422	160903111	160814766
RP11-67E18	10	18	 2	03	189918761	190076498	189997629
RP11-53D15	10	19	 2	03	191144810	191252245	191198527
RP11-88M1	10	20	 2	03	193159977	193160310	193160143
RP11-168F7	10	21	 2	19	 48791653	 48964139	 48877896
RP11-57D6	10	22	 2	03	 13144531	 13315049	 13229790
RP11-372E1	10	23	 2	03	144017129	144200229	144108679
RP11-81P7	10	24	 2	04	161330286	161501950	161416118
RP11-88D10	10	25	 2	04	107874806	108081978	107978392
RP11-89A8	10	 1	 3	04	 52714512	 52724149	 52719330
RP11-89E24	10	 2	 3	04	129487541	129650256	129568898
RP11-89G2	10	 3	 3	04	 72535183	 72701544	 72618363
RP11-89I4	10	 4	 3	04	 35186861	 35342019	 35264440
RP11-89F4	10	 5	 3	04	 44332225	 44462225	 44397225
RP11-89P23	10	 6	 3	04	135212129	135378156	135295142
RP11-90E7	10	 7	 3	04	185184718	185344793	185264755
RP11-90B17	10	 8	 3	04	171049865	171221242	171135553
RP11-90D5	10	 9	 3	04	173631500	173785402	173708451
RP11-90I1	10	10	 3	04	 34409026	 34525425	 34467225
RP11-91E6	10	11	 3	04	 87167643	 87338236	 87252939
RP11-449B1	10	12	 3	04	 83882812	 84039142	 83960977
RP11-451M10	10	13	 3	04	 91975574	 92125825	 92050699
RP11-81J19	10	14	 3	04	182617864	182783135	182700499
RP11-20B3	10	15	 3	05	  3055342	  3213642	  3134492
RP11-103L11	10	16	 3	05	  3816325	  4002342	  3909333
RP11-88L18_1	10	17	 3	05	 17465419	 17636603	 17551011
RP11-67P13	10	18	 3	05	 32057784	 32223971	 32140877
RP11-4N21	10	19	 3	05	 34798552	 34798925	 34798738
RP11-253B9	10	20	 3	05	 37895157	 37895340	 37895248
RP11-9G14	10	21	 3	05	 41319671	 41319970	 41319820
RP11-17H13	10	22	 3	05	 54163147	 54293147	 54228147
RP11-91E17	10	23	 3	06	 55127630	 55281751	 55204690
RP11-91G4	10	24	 3	06	 93870299	 94057737	 93964018
RP11-451M16	10	25	 3	06	136257241	136387241	136322241
RP11-191P7	10	 1	 4	07	  2977025	  3125956	  3051490
RP11-96L18	10	 2	 4	07	  2632601	  2788650	  2710625
RP11-183O1	10	 3	 4	07	  6275590	  6275791	  6275690
RP11-52E9	10	 4	 4	07	 27058078	 27188078	 27123078
RP11-93J6	10	 5	 4	07	 31846265	 32018912	 31932588
RP11-128O3	10	 6	 4	07	 33418110	 33418458	 33418284
RP11-115G23	10	 7	 4	07	 34986452	 35140107	 35063279
RP11-87M15	10	 8	 4	07	 36536763	 36537288	 36537025
RP11-115G1	10	 9	 4	07	 38526041	 38691652	 38608846
RP11-146C1	10	10	 4		NA	NA	NA
RP11-48B18	10	11	 4	07	 48391085	 48548556	 48469820
RP11-14K11	10	12	 4	07	 54903387	 54903650	 54903518
RP11-251I15	10	13	 4	07	 55381621	 55381999	 55381810
RP11-45N18	10	14	 4	07	 61822024	 61983953	 61902988
RP11-214K14	10	15	 4	07	 65867497	 65867687	 65867592
RP11-46O13	10	16	 4	07	 88022288	 88200178	 88111233
RP11-126B8	10	17	 4	07	 92355443	 92485443	 92420443
RP11-32C15	10	18	 4	07	 95259716	 95260053	 95259884
RP11-163M5	10	19	 4	07	101347873	101528379	101438126
RP11-88E13	10	20	 4	07	 69645461	 69645906	 69645683
RP11-61C18	10	21	 4	07	106338795	106492688	106415741
RP11-62H18	10	22	 4	09	  4575558	  4575778	  4575668
RP11-125K10	10	23	 4	09	  4819655	  4991841	  4905748
RP11-165O14	10	24	 4	09	  5873408	  6029621	  5951514
RP11-32D4	10	25	 4	09	 11469224	 11641686	 11555455
RP11-264O11	10	 1	 5	09	 10578155	 10578494	 10578324
RP11-26K11	10	 2	 5	09	 11789514	 11789897	 11789705
RP11-118C13	10	 3	 5	09	 32970169	 33120838	 33045503
RP11-17J8	10	 4	 5	09	 34511040	 34511447	 34511243
RP11-165H19	10	 5	 5	09	 34589620	 34758037	 34673828
RP11-61G7	10	 6	 5	09	 35674485	 35804485	 35739485
RP11-154M9	10	 7	 5	09	 36204443	 36204779	 36204611
RP11-144L7	10	 8	 5	09	 38085104	 38225798	 38155451
RP11-8C21_1	10	 9	 5	09	 88962453	 89168653	 89065553
RP11-23D11	10	10	 5	09	 82178610	 82353358	 82265984
RP11-273J10	10	11	 5	09	 83848346	 83848436	 83848391
RP11-74F15	10	12	 5	09	 83415231	 83560147	 83487689
RP11-65C15	10	13	 5	09	 85721751	 85861729	 85791740
RP11-65B23_1	10	14	 5	09	 87484294	 87654534	 87569414
RP11-23B15	10	15	 5	09	 97623553	 97784350	 97703951
RP11-147H22	10	16	 5	09	 98144353	 98144734	 98144543
RP11-69F21	10	17	 5	09	 98798978	 98928978	 98863978
RP11-4B2	10	18	 5	09	 99571379	 99701379	 99636379
RP11-39L9	10	19	 5	09	 99974087	 99974457	 99974272
RP11-30N20	10	20	 5	09	 99647741	 99816466	 99732103
RP11-209M9	10	21	 5	11	  4180209	  4180458	  4180333
RP11-98L18	10	22	 5	11	  6105391	  6266570	  6185980
RP11-205O15	10	23	 5	11	  7248586	  7248926	  7248756
RP11-133H19	10	24	 5	11	  8555485	  8732332	  8643908
RP11-170F20	10	25	 5	11	 10526429	 10673773	 10600101
RP11-245K9	10	 1	 6	11	 12678356	 12808356	 12743356
RP11-56J22	10	 2	 6	11	 20180423	 20332556	 20256489
RP11-11A11	10	 3	 6	11	 19946712	 20110972	 20028842
RP11-15A11	10	 4	 6	11	 23931119	 23931493	 23931306
RP11-203L7	10	 5	 6	11	 26538836	 26539000	 26538918
RP11-236N9	10	 6	 6	11	 29442650	 29613211	 29527930
RP11-215F2	10	 7	 6	11	 31319852	 31320152	 31320002
RP11-150D18	10	 8	 6	11	 41858281	 42020207	 41939244
RP11-18D13	10	 9	 6		NA	NA	NA
RP11-102E22_1	10	10	 6	11	 44098955	 44271172	 44185063
RP11-12C11	10	11	 6	11	 44879165	 45046162	 44962663
RP11-39G12	10	12	 6	11	 46582997	 46737312	 46660154
RP11-85A19	10	13	 6	11	 48091012	 48108920	 48099966
RP11-120P20	10	14	 6	11	 70080722	 70081006	 70080864
RP11-51M9	10	15	 6	11	 71935340	 72065340	 72000340
RP11-102M18	10	16	 6	11	 73288761	 73452999	 73370880
RP11-168B13	10	17	 6	11	 74766492	 74942321	 74854406
RP11-119C13	10	18	 6	11	 75575032	 75575280	 75575156
RP11-7H7	10	19	 6	11	 78034239	 78206821	 78120530
RP11-64C21	10	20	 6	13	 30138151	 30268151	 30203151
RP11-14A4	10	21	 6	13	 38973232	 39103232	 39038232
RP11-9F13	10	22	 6	13	 40663949	 40806646	 40735297
RP11-13I8	10	23	 6	13	 41402235	 41593291	 41497763
RP11-34K15	10	24	 6	13	 42360122	 42360372	 42360247
RP11-217H23	10	25	 6	13	 44755696	 44756096	 44755896
RP11-31C6	10	 1	 7	13	 72628310	 72628651	 72628480
RP11-9P22	10	 2	 7	13	 73620422	 73769921	 73695171
RP11-79I4_1	10	 3	 7	13	 73284060	 73462828	 73373444
RP11-137M6	10	 4	 7	13	 76931003	 77124101	 77027552
RP11-93G2	10	 5	 7	13	 77899012	 78086670	 77992841
RP11-51C8	10	 6	 7	13	 86679274	 86841507	 86760390
RP11-200I17	10	 7	 7	13	105334288	105334666	105334477
RP11-233E7	10	 8	 7	13	108485598	108485984	108485791
RP11-61I17	10	 9	 7	13	108838301	108968301	108903301
RP11-3P8	10	10	 7	13	111758242	111949607	111853924
RP11-420H1	10	11	 7	13	 24251124	 24440032	 24345578
CTD-2052F6	10	12	 7	13	 25738287	 25885040	 25811663
RP11-88F2	10	13	 7	13	 22746386	 22936999	 22841692
RP11-89A14	10	14	 7	13	 82411998	 82577009	 82494503
RP11-89L15	10	15	 7	13	 39910849	 40070543	 39990696
RP11-89P22	10	16	 7	13	 27585553	 27715553	 27650553
RP11-90F5	10	17	 7	13	 34362633	 34512960	 34437796
RP11-90M5	10	18	 7	13	 29310415	 29471953	 29391184
RP11-110L8	10	19	 7	16	 82189776	 82384326	 82287051
RP11-254F19	10	20	 7	16	 83357020	 83531734	 83444377
RP11-122P17	10	21	 7	16	 84512389	 84688206	 84600297
RP11-118F19	10	22	 7	16	 84123856	 84279987	 84201921
RP11-95P2_1	10	23	 7	16	  4114616	  4289638	  4202127
RP11-250E14_1	10	24	 7	16	 55893719	 56094253	 55993986
RP11-81L19	10	25	 7	16	 15519957	 15681446	 15600701
RP11-81P17	10	 1	 8	16	 60052285	 60182285	 60117285
RP11-89G14	10	 2	 8	16	 59894531	 60054888	 59974709
RP11-89K4	10	 3	 8	16	 72163705	 72328913	 72246309
RP11-89D3	10	 4	 8	16	 10159016	 10336338	 10247677
RP11-89L6	10	 5	 8	16	 75563743	 75693743	 75628743
CTA-991H5	10	 6	 8	16	 16553896	 16662152	 16608024
RP11-212I21_1	10	 7	 8	16	 53975963	 54169922	 54072942
RP11-283C7	10	 8	 8	16	 45502831	 45688112	 45595471
RP11-327F22	10	 9	 8	16	 49274146	 49442417	 49358281
RP11-381L15	10	10	 8	16	 50687676	 50856510	 50772093
RP11-452G23	10	11	 8	16	 47238885	 47397792	 47318338
RP11-89A15	10	12	 8	17	  8199740	  8365794	  8282767
RP11-100L12	10	13	 8	17	 25530227	 25708593	 25619410
RP11-252N11	10	14	 8	17	 30441739	 30442082	 30441910
RP11-268H17	10	15	 8	17	 36278241	 36442072	 36360156
RP11-87N6	10	16	 8	17	 35559232	 35692479	 35625855
RP11-29C11	10	17	 8	17	 36749371	 36924021	 36836696
RP11-53K11_1	10	18	 8	21	 25756854	 25925353	 25841103
RP11-53K11_2	10	19	 8	21	 25756854	 25925353	 25841103
RP11-115H17	10	20	 8	21	 27020424	 27162298	 27091361
RP11-83L17	10	21	 8	21	 26922995	 26923374	 26923184
RP11-30N6	10	22	 8	21	 29708169	 29838169	 29773169
RP11-74D19	10	23	 8	21	 28596969	 28756595	 28676782
RP11-12N9	10	24	 8	21	 36748728	 36749069	 36748898
RP11-78B20	10	25	 8	21	 38370733	 38371157	 38370945
RP11-1P3	10	 1	 9	21	 40165171	 40295171	 40230171
RP11-120C17	10	 2	 9	21	 41630602	 41780323	 41705462
RP11-549G7	10	 3	 9	21	 43679361	 43891061	 43785211
CTD-2096F11	10	 4	 9	21	 33731276	 33731512	 33731394
RP11-91N21	10	 5	 9	21	 14886780	 15043867	 14965323
RP11-172D7	10	 6	 9	22	 16233834	 16234198	 16234016
RP11-22M5_1	10	 7	 9	22	 20564314	 20719548	 20641931
RP11-76E8	10	 8	 9	22	 22795270	 22989794	 22892532
RP11-29I20	10	 9	 9	22	 24821525	 24951525	 24886525
RP11-26I11	10	10	 9	22	 26007486	 26007856	 26007671
RP11-116K16	10	11	 9	22	 42303034	 42433034	 42368034
RP11-61L22	10	12	 9	22	 43957911	 44087911	 44022911
RP11-133P21	10	13	 9	22	 47722916	 47723246	 47723081
RP11-278E23_1	10	14	 9	22	 19862623	 19958793	 19910708
RP11-79G21	10	15	 9	22	 26493946	 26651940	 26572943
RP11-79B21	10	16	 9	22	 33758267	 33933259	 33845763
RP11-181G12	10	17	 9	01	  2104648	  2284571	  2194609
RP11-188P17	10	18	 9	04	184147521	184277395	184212458
RP11-190I11	10	19	 9	01	 65038286	 65038610	 65038448
RP11-194A15	10	20	 9	03	157875443	158057574	157966508
RP11-195E2	10	21	 9	05	 70234597	 70425468	 70330032
RP11-196B3	10	22	 9	18	 75261844	 75424109	 75342976
RP11-208C17	10	23	 9	10	 96678460	 96821641	 96750050
RP11-210L7	10	24	 9	12	101290820	101460824	101375822
RP11-212I21_2	10	25	 9	16	 53975963	 54169922	 54072942
RP11-214A4	10	 1	10	02	162963643	163059060	163011351
RP11-215G15	10	 2	10	05	 10644704	 10824782	 10734743
RP11-215H5	10	 3	10	18	 38185369	 38323522	 38254445
RP11-234C19	10	 4	10	12	118959037	119130104	119044570
RP11-236B18	10	 5	10	10	 92671344	 92829701	 92750522
RP11-238O13	10	 6	10	01	 36361290	 36400458	 36380874
RP11-241I20	10	 7	10	10	 32303828	 32447252	 32375540
RP11-243J18	10	 8	10	01	152440690	152598904	152519797
RP11-245C23	10	 9	10	03	180313113	180497521	180405317
RP11-265F14_2	10	10	10	01	 15503411	 15683816	 15593613
RP11-268O21	10	11	10	19	  2928774	  3109109	  3018941
RP11-269P11	10	12	10	09	125271843	125401843	125336843
RP11-271B5	10	13	10	13	 21089599	 21256302	 21172950
RP11-272H7	10	14	10	06	 44293941	 44488347	 44391144
RP11-274E20	10	15	10	04	185787018	185958275	185872646
RP11-551G13	10	16	10	12	 44524861	 44765782	 44645321
RP11-556A11	10	17	10	02	187271255	187466890	187369072
RP11-557F22	10	18	10	06	 26151436	 26356080	 26253758
RP11-559F24	10	19	10	02	219778330	219797869	219788099
RP11-563O21	10	20	10	19	 54952625	 55134158	 55043391
RP11-568G13	10	21	10	03	 69057279	 69235815	 69146547
RP11-600P1	10	22	10	13	 78171053	 78368687	 78269870
RP11-604O8	10	23	10	01	 84348586	 84529685	 84439135
RP11-605K11	10	24	10	02	203564064	203748875	203656469
RP11-607H21	10	25	10	20	 31721012	 31897420	 31809216
RP11-609L3	10	 1	11	07	 35648493	 35799373	 35723933
RP11-613F22	10	 2	11	11	 18397599	 18594010	 18495804
RP11-652L8	10	 3	11	11	117260928	117421150	117341039
RP11-655M14	10	 4	11	11	 67125653	 67299727	 67212690
RP11-658K18	10	 5	11	11	  5587857	  5759634	  5673745
RP11-665N17	10	 6	11	11	 64318236	 64490041	 64404138
RP11-667N16	10	 7	11	02	 47787058	 47954222	 47870640
RP11-675F6	10	 8	11	08	 38485748	 38646922	 38566335
RP11-693N9	10	 9	11	11	104180115	104352197	104266156
RP11-700M17	10	10	11	08	 95166013	 95332532	 95249272
RP11-707G14	10	11	11	11	 73136526	 73329491	 73233008
RP11-709C9	10	12	11	11	 48047111	 48247226	 48147168
RP11-715F10	10	13	11	11	 67007468	 67127654	 67067561
RP11-717C3	10	14	11	03	126182030	126244947	126213488
RP11-137A4	10	15	11	02	 37123217	 37271804	 37197510
RP11-139H15	10	16	11	15	 53307467	 53465477	 53386472
RP11-142O6	10	17	11	17	 26429956	 26575104	 26502530
RP11-147A22	10	18	11	07	  4990536	  5166699	  5078617
RP11-148G20	10	19	11	03	 48573898	 48764021	 48668959
RP11-158C21	10	20	11	04	155803019	155989896	155896457
RP11-173P16	10	21	11	13	 30506715	 30684939	 30595827
RP11-179H18	10	22	11	10	121288896	121435474	121362185
RP11-180M15_1	10	23	11	12	 12614232	 12772124	 12693178
RP11-181P4	10	24	11	06	110426362	110579408	110502885
RP11-182N22	10	25	11	09	 35015512	 35215382	 35115447
RP11-186B7	10	 1	12	17	  7308417	  7438417	  7373417
RP11-215I23	10	 2	12	01	176017509	176171446	176094477
RP11-219G17	10	 3	12	17	 73640049	 73849800	 73744924
RP11-223I10	10	 4	12	02	231704591	231907159	231805875
RP11-227H4	10	 5	12	03	 99679185	 99843752	 99761468
RP11-235O14	10	 6	12	09	 74873289	 75026681	 74949985
RP11-240B13	10	 7	12	08	132938482	133107201	133022841
RP11-264C14	10	 8	12	10	  7698344	  7872705	  7785524
RP11-272L14	10	 9	12	13	105883587	105987203	105935395
RP11-277P12	10	10	12	12	 10293339	 10461689	 10377514
RP11-281O15	10	11	12	05	178243599	178455573	178349586
RP11-283I3_1	10	12	12	12	   152512	   329906	   241209
RP11-285G1	10	13	12	10	 44640087	 44862577	 44751332
RP11-753H16	10	14	12	12	 53047788	 53208104	 53127946
RP11-754B14	10	15	12	07	  5326027	  5496766	  5411396
RP11-761B3	10	16	12	02	 47195112	 47376833	 47285972
RP11-778N14	10	17	12	12	 93824388	 93996175	 93910281
RP11-793H13	10	18	12	12	 52130263	 52302820	 52216541
RP11-799A12	10	19	12	04	 99198044	 99391068	 99294556
RP11-18N2	10	20	12	X	114094942	114124582	114109762
RP11-26H10	10	21	12	03	 80133743	 80297147	 80215445
RP11-88N16	10	22	12		NA	NA	NA
RP11-110J12	10	23	12	12	116565013	116726693	116645853
RP11-145L22	10	24	12	06	 29713558	 29767603	 29740580
RP11-259M24	10	25	12	14	 83256945	 83445929	 83351437
RP11-51B4_2	10	13	13		NA	NA	NA
RP11-65I22	10	14	13	01	199232706	199413864	199323285
RP11-70G20	10	15	13	01	200326964	200327254	200327109
RP11-155F3	10	16	13	01	201459681	201641559	201550620
RP11-219P13	10	17	13	01	202446965	202447335	202447150
RP11-145I13	10	18	13	01	203623431	203753431	203688431
RP11-192M1	10	19	13	01	222516399	222516739	222516569
RP11-155C15	10	20	13	01	230927584	231057584	230992584
RP11-194F13	10	21	13	01	238025750	238183502	238104626
RP11-212E22	10	22	13	01	239198599	239198980	239198789
CTD-2010C4	10	23	13	01	 64983382	 65084558	 65033970
CTD-2077L2	10	24	13	01	148077375	148077819	148077597
RP11-79M15	10	25	13	01	157484197	157614197	157549197
RP11-79M12	10	 1	14	01	205759609	205928728	205844168
RP11-79B11	10	 2	14	01	 64575648	 64734034	 64654841
RP11-79H5	10	 3	14	01	212474619	212655606	212565112
RP11-79I13	10	 4	14	01	 81419245	 81565588	 81492416
RP11-80D6_2	10	 5	14	01	161968761	162112834	162040797
RP11-81N17	10	 6	14	01	155159521	155311997	155235759
RP11-88D6	10	 7	14	01	117422762	117631324	117527043
RP11-88F22	10	 8	14	01	 79745835	 79947809	 79846822
RP11-88J24	10	 9	14	01	 37076899	 37251319	 37164109
RP11-88N18	10	10	14	01	228034708	228191242	228112975
RP11-88N24	10	11	14	01	 98665911	 98812494	 98739202
RP11-279L16	10	12	14	03	 15213261	 15387250	 15300255
RP11-208G16	10	13	14	03	 22372628	 22514821	 22443724
RP11-41F5	10	14	14	03	 23709789	 23880449	 23795119
RP11-103N21	10	15	14	03	 29867263	 30018477	 29942870
RP11-209O16	10	16	14	03	 38244229	 38407861	 38326045
RP11-241P3	10	17	14	03	 42284364	 42440027	 42362195
RP11-129B22	10	18	14	03	 64013182	 64184359	 64098770
RP11-146E16	10	19	14	03	 67739513	 67813082	 67776297
RP11-8M11	10	20	14	03	 86131902	 86261902	 86196902
RP11-129G16	10	21	14		NA	NA	NA
RP11-129P2	10	22	14	03	109086950	109087255	109087102
RP11-12P11	10	23	14	03	112745660	112921068	112833364
RP11-162J10	10	24	14	03	138894916	139071591	138983253
RP11-160A13	10	25	14	03	144154808	144312333	144233570
RP11-72E23	10	 1	15	03	146541915	146689401	146615658
RP11-145F16	10	 2	15	03	151508469	151678834	151593651
RP11-80I14	10	 3	15	03	153590898	153735647	153663272
RP11-209H21	10	 4	15	03	160726422	160903111	160814766
RP11-67E18	10	 5	15	03	189918761	190076498	189997629
RP11-53D15	10	 6	15	03	191144810	191252245	191198527
RP11-88M1	10	 7	15	03	193159977	193160310	193160143
RP11-168F7	10	 8	15	19	 48791653	 48964139	 48877896
RP11-57D6	10	 9	15	03	 13144531	 13315049	 13229790
RP11-372E1	10	10	15	03	144017129	144200229	144108679
RP11-81P7	10	11	15	04	161330286	161501950	161416118
RP11-88D10	10	12	15	04	107874806	108081978	107978392
RP11-89A8	10	13	15	04	 52714512	 52724149	 52719330
RP11-89E24	10	14	15	04	129487541	129650256	129568898
RP11-89G2	10	15	15	04	 72535183	 72701544	 72618363
RP11-89I4	10	16	15	04	 35186861	 35342019	 35264440
RP11-89F4	10	17	15	04	 44332225	 44462225	 44397225
RP11-89P23	10	18	15	04	135212129	135378156	135295142
RP11-90E7	10	19	15	04	185184718	185344793	185264755
RP11-90B17	10	20	15	04	171049865	171221242	171135553
RP11-90D5	10	21	15	04	173631500	173785402	173708451
RP11-90I1	10	22	15	04	 34409026	 34525425	 34467225
RP11-91E6	10	23	15	04	 87167643	 87338236	 87252939
RP11-449B1	10	24	15	04	 83882812	 84039142	 83960977
RP11-451M10	10	25	15	04	 91975574	 92125825	 92050699
RP11-81J19	10	 1	16	04	182617864	182783135	182700499
RP11-20B3	10	 2	16	05	  3055342	  3213642	  3134492
RP11-103L11	10	 3	16	05	  3816325	  4002342	  3909333
RP11-88L18_1	10	 4	16	05	 17465419	 17636603	 17551011
RP11-67P13	10	 5	16	05	 32057784	 32223971	 32140877
RP11-4N21	10	 6	16	05	 34798552	 34798925	 34798738
RP11-253B9	10	 7	16	05	 37895157	 37895340	 37895248
RP11-9G14	10	 8	16	05	 41319671	 41319970	 41319820
RP11-17H13	10	 9	16	05	 54163147	 54293147	 54228147
RP11-91E17	10	10	16	06	 55127630	 55281751	 55204690
RP11-91G4	10	11	16	06	 93870299	 94057737	 93964018
RP11-451M16	10	12	16	06	136257241	136387241	136322241
RP11-191P7	10	13	16	07	  2977025	  3125956	  3051490
RP11-96L18	10	14	16	07	  2632601	  2788650	  2710625
RP11-183O1	10	15	16	07	  6275590	  6275791	  6275690
RP11-52E9	10	16	16	07	 27058078	 27188078	 27123078
RP11-93J6	10	17	16	07	 31846265	 32018912	 31932588
RP11-128O3	10	18	16	07	 33418110	 33418458	 33418284
RP11-115G23	10	19	16	07	 34986452	 35140107	 35063279
RP11-87M15	10	20	16	07	 36536763	 36537288	 36537025
RP11-115G1	10	21	16	07	 38526041	 38691652	 38608846
RP11-146C1	10	22	16		NA	NA	NA
RP11-48B18	10	23	16	07	 48391085	 48548556	 48469820
RP11-14K11	10	24	16	07	 54903387	 54903650	 54903518
RP11-251I15	10	25	16	07	 55381621	 55381999	 55381810
RP11-45N18	10	 1	17	07	 61822024	 61983953	 61902988
RP11-214K14	10	 2	17	07	 65867497	 65867687	 65867592
RP11-46O13	10	 3	17	07	 88022288	 88200178	 88111233
RP11-126B8	10	 4	17	07	 92355443	 92485443	 92420443
RP11-32C15	10	 5	17	07	 95259716	 95260053	 95259884
RP11-163M5	10	 6	17	07	101347873	101528379	101438126
RP11-88E13	10	 7	17	07	 69645461	 69645906	 69645683
RP11-61C18	10	 8	17	07	106338795	106492688	106415741
RP11-62H18	10	 9	17	09	  4575558	  4575778	  4575668
RP11-125K10	10	10	17	09	  4819655	  4991841	  4905748
RP11-165O14	10	11	17	09	  5873408	  6029621	  5951514
RP11-32D4	10	12	17	09	 11469224	 11641686	 11555455
RP11-264O11	10	13	17	09	 10578155	 10578494	 10578324
RP11-26K11	10	14	17	09	 11789514	 11789897	 11789705
RP11-118C13	10	15	17	09	 32970169	 33120838	 33045503
RP11-17J8	10	16	17	09	 34511040	 34511447	 34511243
RP11-165H19	10	17	17	09	 34589620	 34758037	 34673828
RP11-61G7	10	18	17	09	 35674485	 35804485	 35739485
RP11-154M9	10	19	17	09	 36204443	 36204779	 36204611
RP11-144L7	10	20	17	09	 38085104	 38225798	 38155451
RP11-8C21_1	10	21	17	09	 88962453	 89168653	 89065553
RP11-23D11	10	22	17	09	 82178610	 82353358	 82265984
RP11-273J10	10	23	17	09	 83848346	 83848436	 83848391
RP11-74F15	10	24	17	09	 83415231	 83560147	 83487689
RP11-65C15	10	25	17	09	 85721751	 85861729	 85791740
RP11-65B23_1	10	 1	18	09	 87484294	 87654534	 87569414
RP11-23B15	10	 2	18	09	 97623553	 97784350	 97703951
RP11-147H22	10	 3	18	09	 98144353	 98144734	 98144543
RP11-69F21	10	 4	18	09	 98798978	 98928978	 98863978
RP11-4B2	10	 5	18	09	 99571379	 99701379	 99636379
RP11-39L9	10	 6	18	09	 99974087	 99974457	 99974272
RP11-30N20	10	 7	18	09	 99647741	 99816466	 99732103
RP11-209M9	10	 8	18	11	  4180209	  4180458	  4180333
RP11-98L18	10	 9	18	11	  6105391	  6266570	  6185980
RP11-205O15	10	10	18	11	  7248586	  7248926	  7248756
RP11-133H19	10	11	18	11	  8555485	  8732332	  8643908
RP11-170F20	10	12	18	11	 10526429	 10673773	 10600101
RP11-245K9	10	13	18	11	 12678356	 12808356	 12743356
RP11-56J22	10	14	18	11	 20180423	 20332556	 20256489
RP11-11A11	10	15	18	11	 19946712	 20110972	 20028842
RP11-15A11	10	16	18	11	 23931119	 23931493	 23931306
RP11-203L7	10	17	18	11	 26538836	 26539000	 26538918
RP11-236N9	10	18	18	11	 29442650	 29613211	 29527930
RP11-215F2	10	19	18	11	 31319852	 31320152	 31320002
RP11-150D18	10	20	18	11	 41858281	 42020207	 41939244
RP11-18D13	10	21	18		NA	NA	NA
RP11-102E22_1	10	22	18	11	 44098955	 44271172	 44185063
RP11-12C11	10	23	18	11	 44879165	 45046162	 44962663
RP11-39G12	10	24	18	11	 46582997	 46737312	 46660154
RP11-85A19	10	25	18	11	 48091012	 48108920	 48099966
RP11-120P20	10	 1	19	11	 70080722	 70081006	 70080864
RP11-51M9	10	 2	19	11	 71935340	 72065340	 72000340
RP11-102M18	10	 3	19	11	 73288761	 73452999	 73370880
RP11-168B13	10	 4	19	11	 74766492	 74942321	 74854406
RP11-119C13	10	 5	19	11	 75575032	 75575280	 75575156
RP11-7H7	10	 6	19	11	 78034239	 78206821	 78120530
RP11-64C21	10	 7	19	13	 30138151	 30268151	 30203151
RP11-14A4	10	 8	19	13	 38973232	 39103232	 39038232
RP11-9F13	10	 9	19	13	 40663949	 40806646	 40735297
RP11-13I8	10	10	19	13	 41402235	 41593291	 41497763
RP11-34K15	10	11	19	13	 42360122	 42360372	 42360247
RP11-217H23	10	12	19	13	 44755696	 44756096	 44755896
RP11-31C6	10	13	19	13	 72628310	 72628651	 72628480
RP11-9P22	10	14	19	13	 73620422	 73769921	 73695171
RP11-79I4_1	10	15	19	13	 73284060	 73462828	 73373444
RP11-137M6	10	16	19	13	 76931003	 77124101	 77027552
RP11-93G2	10	17	19	13	 77899012	 78086670	 77992841
RP11-51C8	10	18	19	13	 86679274	 86841507	 86760390
RP11-200I17	10	19	19	13	105334288	105334666	105334477
RP11-233E7	10	20	19	13	108485598	108485984	108485791
RP11-61I17	10	21	19	13	108838301	108968301	108903301
RP11-3P8	10	22	19	13	111758242	111949607	111853924
RP11-420H1	10	23	19	13	 24251124	 24440032	 24345578
CTD-2052F6	10	24	19	13	 25738287	 25885040	 25811663
RP11-88F2	10	25	19	13	 22746386	 22936999	 22841692
RP11-89A14	10	 1	20	13	 82411998	 82577009	 82494503
RP11-89L15	10	 2	20	13	 39910849	 40070543	 39990696
RP11-89P22	10	 3	20	13	 27585553	 27715553	 27650553
RP11-90F5	10	 4	20	13	 34362633	 34512960	 34437796
RP11-90M5	10	 5	20	13	 29310415	 29471953	 29391184
RP11-110L8	10	 6	20	16	 82189776	 82384326	 82287051
RP11-254F19	10	 7	20	16	 83357020	 83531734	 83444377
RP11-122P17	10	 8	20	16	 84512389	 84688206	 84600297
RP11-118F19	10	 9	20	16	 84123856	 84279987	 84201921
RP11-95P2_1	10	10	20	16	  4114616	  4289638	  4202127
RP11-250E14_1	10	11	20	16	 55893719	 56094253	 55993986
RP11-81L19	10	12	20	16	 15519957	 15681446	 15600701
RP11-81P17	10	13	20	16	 60052285	 60182285	 60117285
RP11-89G14	10	14	20	16	 59894531	 60054888	 59974709
RP11-89K4	10	15	20	16	 72163705	 72328913	 72246309
RP11-89D3	10	16	20	16	 10159016	 10336338	 10247677
RP11-89L6	10	17	20	16	 75563743	 75693743	 75628743
CTA-991H5	10	18	20	16	 16553896	 16662152	 16608024
RP11-212I21_1	10	19	20	16	 53975963	 54169922	 54072942
RP11-283C7	10	20	20	16	 45502831	 45688112	 45595471
RP11-327F22	10	21	20	16	 49274146	 49442417	 49358281
RP11-381L15	10	22	20	16	 50687676	 50856510	 50772093
RP11-452G23	10	23	20	16	 47238885	 47397792	 47318338
RP11-89A15	10	24	20	17	  8199740	  8365794	  8282767
RP11-100L12	10	25	20	17	 25530227	 25708593	 25619410
RP11-252N11	10	 1	21	17	 30441739	 30442082	 30441910
RP11-268H17	10	 2	21	17	 36278241	 36442072	 36360156
RP11-87N6	10	 3	21	17	 35559232	 35692479	 35625855
RP11-29C11	10	 4	21	17	 36749371	 36924021	 36836696
RP11-53K11_1	10	 5	21	21	 25756854	 25925353	 25841103
RP11-53K11_2	10	 6	21	21	 25756854	 25925353	 25841103
RP11-115H17	10	 7	21	21	 27020424	 27162298	 27091361
RP11-83L17	10	 8	21	21	 26922995	 26923374	 26923184
RP11-30N6	10	 9	21	21	 29708169	 29838169	 29773169
RP11-74D19	10	10	21	21	 28596969	 28756595	 28676782
RP11-12N9	10	11	21	21	 36748728	 36749069	 36748898
RP11-78B20	10	12	21	21	 38370733	 38371157	 38370945
RP11-1P3	10	13	21	21	 40165171	 40295171	 40230171
RP11-120C17	10	14	21	21	 41630602	 41780323	 41705462
RP11-549G7	10	15	21	21	 43679361	 43891061	 43785211
CTD-2096F11	10	16	21	21	 33731276	 33731512	 33731394
RP11-91N21	10	17	21	21	 14886780	 15043867	 14965323
RP11-172D7	10	18	21	22	 16233834	 16234198	 16234016
RP11-22M5_1	10	19	21	22	 20564314	 20719548	 20641931
RP11-76E8	10	20	21	22	 22795270	 22989794	 22892532
RP11-29I20	10	21	21	22	 24821525	 24951525	 24886525
RP11-26I11	10	22	21	22	 26007486	 26007856	 26007671
RP11-116K16	10	23	21	22	 42303034	 42433034	 42368034
RP11-61L22	10	24	21	22	 43957911	 44087911	 44022911
RP11-133P21	10	25	21	22	 47722916	 47723246	 47723081
RP11-278E23_1	10	 1	22	22	 19862623	 19958793	 19910708
RP11-79G21	10	 2	22	22	 26493946	 26651940	 26572943
RP11-79B21	10	 3	22	22	 33758267	 33933259	 33845763
RP11-181G12	10	 4	22	01	  2104648	  2284571	  2194609
RP11-188P17	10	 5	22	04	184147521	184277395	184212458
RP11-190I11	10	 6	22	01	 65038286	 65038610	 65038448
RP11-194A15	10	 7	22	03	157875443	158057574	157966508
RP11-195E2	10	 8	22	05	 70234597	 70425468	 70330032
RP11-196B3	10	 9	22	18	 75261844	 75424109	 75342976
RP11-208C17	10	10	22	10	 96678460	 96821641	 96750050
RP11-210L7	10	11	22	12	101290820	101460824	101375822
RP11-212I21_2	10	12	22	16	 53975963	 54169922	 54072942
RP11-214A4	10	13	22	02	162963643	163059060	163011351
RP11-215G15	10	14	22	05	 10644704	 10824782	 10734743
RP11-215H5	10	15	22	18	 38185369	 38323522	 38254445
RP11-234C19	10	16	22	12	118959037	119130104	119044570
RP11-236B18	10	17	22	10	 92671344	 92829701	 92750522
RP11-238O13	10	18	22	01	 36361290	 36400458	 36380874
RP11-241I20	10	19	22	10	 32303828	 32447252	 32375540
RP11-243J18	10	20	22	01	152440690	152598904	152519797
RP11-245C23	10	21	22	03	180313113	180497521	180405317
RP11-265F14_2	10	22	22	01	 15503411	 15683816	 15593613
RP11-268O21	10	23	22	19	  2928774	  3109109	  3018941
RP11-269P11	10	24	22	09	125271843	125401843	125336843
RP11-271B5	10	25	22	13	 21089599	 21256302	 21172950
RP11-272H7	10	 1	23	06	 44293941	 44488347	 44391144
RP11-274E20	10	 2	23	04	185787018	185958275	185872646
RP11-551G13	10	 3	23	12	 44524861	 44765782	 44645321
RP11-556A11	10	 4	23	02	187271255	187466890	187369072
RP11-557F22	10	 5	23	06	 26151436	 26356080	 26253758
RP11-559F24	10	 6	23	02	219778330	219797869	219788099
RP11-563O21	10	 7	23	19	 54952625	 55134158	 55043391
RP11-568G13	10	 8	23	03	 69057279	 69235815	 69146547
RP11-600P1	10	 9	23	13	 78171053	 78368687	 78269870
RP11-604O8	10	10	23	01	 84348586	 84529685	 84439135
RP11-605K11	10	11	23	02	203564064	203748875	203656469
RP11-607H21	10	12	23	20	 31721012	 31897420	 31809216
RP11-609L3	10	13	23	07	 35648493	 35799373	 35723933
RP11-613F22	10	14	23	11	 18397599	 18594010	 18495804
RP11-652L8	10	15	23	11	117260928	117421150	117341039
RP11-655M14	10	16	23	11	 67125653	 67299727	 67212690
RP11-658K18	10	17	23	11	  5587857	  5759634	  5673745
RP11-665N17	10	18	23	11	 64318236	 64490041	 64404138
RP11-667N16	10	19	23	02	 47787058	 47954222	 47870640
RP11-675F6	10	20	23	08	 38485748	 38646922	 38566335
RP11-693N9	10	21	23	11	104180115	104352197	104266156
RP11-700M17	10	22	23	08	 95166013	 95332532	 95249272
RP11-707G14	10	23	23	11	 73136526	 73329491	 73233008
RP11-709C9	10	24	23	11	 48047111	 48247226	 48147168
RP11-715F10	10	25	23	11	 67007468	 67127654	 67067561
RP11-717C3	10	 1	24	03	126182030	126244947	126213488
RP11-137A4	10	 2	24	02	 37123217	 37271804	 37197510
RP11-139H15	10	 3	24	15	 53307467	 53465477	 53386472
RP11-142O6	10	 4	24	17	 26429956	 26575104	 26502530
RP11-147A22	10	 5	24	07	  4990536	  5166699	  5078617
RP11-148G20	10	 6	24	03	 48573898	 48764021	 48668959
RP11-158C21	10	 7	24	04	155803019	155989896	155896457
RP11-173P16	10	 8	24	13	 30506715	 30684939	 30595827
RP11-179H18	10	 9	24	10	121288896	121435474	121362185
RP11-180M15_1	10	10	24	12	 12614232	 12772124	 12693178
RP11-181P4	10	11	24	06	110426362	110579408	110502885
RP11-182N22	10	12	24	09	 35015512	 35215382	 35115447
RP11-186B7	10	13	24	17	  7308417	  7438417	  7373417
RP11-215I23	10	14	24	01	176017509	176171446	176094477
RP11-219G17	10	15	24	17	 73640049	 73849800	 73744924
RP11-223I10	10	16	24	02	231704591	231907159	231805875
RP11-227H4	10	17	24	03	 99679185	 99843752	 99761468
RP11-235O14	10	18	24	09	 74873289	 75026681	 74949985
RP11-240B13	10	19	24	08	132938482	133107201	133022841
RP11-264C14	10	20	24	10	  7698344	  7872705	  7785524
RP11-272L14	10	21	24	13	105883587	105987203	105935395
RP11-277P12	10	22	24	12	 10293339	 10461689	 10377514
RP11-281O15	10	23	24	05	178243599	178455573	178349586
RP11-283I3_1	10	24	24	12	   152512	   329906	   241209
RP11-285G1	10	25	24	10	 44640087	 44862577	 44751332
RP11-753H16	10	 1	25	12	 53047788	 53208104	 53127946
RP11-754B14	10	 2	25	07	  5326027	  5496766	  5411396
RP11-761B3	10	 3	25	02	 47195112	 47376833	 47285972
RP11-778N14	10	 4	25	12	 93824388	 93996175	 93910281
RP11-793H13	10	 5	25	12	 52130263	 52302820	 52216541
RP11-799A12	10	 6	25	04	 99198044	 99391068	 99294556
RP11-18N2	10	 7	25	X	114094942	114124582	114109762
RP11-26H10	10	 8	25	03	 80133743	 80297147	 80215445
RP11-88N16	10	 9	25		NA	NA	NA
RP11-110J12	10	10	25	12	116565013	116726693	116645853
RP11-145L22	10	11	25	06	 29713558	 29767603	 29740580
RP11-259M24	10	12	25	14	 83256945	 83445929	 83351437
RP11-155L18	11	 1	 1	01	 20304843	 20434843	 20369843
RP11-277F18	11	 2	 1	01	 22562310	 22749411	 22655860
RP11-72I19	11	 3	 1	01	 23109720	 23287172	 23198446
RP11-276L11	11	 4	 1	01	 30388849	 30389230	 30389039
RP11-62B23	11	 5	 1	01	 30519235	 30649235	 30584235
RP11-4P6	11	 6	 1	01	 33046725	 33204421	 33125573
RP11-149K24	11	 7	 1	01	 57320110	 57320375	 57320242
RP11-8F24	11	 8	 1	01	 60993913	 60994113	 60994013
RP11-248I3	11	 9	 1		NA	NA	NA
RP11-30A5	11	10	 1	01	 63401568	 63531568	 63466568
RP11-265C4	11	11	 1	01	 64049994	 64198973	 64124483
RP11-111N18	11	12	 1	01	 69433720	 69575379	 69504549
RP11-138K16	11	13	 1	01	 99667772	 99843751	 99755761
RP11-178M11	11	14	 1	01	101684496	101684865	101684680
RP11-162H15	11	15	 1	01	106421423	106560920	106491171
RP11-96F24	11	16	 1	01	109973081	110151510	110062295
RP11-150K20	11	17	 1	01	111044322	111205648	111124985
RP11-82A16	11	18	 1	01	112219915	112220230	112220072
RP11-260G23	11	19	 1	01	159178134	159331152	159254643
RP11-193J5	11	20	 1	01	162784902	162785232	162785067
RP11-28D10	11	21	 1	01	164324300	164454300	164389300
RP11-249C5	11	22	 1	01	164824307	164824712	164824509
RP11-184N12	11	23	 1	01	166889029	167056094	166972561
RP11-125J13	11	24	 1	01	169637429	169805885	169721657
RP11-91K13	11	25	 1	02	131025992	131320216	131173104
RP11-91K6	11	 1	 2	02	159678005	159832799	159755402
RP11-91O12	11	 2	 2	02	 73088319	 73255185	 73171752
RP11-91A11	11	 3	 2	02	133584201	133739907	133662054
RP11-91E15	11	 4	 2	02	 69082423	 69271255	 69176839
RP11-91G19	11	 5	 2	02	 69977981	 70137152	 70057566
RP11-128C5_2	11	 6	 2	02	 43985633	 43985897	 43985765
RP11-180L21_2	11	 7	 2	02	 46177272	 46177583	 46177427
RP11-24P23_2	11	 8	 2	02	 70462962	 70623458	 70543210
RP11-63D13_2	11	 9	 2	02	 79619418	 79762286	 79690852
RP11-82B19_2	11	10	 2	02	 84900386	 84900641	 84900513
RP11-67L23_2	11	11	 2	02	 96627590	 96757590	 96692590
RP11-191I9_2	11	12	 2	02	156108565	156109000	156108782
RP11-61N23_2	11	13	 2	02	175281795	175282056	175281925
RP11-96M11	11	14	 2	02	179450883	179482120	179466501
RP11-38I11_2	11	15	 2	02	184317488	184317887	184317687
RP11-34N13_2	11	16	 2	02	198715379	198845379	198780379
RP11-47E6_2	11	17	 2	02	204397712	204575312	204486512
RP11-451C8	11	18	 2	02	 83095789	 83254069	 83174929
RP11-451M22	11	19	 2	02	 64734303	 64918588	 64826445
RP11-451A14	11	20	 2	02	 15798209	 15928209	 15863209
RP11-451E4	11	21	 2	02	100295246	100425246	100360246
RP11-451C14	11	22	 2	02	138329641	138533805	138431723
RP11-451C18	11	23	 2	02	221744142	221916798	221830470
RP11-89E4_1	11	24	 2	04	145582167	145748010	145665088
RP11-47P10	11	25	 2	04	145330818	145495070	145412944
RP11-33C6	11	 1	 3		NA	NA	NA
RP11-134L22	11	 2	 3	04	146884125	147014125	146949125
RP11-49P16	11	 3	 3	04	150348945	150478945	150413945
RP11-218A2	11	 4	 3	04	152400149	152400483	152400316
RP11-1G8	11	 5	 3	04	163605968	163749619	163677793
RP11-177L7	11	 6	 3	04	165185104	165341069	165263086
RP11-199O10	11	 7	 3	04	169100496	169100838	169100667
RP11-6L19	11	 8	 3	04	167293160	167453527	167373343
RP11-6E9	11	 9	 3	04	171219033	171415890	171317461
RP11-119J20_1	11	10	 3	04	173378777	173548334	173463555
RP11-18D7	11	11	 3	04	183933464	184117496	184025480
RP11-275J17	11	12	 3	04	184972211	185102211	185037211
RP11-243D3	11	13	 3	04	185221070	185375437	185298253
RP11-267E24	11	14	 3	04	185876219	186006219	185941219
RP11-132F21	11	15	 3	04	185994397	185994820	185994608
RP11-280G1	11	16	 3	04	185610965	185752832	185681898
RP11-79E3	11	17	 3	04	 33696677	 33859048	 33777862
RP11-79G9	11	18	 3	04	 12411625	 12578258	 12494941
RP11-79E2_2	11	19	 3	04	143001495	143146137	143073816
RP11-79G20	11	20	 3	04	180819690	180966035	180892862
RP11-79K2	11	21	 3	04	178561002	178721484	178641243
RP11-79K18	11	22	 3	04	126712275	126856903	126784589
RP11-13I21	11	23	 3	06	 91241345	 91383425	 91312385
RP11-14G17	11	24	 3	06	 99734285	 99913830	 99824057
RP11-73D20	11	25	 3	06	102542632	102542998	102542815
RP11-47E20	11	 1	 4	06	105621318	105794428	105707873
RP11-78P9	11	 2	 4	06	108616091	108616467	108616279
RP11-75C8	11	 3	 4	06	112067211	112263337	112165274
RP11-195B12	11	 4	 4	06	136323912	136324217	136324064
RP11-15H7	11	 5	 4	06	139955508	140131794	140043651
RP11-20H19	11	 6	 4	06	155272596	155434808	155353702
RP11-438N24	11	 7	 4	06	104583108	104745862	104664485
CTD-2018P8	11	 8	 4	06	 20601182	 20601453	 20601317
CTD-2090G18	11	 9	 4	06	 87777456	 87907456	 87842456
RP11-79K22	11	10	 4	06	101736584	101908759	101822671
RP11-79O12	11	11	 4	06	102177867	102358166	102268016
RP11-79B1	11	12	 4	06	 86778402	 86937047	 86857724
RP11-79F1	11	13	 4	06	135117337	135274819	135196078
RP11-79F21	11	14	 4	06	 64312112	 64486010	 64399061
RP11-79J5	11	15	 4	06	 41062439	 41210987	 41136713
RP11-89A10	11	16	 4	06	141814614	141971532	141893073
RP11-89F9	11	17	 4	06	141642604	141781814	141712209
RP11-89L9	11	18	 4	06	  9459201	  9618037	  9538619
RP11-90G9	11	19	 4	06	 72512820	 72664349	 72588584
RP11-90I11	11	20	 4	06	 14859323	 15059927	 14959625
RP11-90K21	11	21	 4	06	123314080	123465414	123389747
RP11-102K7	11	22	 4	08	101238454	101417646	101328050
RP11-208E21	11	23	 4	08	100717687	100858319	100788003
RP11-136H10	11	24	 4	08	100284005	100437840	100360922
RP11-282M7	11	25	 4	08	 99970445	100136669	100053557
RP11-131D12	11	 1	 5	08	 99314606	 99314869	 99314737
RP11-158K1	11	 2	 5	08	125497282	125691169	125594225
RP11-28A4	11	 3	 5	08	136762748	136934682	136848715
RP11-13A18	11	 4	 5	08	141605928	141777031	141691479
RP11-54D13	11	 5	 5	08	 88630985	 88771884	 88701434
CTD-2066E12	11	 6	 5	08	 68117869	 68137116	 68127492
RP11-79C21	11	 7	 5	08	109472957	109652275	109562616
RP11-79E11	11	 8	 5	08	  9289501	  9451740	  9370620
RP11-80P18	11	 9	 5	08	 88151299	 88318399	 88234849
RP11-88J8	11	10	 5	08	 90469149	 90644613	 90556881
RP11-88J18	11	11	 5	08	122259232	122437881	122348556
RP11-89A4	11	12	 5	08	 42696310	 42850493	 42773401
RP11-89I12	11	13	 5	08	  4386744	  4564671	  4475707
RP11-89I16	11	14	 5	08	114955242	115140930	115048086
RP11-90F1	11	15	 5	08	 85831874	 86005081	 85918477
RP11-90M13	11	16	 5	08	 25874705	 26038850	 25956777
RP11-90O17	11	17	 5	08	 12687916	 12856436	 12772176
RP11-90N3	11	18	 5	08	 96904502	 97062457	 96983479
RP11-91F1	11	19	 5	08	110307590	110437590	110372590
RP11-91P13	11	20	 5	08	 33915030	 34077419	 33996224
RP11-32I9	11	21	 5	10	116212556	116212972	116212764
RP11-77E11	11	22	 5	10	120822705	120979467	120901086
RP11-240L14	11	23	 5	10	122188365	122352809	122270587
RP11-7P17	11	24	 5	10	123070046	123245773	123157909
RP11-262E19	11	25	 5	10	123952623	124082623	124017623
RP11-101I20	11	 1	 6	10	124690744	124859327	124775035
RP11-131C15	11	 2	 6		NA	NA	NA
RP11-342M3_1	11	 3	 6	10	 80780233	 80947467	 80863850
RP11-469M11	11	 4	 6	10	110887891	111047380	110967635
CTD-2126J18	11	 5	 6	10	 27042399	 27152224	 27097311
CTD-2165L8	11	 6	 6	10	 17215871	 17372043	 17293957
RP11-79K19	11	 7	 6	10	 33372796	 33522133	 33447464
RP11-80J24	11	 8	 6	10	 95781325	 95935762	 95858543
RP11-81N3	11	 9	 6	10	133056449	133186449	133121449
RP11-88B18	11	10	 6	10	 56628164	 56781399	 56704781
RP11-89C18	11	11	 6	10	113462434	113635836	113549135
RP11-89I20	11	12	 6	10	 27721835	 27873150	 27797492
RP11-89B19	11	13	 6	10	  1170730	  1340862	  1255796
RP11-90M21	11	14	 6	10	  6834859	  7015807	  6925333
RP11-90O5	11	15	 6	10	 78733509	 78899962	 78816735
RP11-90O13	11	16	 6	10	131417897	131588229	131503063
RP11-90J7	11	17	 6	10	 79687949	 79845027	 79766488
RP11-91D9	11	18	 6	10	 19497794	 19663829	 19580811
RP11-91H19	11	19	 6	10	 58218257	 58359946	 58289101
RP11-166E4	11	20	 6	12	 91954351	 92087007	 92020679
RP11-74K11	11	21	 6	12	 93024470	 93178678	 93101574
RP11-31A19	11	22	 6	12	 93918138	 93918475	 93918306
RP11-69E3	11	23	 6	12	 94705537	 94870907	 94788222
RP11-89E9	11	24	 6	12	 97222144	 97411481	 97316812
RP11-18F1	11	25	 6	12	 99970407	 99970789	 99970598
RP11-89J2_1	11	 1	 7	12	124562362	124692362	124627362
RP11-284P8	11	 2	 7	12	125741190	125741461	125741325
RP11-81G12	11	 3	 7	12	128926116	129063553	128994834
RP11-1K22	11	 4	 7	12	129607064	129797867	129702465
CTD-2101J13	11	 5	 7	12	 87393181	 87393365	 87393273
RP11-79O1	11	 6	 7	12	 50207143	 50337143	 50272143
RP11-88L2	11	 7	 7	12	 42459838	 42629204	 42544521
RP11-88P4	11	 8	 7	12	 33359943	 33534861	 33447402
RP11-89F23	11	 9	 7	12	129778789	129908789	129843789
RP11-89F16	11	10	 7	12	 90601229	 90731229	 90666229
RP11-89J2_2	11	11	 7	12	124562362	124692362	124627362
RP11-90C1	11	12	 7	12	 77197759	 77385627	 77291693
RP11-91H3	11	13	 7	12	 60829047	 60959047	 60894047
RP11-91I15	11	14	 7	12	 54483331	 54649134	 54566232
RP11-91K23	11	15	 7	12	 65798395	 65964115	 65881255
RP11-91M8	11	16	 7	12	101657517	101821925	101739721
RP11-91A7	11	17	 7	12	 42552198	 42739501	 42645849
RP11-548L8	11	18	 7	12	 53730294	 53914928	 53822611
RP11-368G21	11	19	 7	15	 67059839	 67275206	 67167522
RP11-38E12	11	20	 7		NA	NA	NA
RP11-355D13_1	11	21	 7	15	 41409157	 41591921	 41500539
RP11-548M13	11	22	 7	15	 53037813	 53208562	 53123187
RP11-79A5	11	23	 7	15	 35776623	 35953471	 35865047
RP11-79C5	11	24	 7	15	 49086923	 49233958	 49160440
RP11-88J10_2	11	25	 7	15	 41591918	 41763430	 41677674
RP11-89A6	11	 1	 8	15	 54383554	 54539006	 54461280
RP11-89L21	11	 2	 8	15	 69990760	 70141861	 70066310
RP11-90E5	11	 3	 8	15	 98388044	 98574562	 98481303
RP11-90J19	11	 4	 8	15	 45134880	 45309881	 45222380
RP11-91M4	11	 5	 8	15	 77596131	 77748701	 77672416
RP11-181O4	11	 6	 8	16	 20353494	 20353732	 20353613
RP11-50D22	11	 7	 8	06	 69029499	 69159499	 69094499
RP11-146J7	11	 8	 8	16	 25650664	 25795346	 25723005
RP11-18H23	11	 9	 8	16	 31274024	 31443695	 31358859
RP11-48I18	11	10	 8	16	 48293522	 48469772	 48381647
RP11-131K14	11	11	 8	16	 50798278	 50798428	 50798353
RP11-154N7	11	12	 8	16	 64952312	 65082312	 65017312
RP11-5A19_1	11	13	 8	16	 65622599	 65775720	 65699159
RP11-84C4	11	14	 8	16	 66892476	 66892806	 66892641
RP11-224E17_1	11	15	 8	16	 67375999	 67426927	 67401463
RP11-123C5	11	16	 8	16	 67553298	 67731554	 67642426
RP11-58M3	11	17	 8	16	 70170264	 70355260	 70262762
RP11-48M7	11	18	 8	20	  3728265	  3902382	  3815323
RP11-149O7	11	19	 8	20	  5465912	  5595912	  5530912
RP11-238D15	11	20	 8	02	190314258	190444258	190379258
RP11-24K4	11	21	 8	20	  9164289	  9312641	  9238465
RP11-32O9	11	22	 8	20	  8743007	  8743320	  8743163
RP11-60N17	11	23	 8	20	 11023799	 11191742	 11107770
RP11-57G7	11	24	 8	20	 30429538	 30429884	 30429711
RP11-47O20	11	25	 8	20	 30429538	 30566288	 30497913
RP11-134I8	11	 1	 9	20	 29972561	 30102561	 30037561
RP11-71N16	11	 2	 9	20	 37083840	 37213840	 37148840
RP11-93L19	11	 3	 9	20	 38878781	 39008781	 38943781
RP11-13F12	11	 4	 9	20	 40315314	 40445314	 40380314
RP11-24K24	11	 5	 9	20	 49418206	 49548206	 49483206
RP11-55E1	11	 6	 9	20	 51802067	 51966817	 51884442
RP11-195N11	11	 7	 9	20	 53178485	 53308485	 53243485
RP11-1E23	11	 8	 9	20	 57140427	 57304494	 57222460
RP11-149I18	11	 9	 9	20	 13199231	 13283353	 13241292
CTD-2018E1	11	10	 9	X	 84925466	 84925779	 84925622
RP11-90H19	11	11	 9	20	 25471326	 25618069	 25544697
RP11-91I9	11	12	 9	20	  2990246	  3155302	  3072774
RP11-91M17	11	13	 9	20	 19340878	 19509811	 19425344
RP11-91I2	11	14	 9	20	  9893326	 10048573	  9970949
RP11-451C16	11	15	 9	20	 48390166	 48520166	 48455166
RP11-451O14	11	16	 9	20	 23976875	 24178609	 24077742
RP11-84M3	11	17	 9	02	192041778	192234795	192138286
RP11-87N3	11	18	 9	17	 59891221	 60079774	 59985497
RP11-89M8_3	11	19	 9	08	 22779033	 22949883	 22864458
RP11-90P5_2	11	20	 9	08	 38091018	 38226422	 38158720
RP11-92H22	11	21	 9	04	 72025504	 72179921	 72102712
RP11-92M7	11	22	 9	05	 52909242	 53065347	 52987294
RP11-101H7	11	23	 9	03	193209175	193376535	193292855
RP11-104G23	11	24	 9	17	 12002245	 12132245	 12067245
RP11-105B9	11	25	 9	07	 44464064	 44642832	 44553448
RP11-108K14	11	 1	10	10	135117744	135279389	135198566
RP11-113O24	11	 2	10	09	 38261088	 38427295	 38344191
RP11-115J22	11	 3	10	09	108746381	108934521	108840451
RP11-127K18	11	 4	10	02	 98488208	 98691151	 98589679
RP11-131E5	11	 5	10	01	202409146	202539071	202474108
RP11-134A8	11	 6	10	10	 35429884	 35559884	 35494884
RP11-135A1	11	 7	10	03	195222716	195374989	195298852
RP11-137A12	11	 8	10	01	157885413	158056445	157970929
RP11-138P20	11	 9	10	05	  7879719	  8039222	  7959470
RP11-152H18	11	10	10	11	  8634956	  8795697	  8715326
RP11-152P23	11	11	10	16	  8777492	  8958381	  8867936
RP11-154J22	11	12	10	15	 46296330	 46451070	 46373700
RP11-155P18	11	13	10	02	201875762	202057369	201966565
RP11-165D7	11	14	10	13	 47960546	 48117394	 48038970
RP11-167I10	11	15	10	06	123463902	123639710	123551806
RP11-458N5	11	16	10	02	 25347012	 25544664	 25445838
RP11-459K13	11	17	10	01	 59929893	 60117072	 60023482
RP11-461A8	11	18	10	16	  3532260	  3723074	  3627667
RP11-462D19	11	19	10	07	 39746780	 39934865	 39840822
RP11-463M3	11	20	10	13	 20781179	 20826976	 20804077
RP11-465L10	11	21	10	20	 43969087	 44142010	 44055548
RP11-480I12	11	22	10	01	199439615	199641470	199540542
RP11-484I6	11	23	10	13	102165632	102337684	102251658
RP11-486I11	11	24	10	16	 11727456	 11875890	 11801673
RP11-489K22	11	25	10	02	 43774513	 43960604	 43867558
RP11-490H24	11	 1	11	12	102819671	102991992	102905831
RP11-492M19	11	 2	11	01	 26522950	 26651292	 26587121
RP11-502P18	11	 3	11	13	 27704423	 27868943	 27786683
RP11-506L7	11	 4	11	07	 76168056	 76202143	 76185099
RP11-507K13	11	 5	11	10	 50500475	 50698877	 50599676
RP11-510J16	11	 6	11	16	 80512566	 80689866	 80601216
RP11-513I15	11	 7	11	06	 34208416	 34360244	 34284330
RP11-514P19	11	 8	11	16	 46203946	 46405307	 46304626
RP11-528G1	11	 9	11	01	157222200	157397586	157309893
RP11-532F12	11	10	11	15	 38766144	 38944390	 38855267
RP11-533J15	11	11	11	12	 49503684	 49560230	 49531957
RP11-534J17	11	12	11	02	234110807	234218418	234164612
RP11-535P8	11	13	11	15	 83685710	 83883622	 83784666
RP11-539D10	11	14	11	Y	 25325838	 25501828	 25413833
RP11-29P18	11	15	11	04	151456997	151632669	151544833
RP11-30A1	11	16	11	09	 84664561	 84788727	 84726644
RP11-31I10	11	17	11	16	  1752991	  1918786	  1835888
RP11-33O4	11	18	11	02	219610589	219780330	219695459
RP11-35B4	11	19	11		NA	NA	NA
RP11-36D19	11	20	11	10	 81994355	 82165503	 82079929
RP11-54L6	11	21	11	03	 18424762	 18603556	 18514159
RP11-58H15	11	22	11	04	144621038	144805161	144713099
RP11-60L3	11	23	11	15	 72255859	 72417365	 72336612
RP11-62C3	11	24	11	09	 92007008	 92200512	 92103760
RP11-64D24	11	25	11	11	113582166	113746962	113664564
RP11-66A14_1	11	 1	12	04	122831999	123020921	122926460
RP11-82H13	11	 2	12	01	 84306742	 84437620	 84372181
RP11-85E16	11	 3	12	07	 36543036	 36718248	 36630642
RP11-86H7	11	 4	12	01	 94692287	 94892713	 94792500
RP11-87N22	11	 5	12	11	112570855	112764135	112667495
RP11-90L1_2	11	 6	12	13	109936817	110114209	110025513
RP11-92H16	11	 7	12	12	 21633746	 21784757	 21709251
RP11-107O13	11	 8	12	03	 45472443	 45635059	 45553751
RP11-110K8	11	 9	12	13	 20982685	 21161844	 21072264
RP11-111L24	11	10	12	13	 97843997	 97950575	 97897286
RP11-112O24	11	11	12	03	139818740	139995217	139906978
RP11-115L11	11	12	12	04	 15299108	 15414620	 15356864
RP11-117L6	11	13	12	05	170679526	170854644	170767085
RP11-707M3	11	14	12	08	 66675183	 66877203	 66776193
RP11-712B9	11	15	12	11	 94492266	 94665707	 94578986
RP11-714M16	11	16	12	10	121088268	121281908	121185088
RP11-726L11	11	17	12	18	 31453697	 31650397	 31552047
RP11-750H9	11	18	12	11	 47353655	 47556194	 47454924
RP11-752L20	11	19	12	04	148727873	148892793	148810333
RP1-3K23	11	20	12	07	158402708	158620885	158511796
RP1-26N8	11	21	12	11	130996205	130996287	130996246
P1-85A10	11	22	12		NA	NA	NA
RP1-191P24	11	23	12	16	 88612329	 88612553	 88612441
RP1-81F12	11	24	12	20	 62230424	 62392948	 62311686
RP11-17K17	11	25	12	X	 50860186	 51038128	 50949157
RP11-155L18	11	13	13	01	 20304843	 20434843	 20369843
RP11-277F18	11	14	13	01	 22562310	 22749411	 22655860
RP11-72I19	11	15	13	01	 23109720	 23287172	 23198446
RP11-276L11	11	16	13	01	 30388849	 30389230	 30389039
RP11-62B23	11	17	13	01	 30519235	 30649235	 30584235
RP11-4P6	11	18	13	01	 33046725	 33204421	 33125573
RP11-149K24	11	19	13	01	 57320110	 57320375	 57320242
RP11-8F24	11	20	13	01	 60993913	 60994113	 60994013
RP11-248I3	11	21	13		NA	NA	NA
RP11-30A5	11	22	13	01	 63401568	 63531568	 63466568
RP11-265C4	11	23	13	01	 64049994	 64198973	 64124483
RP11-111N18	11	24	13	01	 69433720	 69575379	 69504549
RP11-138K16	11	25	13	01	 99667772	 99843751	 99755761
RP11-178M11	11	 1	14	01	101684496	101684865	101684680
RP11-162H15	11	 2	14	01	106421423	106560920	106491171
RP11-96F24	11	 3	14	01	109973081	110151510	110062295
RP11-150K20	11	 4	14	01	111044322	111205648	111124985
RP11-82A16	11	 5	14	01	112219915	112220230	112220072
RP11-260G23	11	 6	14	01	159178134	159331152	159254643
RP11-193J5	11	 7	14	01	162784902	162785232	162785067
RP11-28D10	11	 8	14	01	164324300	164454300	164389300
RP11-249C5	11	 9	14	01	164824307	164824712	164824509
RP11-184N12	11	10	14	01	166889029	167056094	166972561
RP11-125J13	11	11	14	01	169637429	169805885	169721657
RP11-91K13	11	12	14	02	131025992	131320216	131173104
RP11-91K6	11	13	14	02	159678005	159832799	159755402
RP11-91O12	11	14	14	02	 73088319	 73255185	 73171752
RP11-91A11	11	15	14	02	133584201	133739907	133662054
RP11-91E15	11	16	14	02	 69082423	 69271255	 69176839
RP11-91G19	11	17	14	02	 69977981	 70137152	 70057566
RP11-128C5_2	11	18	14	02	 43985633	 43985897	 43985765
RP11-180L21_2	11	19	14	02	 46177272	 46177583	 46177427
RP11-24P23_2	11	20	14	02	 70462962	 70623458	 70543210
RP11-63D13_2	11	21	14	02	 79619418	 79762286	 79690852
RP11-82B19_2	11	22	14	02	 84900386	 84900641	 84900513
RP11-67L23_2	11	23	14	02	 96627590	 96757590	 96692590
RP11-191I9_2	11	24	14	02	156108565	156109000	156108782
RP11-61N23_2	11	25	14	02	175281795	175282056	175281925
RP11-96M11	11	 1	15	02	179450883	179482120	179466501
RP11-38I11_2	11	 2	15	02	184317488	184317887	184317687
RP11-34N13_2	11	 3	15	02	198715379	198845379	198780379
RP11-47E6_2	11	 4	15	02	204397712	204575312	204486512
RP11-451C8	11	 5	15	02	 83095789	 83254069	 83174929
RP11-451M22	11	 6	15	02	 64734303	 64918588	 64826445
RP11-451A14	11	 7	15	02	 15798209	 15928209	 15863209
RP11-451E4	11	 8	15	02	100295246	100425246	100360246
RP11-451C14	11	 9	15	02	138329641	138533805	138431723
RP11-451C18	11	10	15	02	221744142	221916798	221830470
RP11-89E4_1	11	11	15	04	145582167	145748010	145665088
RP11-47P10	11	12	15	04	145330818	145495070	145412944
RP11-33C6	11	13	15		NA	NA	NA
RP11-134L22	11	14	15	04	146884125	147014125	146949125
RP11-49P16	11	15	15	04	150348945	150478945	150413945
RP11-218A2	11	16	15	04	152400149	152400483	152400316
RP11-1G8	11	17	15	04	163605968	163749619	163677793
RP11-177L7	11	18	15	04	165185104	165341069	165263086
RP11-199O10	11	19	15	04	169100496	169100838	169100667
RP11-6L19	11	20	15	04	167293160	167453527	167373343
RP11-6E9	11	21	15	04	171219033	171415890	171317461
RP11-119J20_1	11	22	15	04	173378777	173548334	173463555
RP11-18D7	11	23	15	04	183933464	184117496	184025480
RP11-275J17	11	24	15	04	184972211	185102211	185037211
RP11-243D3	11	25	15	04	185221070	185375437	185298253
RP11-267E24	11	 1	16	04	185876219	186006219	185941219
RP11-132F21	11	 2	16	04	185994397	185994820	185994608
RP11-280G1	11	 3	16	04	185610965	185752832	185681898
RP11-79E3	11	 4	16	04	 33696677	 33859048	 33777862
RP11-79G9	11	 5	16	04	 12411625	 12578258	 12494941
RP11-79E2_2	11	 6	16	04	143001495	143146137	143073816
RP11-79G20	11	 7	16	04	180819690	180966035	180892862
RP11-79K2	11	 8	16	04	178561002	178721484	178641243
RP11-79K18	11	 9	16	04	126712275	126856903	126784589
RP11-13I21	11	10	16	06	 91241345	 91383425	 91312385
RP11-14G17	11	11	16	06	 99734285	 99913830	 99824057
RP11-73D20	11	12	16	06	102542632	102542998	102542815
RP11-47E20	11	13	16	06	105621318	105794428	105707873
RP11-78P9	11	14	16	06	108616091	108616467	108616279
RP11-75C8	11	15	16	06	112067211	112263337	112165274
RP11-195B12	11	16	16	06	136323912	136324217	136324064
RP11-15H7	11	17	16	06	139955508	140131794	140043651
RP11-20H19	11	18	16	06	155272596	155434808	155353702
RP11-438N24	11	19	16	06	104583108	104745862	104664485
CTD-2018P8	11	20	16	06	 20601182	 20601453	 20601317
CTD-2090G18	11	21	16	06	 87777456	 87907456	 87842456
RP11-79K22	11	22	16	06	101736584	101908759	101822671
RP11-79O12	11	23	16	06	102177867	102358166	102268016
RP11-79B1	11	24	16	06	 86778402	 86937047	 86857724
RP11-79F1	11	25	16	06	135117337	135274819	135196078
RP11-79F21	11	 1	17	06	 64312112	 64486010	 64399061
RP11-79J5	11	 2	17	06	 41062439	 41210987	 41136713
RP11-89A10	11	 3	17	06	141814614	141971532	141893073
RP11-89F9	11	 4	17	06	141642604	141781814	141712209
RP11-89L9	11	 5	17	06	  9459201	  9618037	  9538619
RP11-90G9	11	 6	17	06	 72512820	 72664349	 72588584
RP11-90I11	11	 7	17	06	 14859323	 15059927	 14959625
RP11-90K21	11	 8	17	06	123314080	123465414	123389747
RP11-102K7	11	 9	17	08	101238454	101417646	101328050
RP11-208E21	11	10	17	08	100717687	100858319	100788003
RP11-136H10	11	11	17	08	100284005	100437840	100360922
RP11-282M7	11	12	17	08	 99970445	100136669	100053557
RP11-131D12	11	13	17	08	 99314606	 99314869	 99314737
RP11-158K1	11	14	17	08	125497282	125691169	125594225
RP11-28A4	11	15	17	08	136762748	136934682	136848715
RP11-13A18	11	16	17	08	141605928	141777031	141691479
RP11-54D13	11	17	17	08	 88630985	 88771884	 88701434
CTD-2066E12	11	18	17	08	 68117869	 68137116	 68127492
RP11-79C21	11	19	17	08	109472957	109652275	109562616
RP11-79E11	11	20	17	08	  9289501	  9451740	  9370620
RP11-80P18	11	21	17	08	 88151299	 88318399	 88234849
RP11-88J8	11	22	17	08	 90469149	 90644613	 90556881
RP11-88J18	11	23	17	08	122259232	122437881	122348556
RP11-89A4	11	24	17	08	 42696310	 42850493	 42773401
RP11-89I12	11	25	17	08	  4386744	  4564671	  4475707
RP11-89I16	11	 1	18	08	114955242	115140930	115048086
RP11-90F1	11	 2	18	08	 85831874	 86005081	 85918477
RP11-90M13	11	 3	18	08	 25874705	 26038850	 25956777
RP11-90O17	11	 4	18	08	 12687916	 12856436	 12772176
RP11-90N3	11	 5	18	08	 96904502	 97062457	 96983479
RP11-91F1	11	 6	18	08	110307590	110437590	110372590
RP11-91P13	11	 7	18	08	 33915030	 34077419	 33996224
RP11-32I9	11	 8	18	10	116212556	116212972	116212764
RP11-77E11	11	 9	18	10	120822705	120979467	120901086
RP11-240L14	11	10	18	10	122188365	122352809	122270587
RP11-7P17	11	11	18	10	123070046	123245773	123157909
RP11-262E19	11	12	18	10	123952623	124082623	124017623
RP11-101I20	11	13	18	10	124690744	124859327	124775035
RP11-131C15	11	14	18		NA	NA	NA
RP11-342M3_1	11	15	18	10	 80780233	 80947467	 80863850
RP11-469M11	11	16	18	10	110887891	111047380	110967635
CTD-2126J18	11	17	18	10	 27042399	 27152224	 27097311
CTD-2165L8	11	18	18	10	 17215871	 17372043	 17293957
RP11-79K19	11	19	18	10	 33372796	 33522133	 33447464
RP11-80J24	11	20	18	10	 95781325	 95935762	 95858543
RP11-81N3	11	21	18	10	133056449	133186449	133121449
RP11-88B18	11	22	18	10	 56628164	 56781399	 56704781
RP11-89C18	11	23	18	10	113462434	113635836	113549135
RP11-89I20	11	24	18	10	 27721835	 27873150	 27797492
RP11-89B19	11	25	18	10	  1170730	  1340862	  1255796
RP11-90M21	11	 1	19	10	  6834859	  7015807	  6925333
RP11-90O5	11	 2	19	10	 78733509	 78899962	 78816735
RP11-90O13	11	 3	19	10	131417897	131588229	131503063
RP11-90J7	11	 4	19	10	 79687949	 79845027	 79766488
RP11-91D9	11	 5	19	10	 19497794	 19663829	 19580811
RP11-91H19	11	 6	19	10	 58218257	 58359946	 58289101
RP11-166E4	11	 7	19	12	 91954351	 92087007	 92020679
RP11-74K11	11	 8	19	12	 93024470	 93178678	 93101574
RP11-31A19	11	 9	19	12	 93918138	 93918475	 93918306
RP11-69E3	11	10	19	12	 94705537	 94870907	 94788222
RP11-89E9	11	11	19	12	 97222144	 97411481	 97316812
RP11-18F1	11	12	19	12	 99970407	 99970789	 99970598
RP11-89J2_1	11	13	19	12	124562362	124692362	124627362
RP11-284P8	11	14	19	12	125741190	125741461	125741325
RP11-81G12	11	15	19	12	128926116	129063553	128994834
RP11-1K22	11	16	19	12	129607064	129797867	129702465
CTD-2101J13	11	17	19	12	 87393181	 87393365	 87393273
RP11-79O1	11	18	19	12	 50207143	 50337143	 50272143
RP11-88L2	11	19	19	12	 42459838	 42629204	 42544521
RP11-88P4	11	20	19	12	 33359943	 33534861	 33447402
RP11-89F23	11	21	19	12	129778789	129908789	129843789
RP11-89F16	11	22	19	12	 90601229	 90731229	 90666229
RP11-89J2_2	11	23	19	12	124562362	124692362	124627362
RP11-90C1	11	24	19	12	 77197759	 77385627	 77291693
RP11-91H3	11	25	19	12	 60829047	 60959047	 60894047
RP11-91I15	11	 1	20	12	 54483331	 54649134	 54566232
RP11-91K23	11	 2	20	12	 65798395	 65964115	 65881255
RP11-91M8	11	 3	20	12	101657517	101821925	101739721
RP11-91A7	11	 4	20	12	 42552198	 42739501	 42645849
RP11-548L8	11	 5	20	12	 53730294	 53914928	 53822611
RP11-368G21	11	 6	20	15	 67059839	 67275206	 67167522
RP11-38E12	11	 7	20		NA	NA	NA
RP11-355D13_1	11	 8	20	15	 41409157	 41591921	 41500539
RP11-548M13	11	 9	20	15	 53037813	 53208562	 53123187
RP11-79A5	11	10	20	15	 35776623	 35953471	 35865047
RP11-79C5	11	11	20	15	 49086923	 49233958	 49160440
RP11-88J10_2	11	12	20	15	 41591918	 41763430	 41677674
RP11-89A6	11	13	20	15	 54383554	 54539006	 54461280
RP11-89L21	11	14	20	15	 69990760	 70141861	 70066310
RP11-90E5	11	15	20	15	 98388044	 98574562	 98481303
RP11-90J19	11	16	20	15	 45134880	 45309881	 45222380
RP11-91M4	11	17	20	15	 77596131	 77748701	 77672416
RP11-181O4	11	18	20	16	 20353494	 20353732	 20353613
RP11-50D22	11	19	20	06	 69029499	 69159499	 69094499
RP11-146J7	11	20	20	16	 25650664	 25795346	 25723005
RP11-18H23	11	21	20	16	 31274024	 31443695	 31358859
RP11-48I18	11	22	20	16	 48293522	 48469772	 48381647
RP11-131K14	11	23	20	16	 50798278	 50798428	 50798353
RP11-154N7	11	24	20	16	 64952312	 65082312	 65017312
RP11-5A19_1	11	25	20	16	 65622599	 65775720	 65699159
RP11-84C4	11	 1	21	16	 66892476	 66892806	 66892641
RP11-224E17_1	11	 2	21	16	 67375999	 67426927	 67401463
RP11-123C5	11	 3	21	16	 67553298	 67731554	 67642426
RP11-58M3	11	 4	21	16	 70170264	 70355260	 70262762
RP11-48M7	11	 5	21	20	  3728265	  3902382	  3815323
RP11-149O7	11	 6	21	20	  5465912	  5595912	  5530912
RP11-238D15	11	 7	21	02	190314258	190444258	190379258
RP11-24K4	11	 8	21	20	  9164289	  9312641	  9238465
RP11-32O9	11	 9	21	20	  8743007	  8743320	  8743163
RP11-60N17	11	10	21	20	 11023799	 11191742	 11107770
RP11-57G7	11	11	21	20	 30429538	 30429884	 30429711
RP11-47O20	11	12	21	20	 30429538	 30566288	 30497913
RP11-134I8	11	13	21	20	 29972561	 30102561	 30037561
RP11-71N16	11	14	21	20	 37083840	 37213840	 37148840
RP11-93L19	11	15	21	20	 38878781	 39008781	 38943781
RP11-13F12	11	16	21	20	 40315314	 40445314	 40380314
RP11-24K24	11	17	21	20	 49418206	 49548206	 49483206
RP11-55E1	11	18	21	20	 51802067	 51966817	 51884442
RP11-195N11	11	19	21	20	 53178485	 53308485	 53243485
RP11-1E23	11	20	21	20	 57140427	 57304494	 57222460
RP11-149I18	11	21	21	20	 13199231	 13283353	 13241292
CTD-2018E1	11	22	21	X	 84925466	 84925779	 84925622
RP11-90H19	11	23	21	20	 25471326	 25618069	 25544697
RP11-91I9	11	24	21	20	  2990246	  3155302	  3072774
RP11-91M17	11	25	21	20	 19340878	 19509811	 19425344
RP11-91I2	11	 1	22	20	  9893326	 10048573	  9970949
RP11-451C16	11	 2	22	20	 48390166	 48520166	 48455166
RP11-451O14	11	 3	22	20	 23976875	 24178609	 24077742
RP11-84M3	11	 4	22	02	192041778	192234795	192138286
RP11-87N3	11	 5	22	17	 59891221	 60079774	 59985497
RP11-89M8_3	11	 6	22	08	 22779033	 22949883	 22864458
RP11-90P5_2	11	 7	22	08	 38091018	 38226422	 38158720
RP11-92H22	11	 8	22	04	 72025504	 72179921	 72102712
RP11-92M7	11	 9	22	05	 52909242	 53065347	 52987294
RP11-101H7	11	10	22	03	193209175	193376535	193292855
RP11-104G23	11	11	22	17	 12002245	 12132245	 12067245
RP11-105B9	11	12	22	07	 44464064	 44642832	 44553448
RP11-108K14	11	13	22	10	135117744	135279389	135198566
RP11-113O24	11	14	22	09	 38261088	 38427295	 38344191
RP11-115J22	11	15	22	09	108746381	108934521	108840451
RP11-127K18	11	16	22	02	 98488208	 98691151	 98589679
RP11-131E5	11	17	22	01	202409146	202539071	202474108
RP11-134A8	11	18	22	10	 35429884	 35559884	 35494884
RP11-135A1	11	19	22	03	195222716	195374989	195298852
RP11-137A12	11	20	22	01	157885413	158056445	157970929
RP11-138P20	11	21	22	05	  7879719	  8039222	  7959470
RP11-152H18	11	22	22	11	  8634956	  8795697	  8715326
RP11-152P23	11	23	22	16	  8777492	  8958381	  8867936
RP11-154J22	11	24	22	15	 46296330	 46451070	 46373700
RP11-155P18	11	25	22	02	201875762	202057369	201966565
RP11-165D7	11	 1	23	13	 47960546	 48117394	 48038970
RP11-167I10	11	 2	23	06	123463902	123639710	123551806
RP11-458N5	11	 3	23	02	 25347012	 25544664	 25445838
RP11-459K13	11	 4	23	01	 59929893	 60117072	 60023482
RP11-461A8	11	 5	23	16	  3532260	  3723074	  3627667
RP11-462D19	11	 6	23	07	 39746780	 39934865	 39840822
RP11-463M3	11	 7	23	13	 20781179	 20826976	 20804077
RP11-465L10	11	 8	23	20	 43969087	 44142010	 44055548
RP11-480I12	11	 9	23	01	199439615	199641470	199540542
RP11-484I6	11	10	23	13	102165632	102337684	102251658
RP11-486I11	11	11	23	16	 11727456	 11875890	 11801673
RP11-489K22	11	12	23	02	 43774513	 43960604	 43867558
RP11-490H24	11	13	23	12	102819671	102991992	102905831
RP11-492M19	11	14	23	01	 26522950	 26651292	 26587121
RP11-502P18	11	15	23	13	 27704423	 27868943	 27786683
RP11-506L7	11	16	23	07	 76168056	 76202143	 76185099
RP11-507K13	11	17	23	10	 50500475	 50698877	 50599676
RP11-510J16	11	18	23	16	 80512566	 80689866	 80601216
RP11-513I15	11	19	23	06	 34208416	 34360244	 34284330
RP11-514P19	11	20	23	16	 46203946	 46405307	 46304626
RP11-528G1	11	21	23	01	157222200	157397586	157309893
RP11-532F12	11	22	23	15	 38766144	 38944390	 38855267
RP11-533J15	11	23	23	12	 49503684	 49560230	 49531957
RP11-534J17	11	24	23	02	234110807	234218418	234164612
RP11-535P8	11	25	23	15	 83685710	 83883622	 83784666
RP11-539D10	11	 1	24	Y	 25325838	 25501828	 25413833
RP11-29P18	11	 2	24	04	151456997	151632669	151544833
RP11-30A1	11	 3	24	09	 84664561	 84788727	 84726644
RP11-31I10	11	 4	24	16	  1752991	  1918786	  1835888
RP11-33O4	11	 5	24	02	219610589	219780330	219695459
RP11-35B4	11	 6	24		NA	NA	NA
RP11-36D19	11	 7	24	10	 81994355	 82165503	 82079929
RP11-54L6	11	 8	24	03	 18424762	 18603556	 18514159
RP11-58H15	11	 9	24	04	144621038	144805161	144713099
RP11-60L3	11	10	24	15	 72255859	 72417365	 72336612
RP11-62C3	11	11	24	09	 92007008	 92200512	 92103760
RP11-64D24	11	12	24	11	113582166	113746962	113664564
RP11-66A14_1	11	13	24	04	122831999	123020921	122926460
RP11-82H13	11	14	24	01	 84306742	 84437620	 84372181
RP11-85E16	11	15	24	07	 36543036	 36718248	 36630642
RP11-86H7	11	16	24	01	 94692287	 94892713	 94792500
RP11-87N22	11	17	24	11	112570855	112764135	112667495
RP11-90L1_2	11	18	24	13	109936817	110114209	110025513
RP11-92H16	11	19	24	12	 21633746	 21784757	 21709251
RP11-107O13	11	20	24	03	 45472443	 45635059	 45553751
RP11-110K8	11	21	24	13	 20982685	 21161844	 21072264
RP11-111L24	11	22	24	13	 97843997	 97950575	 97897286
RP11-112O24	11	23	24	03	139818740	139995217	139906978
RP11-115L11	11	24	24	04	 15299108	 15414620	 15356864
RP11-117L6	11	25	24	05	170679526	170854644	170767085
RP11-707M3	11	 1	25	08	 66675183	 66877203	 66776193
RP11-712B9	11	 2	25	11	 94492266	 94665707	 94578986
RP11-714M16	11	 3	25	10	121088268	121281908	121185088
RP11-726L11	11	 4	25	18	 31453697	 31650397	 31552047
RP11-750H9	11	 5	25	11	 47353655	 47556194	 47454924
RP11-752L20	11	 6	25	04	148727873	148892793	148810333
RP1-3K23	11	 7	25	07	158402708	158620885	158511796
RP1-26N8	11	 8	25	11	130996205	130996287	130996246
P1-85A10	11	 9	25		NA	NA	NA
RP1-191P24	11	10	25	16	 88612329	 88612553	 88612441
RP1-81F12	11	11	25	20	 62230424	 62392948	 62311686
RP11-17K17	11	12	25	X	 50860186	 51038128	 50949157
RP11-246J15	12	 1	 1	01	198812719	198972162	198892440
RP11-148K15	12	 2	 1	01	201303314	201476223	201389768
RP11-243M13	12	 3	 1	01	201635643	201794557	201715100
RP11-249H15	12	 4	 1	01	202122929	202252929	202187929
RP11-57I17	12	 5	 1	01	204097913	204278890	204188401
RP11-45F21	12	 6	 1	01	204773022	204952147	204862584
RP11-210E16	12	 7	 1	01	228801390	228801630	228801510
RP11-130I13	12	 8	 1	01	235875218	235875533	235875375
RP11-210F8	12	 9	 1	01	237932252	237932584	237932418
RP11-472I17	12	10	 1	01	200331551	200461551	200396551
CTD-2018M10	12	11	 1		NA	NA	NA
CTD-2100E20	12	12	 1	01	 53379233	 53473461	 53426347
RP11-79O23	12	13	 1	01	 70018659	 70167379	 70093019
RP11-79O22	12	14	 1	01	223414231	223593287	223503759
RP11-79D15	12	15	 1	01	 17719024	 17897409	 17808216
RP11-79H19	12	16	 1	01	102344531	102502343	102423437
RP11-80B20	12	17	 1	01	162203379	162348337	162275858
RP11-80F2	12	18	 1	01	158596402	158763361	158679881
RP11-81P11	12	19	 1	01	149476215	149644651	149560433
RP11-88D12	12	20	 1	01	192286357	192457734	192372045
RP11-88H4	12	21	 1	01	242400427	242559130	242479778
RP11-88L6	12	22	 1	01	 80563568	 80727650	 80645609
RP11-88N22	12	23	 1	01	194722389	194886911	194804650
RP11-89E6	12	24	 1	01	117867781	118030140	117948960
RP11-255O19	12	25	 1	03	 15780361	 15940642	 15860501
RP11-245E5	12	 1	 2	03	 22747912	 22936416	 22842164
RP11-11L6	12	 2	 2	03	 28645903	 28824358	 28735130
RP11-286G5	12	 3	 2	03	 36367283	 36550871	 36459077
RP11-119L2	12	 4	 2	03	 42430733	 42596936	 42513834
RP11-189H19	12	 5	 2	03	 44567436	 44737926	 44652681
RP11-179B9	12	 6	 2	03	 64182441	 64329906	 64256173
RP11-154H23	12	 7	 2	03	 71622958	 71816508	 71719733
RP11-285J14	12	 8	 2	03	 95525743	 95526071	 95525907
RP11-69N24	12	 9	 2	03	106200730	106361090	106280910
RP11-166C10	12	10	 2	03	109969472	110058472	110013972
RP11-153K19	12	11	 2	03	114199281	114348980	114274130
RP11-166D18	12	12	 2	03	140942615	141096384	141019499
RP11-165M11	12	13	 2	03	144846151	144976151	144911151
RP11-229G6	12	14	 2	03	150205916	150335916	150270916
RP11-64F6	12	15	 2	03	152413965	152591089	152502527
RP11-65L11	12	16	 2	03	152788889	152947545	152868217
RP11-203L15	12	17	 2	03	162044657	162207623	162126140
RP11-178K17	12	18	 2	03	190561333	190731939	190646636
RP11-54L9	12	19	 2	03	191443383	191627669	191535526
RP11-233N20	12	20	 2	03	198504433	198504724	198504578
RP11-7M24	12	21	 2	03	  6184062	  6351760	  6267911
RP11-105H19_1	12	22	 2	03	 11245296	 11402240	 11323768
CTD-2125O15	12	23	 2	03	136333485	136508834	136421159
RP11-88B22	12	24	 2	04	 21916095	 22082375	 21999235
RP11-88J6	12	25	 2	04	 74973206	 75127547	 75050376
RP11-89C4	12	 1	 3	04	159318132	159497775	159407953
RP11-89E4_2	12	 2	 3	04	145582167	145748010	145665088
RP11-89G6	12	 3	 3	04	110243470	110401140	110322305
RP11-89I6	12	 4	 3	04	 28918364	 29089564	 29003964
RP11-89N9	12	 5	 3	04	 44849765	 45006517	 44928141
RP11-89N8	12	 6	 3	04	122091739	122221739	122156739
RP11-90E13	12	 7	 3	04	171498340	171662686	171580513
RP11-90D3	12	 8	 3	04	 43358403	 43517865	 43438134
RP11-90F11	12	 9	 3	04	 45988565	 46144739	 46066652
RP11-90I15	12	10	 3	04	 17884283	 18031246	 17957764
RP11-227F19	12	11	 3	04	 41486235	 41673302	 41579768
RP11-451M18	12	12	 3	04	 17670296	 17800296	 17735296
RP11-451E22	12	13	 3	04	 10705224	 10835224	 10770224
RP11-94J21	12	14	 3	05	  1377470	  1540913	  1459191
RP11-82M24	12	15	 3	05	  3449496	  3449744	  3449620
RP11-227M19	12	16	 3	05	  3994864	  3995049	  3994956
RP11-5N11	12	17	 3	05	 31657457	 31800465	 31728961
RP11-94E6	12	18	 3	05	 33737269	 33926014	 33831641
RP11-85N3	12	19	 3	05	 35724542	 35854542	 35789542
RP11-19F12	12	20	 3	05	 41237160	 41386317	 41311738
RP11-160F8	12	21	 3	05	 53365247	 53520260	 53442753
RP11-203O23	12	22	 3	05	 54984808	 55114808	 55049808
RP11-91G15	12	23	 3	06	137329400	137498692	137414046
RP11-449B3	12	24	 3	05	152608266	152785580	152696923
RP11-451M2	12	25	 3	06	 27527854	 27735846	 27631850
RP11-23D23	12	 1	 4	07	   835958	   836351	   836154
RP11-234N20	12	 2	 4	07	  2871152	  2871468	  2871310
RP11-2K20	12	 3	 4	07	  5893799	  6040702	  5967250
RP11-34N11	12	 4	 4	07	 29310964	 29460113	 29385538
RP11-95N10	12	 5	 4	07	 32674298	 32674755	 32674526
RP11-178P2	12	 6	 4	07	 35026935	 35195736	 35111335
RP11-138E20	12	 7	 4	07	 36363196	 36363642	 36363419
RP11-75O22	12	 8	 4	07	 36992743	 37179752	 37086247
RP11-64I2	12	 9	 4	07	 39275219	 39421582	 39348400
RP11-123F4	12	10	 4		NA	NA	NA
RP11-15L23	12	11	 4	07	 50757191	 50938983	 50848087
RP11-34J24	12	12	 4	07	 55273627	 55403627	 55338627
RP11-97P11	12	13	 4	07	 55238304	 55381999	 55310151
RP11-90O18	12	14	 4	07	 63578358	 63708358	 63643358
RP11-41F23	12	15	 4	07	 67297490	 67427490	 67362490
RP11-49N15	12	16	 4	07	 92507499	 92656812	 92582155
RP11-127F3	12	17	 4	07	 94767277	 94767648	 94767462
RP11-10D8	12	18	 4	07	 98067793	 98216726	 98142259
RP11-213E22	12	19	 4	07	100298530	100493349	100395939
RP11-72J24	12	20	 4	07	104207163	104360140	104283651
RP11-46J20	12	21	 4	07	106781327	106958825	106870076
RP11-280I16	12	22	 4	09	  4407742	  4603810	  4505776
RP11-12N24	12	23	 4	09	  5179813	  5309813	  5244813
RP11-117J18	12	24	 4	09	 12628463	 12795950	 12712206
RP11-50C21	12	25	 4	09	 10400067	 10554235	 10477151
RP11-58B8	12	 1	 5	09	 11597866	 11764217	 11681041
RP11-115I23	12	 2	 5	09	 13017705	 13186528	 13102116
RP11-115L5	12	 3	 5	09	 33163287	 33163691	 33163489
RP11-18K11	12	 4	 5	09	 34677550	 34820126	 34748838
RP11-37F22	12	 5	 5	09	 34971399	 34971713	 34971556
RP11-39I6	12	 6	 5	09	 36174983	 36304983	 36239983
RP11-61I3	12	 7	 5	09	 37607772	 37770703	 37689237
RP11-16N10	12	 8	 5	09	 69008752	 69176495	 69092623
RP11-8D10	12	 9	 5	09	 82079078	 82209078	 82144078
RP11-22C13	12	10	 5	09	 82539143	 82707467	 82623305
RP11-142P12	12	11	 5	09	 83246695	 83400807	 83323751
RP11-20B20	12	12	 5	09	 84865139	 84995139	 84930139
RP11-41K9	12	13	 5	09	 86802342	 86932342	 86867342
RP11-88J16_1	12	14	 5	09	 88247300	 88427843	 88337571
RP11-106N7	12	15	 5	09	 97924515	 98093688	 98009101
RP11-32A11	12	16	 5	09	 98129626	 98130355	 98129990
RP11-20E13	12	17	 5	09	 98986283	 99116283	 99051283
RP11-52E12	12	18	 5	09	 99949923	100109727	100029825
RP11-84C18	12	19	 5	09	 99811048	 99811377	 99811212
RP11-5K11	12	20	 5	09	100142823	100327175	100234999
RP11-57F14	12	21	 5	11	  5363393	  5523139	  5443266
RP11-30I3	12	22	 5	11	  6270497	  6431042	  6350769
RP11-25D22	12	23	 5	11	  7687390	  7817390	  7752390
RP11-28I11	12	24	 5	11	 10492617	 10492765	 10492691
RP11-82L24	12	25	 5	11	 11677615	 11677935	 11677775
RP11-206L19	12	 1	 6	11	 11681592	 11828351	 11754971
RP11-140J4	12	 2	 6	11	 19988279	 20164494	 20076386
RP11-2C23	12	 3	 6	11	 19951964	 20135909	 20043936
RP11-16H3	12	 4	 6	11	 26552621	 26723462	 26638041
RP11-1L12	12	 5	 6	11	 27033269	 27213374	 27123321
RP11-246J1	12	 6	 6	11	 30497126	 30632438	 30564782
RP11-51J14	12	 7	 6	11	 33302224	 33432224	 33367224
RP11-79G4_1	12	 8	 6	11	 41558232	 41710577	 41634404
RP11-12D19	12	 9	 6	11	 43681667	 43842756	 43762211
RP11-206I1	12	10	 6	11	 45047399	 45224812	 45136105
RP11-29O22	12	11	 6	11	 46582987	 46722148	 46652567
RP11-56E13	12	12	 6	11	 47989032	 48119032	 48054032
RP11-222G13	12	13	 6	11	 48464298	 48464506	 48464402
RP11-256P19	12	14	 6	11	 71610465	 71610635	 71610550
RP11-96D22	12	15	 6	11	 72716086	 72868556	 72792321
RP11-91P18	12	16	 6	11	 74878806	 75008806	 74943806
RP11-165C10	12	17	 6	11	 75018621	 75180303	 75099462
RP11-98G24	12	18	 6	11	 76964745	 77094745	 77029745
RP11-31F2	12	19	 6	11	 77218045	 77348045	 77283045
RP11-63C16	12	20	 6	13	 30131054	 30272332	 30201693
RP11-53F19	12	21	 6	13	 39905442	 40035442	 39970442
RP11-88N4_1	12	22	 6	13	 40708134	 40876134	 40792134
RP11-21H9	12	23	 6	13	 41945945	 42089411	 42017678
RP11-17I11	12	24	 6	13	 42577659	 42766463	 42672061
RP11-30N18	12	25	 6	13	 44481779	 44611779	 44546779
RP11-30C8	12	 1	 7	13	 72854046	 72984046	 72919046
RP11-46L3	12	 2	 7	13	 73510380	 73672828	 73591604
RP11-43P9	12	 3	 7	13	 75065780	 75227940	 75146860
RP11-122N18	12	 4	 7	13	 77314550	 77489832	 77402191
RP11-118K20	12	 5	 7	13	 83758823	 83888823	 83823823
RP11-86C3	12	 6	 7	13	 89049118	 89214348	 89131733
RP11-211J11	12	 7	 7	13	 52111041	 52111313	 52111177
RP11-183A20	12	 8	 7	13	107717307	107865111	107791209
RP11-230A15	12	 9	 7	13	110170935	110171421	110171178
RP11-19O15	12	10	 7	13	112386529	112516529	112451529
RP11-94A1	12	11	 7	13	 18360157	 18502664	 18431410
CTD-2202J2	12	12	 7	13	 39942273	 40072273	 40007273
RP11-88N4_2	12	13	 7	13	 40708134	 40876134	 40792134
RP11-89D16	12	14	 7	13	 20858775	 20988775	 20923775
RP11-89J10	12	15	 7	13	 26724456	 26854456	 26789456
RP11-90C11	12	16	 7	13	100477930	100637276	100557603
RP11-90K7	12	17	 7	13	 48069306	 48242971	 48156138
RP11-90M15	12	18	 7	13	 24639727	 24796857	 24718292
RP11-140K16	12	19	 7	16	 82993991	 83152337	 83073164
RP11-59A12	12	20	 7	16	 83442826	 83572826	 83507826
RP11-60B6	12	21	 7	16	 83893496	 83893746	 83893621
RP11-7D23_1	12	22	 7	16	 88297301	 88465228	 88381264
RP11-368N21	12	23	 7	16	 29408697	 29609853	 29509275
CTD-2007N1	12	24	 7	16	   258356	   258529	   258442
RP11-81L21	12	25	 7	16	 70009987	 70163285	 70086636
RP11-89C10	12	 1	 8	16	 64421380	 64579967	 64500673
RP11-89M4	12	 2	 8	16	  4523242	  4697230	  4610236
RP11-89O14	12	 3	 8	16	 57476831	 57653333	 57565082
RP11-89N7	12	 4	 8	16	 50018681	 50173498	 50096089
RP11-90H1	12	 5	 8	16	 53966219	 54127805	 54047012
RP11-167B4	12	 6	 8	16	  6165922	  6339853	  6252887
RP11-21B23	12	 7	 8	16	 48934950	 49090411	 49012680
RP11-2D4	12	 8	 8	16	 54226896	 54397137	 54312016
RP11-35P16	12	 9	 8	16	  4441449	  4598898	  4520173
RP11-433P17	12	10	 8	16	  3292430	  3471943	  3382186
RP11-475D10	12	11	 8	16	  8598165	  8783442	  8690803
RP11-42F12	12	12	 8	17	 14153980	 14314061	 14234020
RP11-73F15	12	13	 8	17	 26053148	 26183148	 26118148
RP11-58O8	12	14	 8	17	 30896260	 31026260	 30961260
RP11-58O9	12	15	 8	17	 35754736	 35920945	 35837840
RP11-241H2	12	16	 8	17	 35692236	 35833467	 35762851
RP11-266I24	12	17	 8	17	 38235011	 38412429	 38323720
RP11-15H6	12	18	 8	21	 26643204	 26798261	 26720732
RP11-44F3	12	19	 8	21	 26441537	 26603298	 26522417
RP11-6I7	12	20	 8	21	 26776963	 26923374	 26850168
RP11-12M14	12	21	 8	21	 31204602	 31363718	 31284160
RP11-108H5	12	22	 8	21	 26788596	 26960676	 26874636
RP11-70L17	12	23	 8	21	 29576993	 29706993	 29641993
RP11-105O24	12	24	 8	21	 37717327	 37872927	 37795127
RP11-66C14	12	25	 8	21	 38716580	 38716946	 38716763
RP11-114H1	12	 1	 9	21	 41110820	 41272864	 41191842
RP11-190A24	12	 2	 9	21	 44148292	 44148594	 44148443
CTD-2035F24	12	 3	 9	21	 26174732	 26175854	 26175293
CTD-2103O7	12	 4	 9	21	 41752582	 41752979	 41752780
RP11-451M12	12	 5	 9	21	 35302676	 35500392	 35401534
RP11-100K2	12	 6	 9	22	 16792168	 16966188	 16879178
RP11-36N5	12	 7	 9	22	 20289397	 20419397	 20354397
RP11-13J4	12	 8	 9	22	 24221800	 24398577	 24310188
RP11-65F22	12	 9	 9		NA	NA	NA
RP11-5O6	12	10	 9	22	 26243204	 26243615	 26243409
RP11-49M22	12	11	 9	22	 43411157	 43579114	 43495135
RP11-66M5	12	12	 9	22	 46600002	 46762453	 46681227
RP11-66F9	12	13	 9	22	 15756122	 15931462	 15843792
CTD-2164I18	12	14	 9	22	 24443742	 24444188	 24443965
RP11-79G6	12	15	 9	22	 28896348	 29079659	 28988003
RP11-81B3	12	16	 9	22	 16792243	 16984468	 16888355
RP11-186B13	12	17	 9	18	 49166730	 49323443	 49245086
RP11-188P20	12	18	 9	03	 43292868	 43435902	 43364385
RP11-193D24	12	19	 9	06	151743714	151919380	151831547
RP11-195B17	12	20	 9	02	 27193819	 27353526	 27273672
RP11-195F19	12	21	 9	09	 34634467	 34820900	 34727683
RP11-196P12	12	22	 9	17	 31262983	 31443599	 31353291
RP11-209M4	12	23	 9	17	 39047604	 39205560	 39126582
RP11-211E17	12	24	 9	11	  6433952	  6626210	  6530081
RP11-213P13	12	25	 9	01	 56593281	 56762346	 56677813
RP11-214N16	12	 1	10	09	 76317748	 76501606	 76409677
RP11-215H18	12	 2	10	11	117662914	117753170	117708042
RP11-215K24	12	 3	10	03	 70082272	 70235455	 70158863
RP11-234D19	12	 4	10	01	 85388186	 85485976	 85437081
RP11-237C13	12	 5	10	12	109473086	109638318	109555702
RP11-240H8	12	 6	10	07	 22528823	 22620015	 22574419
RP11-242D8	12	 7	10	17	 38491120	 38621120	 38556120
RP11-243K18	12	 8	10	16	   266993	   431803	   349398
RP11-251N10	12	 9	10	01	 13805523	 13998156	 13901839
RP11-266J6	12	10	10	03	  9665620	  9852213	  9758916
RP11-269C23	12	11	10	13	 43763726	 43908562	 43836144
RP11-270G15	12	12	10	03	156238356	156401193	156319774
RP11-271O1_2	12	13	10	08	 67573801	 67732186	 67652993
RP11-272P3	12	14	10	01	 94692701	 94892707	 94792704
RP11-275J11	12	15	10	03	 12474739	 12625546	 12550142
RP11-552F3	12	16	10	17	 71257310	 71461062	 71359186
RP11-556G18	12	17	10	03	 14053910	 14216520	 14135215
RP11-557L19	12	18	10	02	  7346655	  7453291	  7399973
RP11-560A15	12	19	10	20	 55075395	 55200242	 55137818
RP11-564A8	12	20	10	01	203409711	203602276	203505993
RP11-568N1	12	21	10	02	 70552651	 70737830	 70645240
RP11-602P21	12	22	10	06	 33276697	 33500727	 33388712
RP11-605B16	12	23	10	02	156880526	157055606	156968066
RP11-607F22	12	24	10	15	 23260672	 23452928	 23356800
RP11-608N6	12	25	10	02	157843879	158030176	157937027
RP11-613D13	12	 1	11	11	 43752885	 43941852	 43847368
RP11-618A20	12	 2	11	09	130252614	130425637	130339125
RP11-655A17	12	 3	11	03	 87099697	 87270490	 87185093
RP11-658E8	12	 4	11	02	  9531626	  9738681	  9635153
RP11-659P16	12	 5	11	03	 25516684	 25705992	 25611338
RP11-667B21	12	 6	11	13	 26499973	 26541591	 26520782
RP11-671C15	12	 7	11	01	   849475	  1038212	   943843
RP11-675J9	12	 8	11		NA	NA	NA
RP11-697H17	12	 9	11	07	 79915150	 80098996	 80007073
RP11-706A13	12	10	11	11	 44198236	 44392852	 44295544
RP11-708D1	12	11	11	03	 14651544	 14803222	 14727383
RP11-713N11	12	12	11	12	 25028582	 25181819	 25105200
RP11-716A19	12	13	11	X	 16588103	 16760718	 16674410
RP11-720L3	12	14	11	18	 13652268	 13827849	 13740058
RP11-139H14	12	15	11	13	 45543685	 45724365	 45634025
RP11-141M3	12	16	11	03	 42812666	 42988806	 42900736
RP11-144B2	12	17	11	12	119040684	119225424	119133054
RP11-147K16	12	18	11	17	  3241550	  3398993	  3320271
RP11-150L22	12	19	11	01	239848752	240032059	239940405
RP11-158G19	12	20	11	19	 59041159	 59235466	 59138312
RP11-177A2	12	21	11	01	175661891	175824392	175743141
RP11-180A14	12	22	11	01	197518664	197685966	197602315
RP11-181K3	12	23	11	01	179794770	179958854	179876812
RP11-182B22	12	24	11	01	233330840	233503593	233417216
RP11-184A2	12	25	11	10	  3722437	  3816599	  3769518
RP11-190C22	12	 1	12	03	120684353	120844091	120764222
RP11-215P8	12	 2	12	05	133668049	133810324	133739186
RP11-221E20	12	 3	12	03	129991754	130058439	130025096
RP11-224O19	12	 4	12	01	214854371	215040162	214947266
RP11-227L6	12	 5	12	02	173072109	173241695	173156902
RP11-238E12	12	 6	12	X	149404183	149559522	149481852
RP11-242J7	12	 7	12	04	185824194	185996855	185910524
RP11-265B8	12	 8	12	09	 68778952	 68967116	 68873034
RP11-275F13	12	 9	12	01	 51437975	 51597421	 51517698
RP11-278J17	12	10	12	01	 51147793	 51275817	 51211805
RP11-282O18	12	11	12	12	122202693	122332693	122267693
RP11-284O21	12	12	12	11	116430107	116618856	116524481
RP11-286H15	12	13	12	02	127923137	128127280	128025208
RP11-754A4	12	14	12	05	180044369	180214113	180129241
RP11-755I3	12	15	12	11	 73918326	 74098054	 74008190
RP11-762B21	12	16	12	11	122398007	122594984	122496495
RP11-791G15	12	17	12	02	 10760770	 10952850	 10856810
RP11-795B6	12	18	12	19	 55987852	 56202501	 56095176
RP11-799C6	12	19	12	01	110548255	110760450	110654352
RP11-21N8	12	20	12	03	131810603	131961221	131885912
RP11-57D16	12	21	12	01	176568602	176725365	176646983
RP11-104N13	12	22	12	06	165032657	165108996	165070826
RP11-138D23	12	23	12	13	 66378427	 66543031	 66460729
RP11-159D14	12	24	12	18	 48053986	 48218621	 48136303
RP11-260G22	12	25	12	02	 53032451	 53196368	 53114409
RP11-246J15	12	13	13	01	198812719	198972162	198892440
RP11-148K15	12	14	13	01	201303314	201476223	201389768
RP11-243M13	12	15	13	01	201635643	201794557	201715100
RP11-249H15	12	16	13	01	202122929	202252929	202187929
RP11-57I17	12	17	13	01	204097913	204278890	204188401
RP11-45F21	12	18	13	01	204773022	204952147	204862584
RP11-210E16	12	19	13	01	228801390	228801630	228801510
RP11-130I13	12	20	13	01	235875218	235875533	235875375
RP11-210F8	12	21	13	01	237932252	237932584	237932418
RP11-472I17	12	22	13	01	200331551	200461551	200396551
CTD-2018M10	12	23	13		NA	NA	NA
CTD-2100E20	12	24	13	01	 53379233	 53473461	 53426347
RP11-79O23	12	25	13	01	 70018659	 70167379	 70093019
RP11-79O22	12	 1	14	01	223414231	223593287	223503759
RP11-79D15	12	 2	14	01	 17719024	 17897409	 17808216
RP11-79H19	12	 3	14	01	102344531	102502343	102423437
RP11-80B20	12	 4	14	01	162203379	162348337	162275858
RP11-80F2	12	 5	14	01	158596402	158763361	158679881
RP11-81P11	12	 6	14	01	149476215	149644651	149560433
RP11-88D12	12	 7	14	01	192286357	192457734	192372045
RP11-88H4	12	 8	14	01	242400427	242559130	242479778
RP11-88L6	12	 9	14	01	 80563568	 80727650	 80645609
RP11-88N22	12	10	14	01	194722389	194886911	194804650
RP11-89E6	12	11	14	01	117867781	118030140	117948960
RP11-255O19	12	12	14	03	 15780361	 15940642	 15860501
RP11-245E5	12	13	14	03	 22747912	 22936416	 22842164
RP11-11L6	12	14	14	03	 28645903	 28824358	 28735130
RP11-286G5	12	15	14	03	 36367283	 36550871	 36459077
RP11-119L2	12	16	14	03	 42430733	 42596936	 42513834
RP11-189H19	12	17	14	03	 44567436	 44737926	 44652681
RP11-179B9	12	18	14	03	 64182441	 64329906	 64256173
RP11-154H23	12	19	14	03	 71622958	 71816508	 71719733
RP11-285J14	12	20	14	03	 95525743	 95526071	 95525907
RP11-69N24	12	21	14	03	106200730	106361090	106280910
RP11-166C10	12	22	14	03	109969472	110058472	110013972
RP11-153K19	12	23	14	03	114199281	114348980	114274130
RP11-166D18	12	24	14	03	140942615	141096384	141019499
RP11-165M11	12	25	14	03	144846151	144976151	144911151
RP11-229G6	12	 1	15	03	150205916	150335916	150270916
RP11-64F6	12	 2	15	03	152413965	152591089	152502527
RP11-65L11	12	 3	15	03	152788889	152947545	152868217
RP11-203L15	12	 4	15	03	162044657	162207623	162126140
RP11-178K17	12	 5	15	03	190561333	190731939	190646636
RP11-54L9	12	 6	15	03	191443383	191627669	191535526
RP11-233N20	12	 7	15	03	198504433	198504724	198504578
RP11-7M24	12	 8	15	03	  6184062	  6351760	  6267911
RP11-105H19_1	12	 9	15	03	 11245296	 11402240	 11323768
CTD-2125O15	12	10	15	03	136333485	136508834	136421159
RP11-88B22	12	11	15	04	 21916095	 22082375	 21999235
RP11-88J6	12	12	15	04	 74973206	 75127547	 75050376
RP11-89C4	12	13	15	04	159318132	159497775	159407953
RP11-89E4_2	12	14	15	04	145582167	145748010	145665088
RP11-89G6	12	15	15	04	110243470	110401140	110322305
RP11-89I6	12	16	15	04	 28918364	 29089564	 29003964
RP11-89N9	12	17	15	04	 44849765	 45006517	 44928141
RP11-89N8	12	18	15	04	122091739	122221739	122156739
RP11-90E13	12	19	15	04	171498340	171662686	171580513
RP11-90D3	12	20	15	04	 43358403	 43517865	 43438134
RP11-90F11	12	21	15	04	 45988565	 46144739	 46066652
RP11-90I15	12	22	15	04	 17884283	 18031246	 17957764
RP11-227F19	12	23	15	04	 41486235	 41673302	 41579768
RP11-451M18	12	24	15	04	 17670296	 17800296	 17735296
RP11-451E22	12	25	15	04	 10705224	 10835224	 10770224
RP11-94J21	12	 1	16	05	  1377470	  1540913	  1459191
RP11-82M24	12	 2	16	05	  3449496	  3449744	  3449620
RP11-227M19	12	 3	16	05	  3994864	  3995049	  3994956
RP11-5N11	12	 4	16	05	 31657457	 31800465	 31728961
RP11-94E6	12	 5	16	05	 33737269	 33926014	 33831641
RP11-85N3	12	 6	16	05	 35724542	 35854542	 35789542
RP11-19F12	12	 7	16	05	 41237160	 41386317	 41311738
RP11-160F8	12	 8	16	05	 53365247	 53520260	 53442753
RP11-203O23	12	 9	16	05	 54984808	 55114808	 55049808
RP11-91G15	12	10	16	06	137329400	137498692	137414046
RP11-449B3	12	11	16	05	152608266	152785580	152696923
RP11-451M2	12	12	16	06	 27527854	 27735846	 27631850
RP11-23D23	12	13	16	07	   835958	   836351	   836154
RP11-234N20	12	14	16	07	  2871152	  2871468	  2871310
RP11-2K20	12	15	16	07	  5893799	  6040702	  5967250
RP11-34N11	12	16	16	07	 29310964	 29460113	 29385538
RP11-95N10	12	17	16	07	 32674298	 32674755	 32674526
RP11-178P2	12	18	16	07	 35026935	 35195736	 35111335
RP11-138E20	12	19	16	07	 36363196	 36363642	 36363419
RP11-75O22	12	20	16	07	 36992743	 37179752	 37086247
RP11-64I2	12	21	16	07	 39275219	 39421582	 39348400
RP11-123F4	12	22	16		NA	NA	NA
RP11-15L23	12	23	16	07	 50757191	 50938983	 50848087
RP11-34J24	12	24	16	07	 55273627	 55403627	 55338627
RP11-97P11	12	25	16	07	 55238304	 55381999	 55310151
RP11-90O18	12	 1	17	07	 63578358	 63708358	 63643358
RP11-41F23	12	 2	17	07	 67297490	 67427490	 67362490
RP11-49N15	12	 3	17	07	 92507499	 92656812	 92582155
RP11-127F3	12	 4	17	07	 94767277	 94767648	 94767462
RP11-10D8	12	 5	17	07	 98067793	 98216726	 98142259
RP11-213E22	12	 6	17	07	100298530	100493349	100395939
RP11-72J24	12	 7	17	07	104207163	104360140	104283651
RP11-46J20	12	 8	17	07	106781327	106958825	106870076
RP11-280I16	12	 9	17	09	  4407742	  4603810	  4505776
RP11-12N24	12	10	17	09	  5179813	  5309813	  5244813
RP11-117J18	12	11	17	09	 12628463	 12795950	 12712206
RP11-50C21	12	12	17	09	 10400067	 10554235	 10477151
RP11-58B8	12	13	17	09	 11597866	 11764217	 11681041
RP11-115I23	12	14	17	09	 13017705	 13186528	 13102116
RP11-115L5	12	15	17	09	 33163287	 33163691	 33163489
RP11-18K11	12	16	17	09	 34677550	 34820126	 34748838
RP11-37F22	12	17	17	09	 34971399	 34971713	 34971556
RP11-39I6	12	18	17	09	 36174983	 36304983	 36239983
RP11-61I3	12	19	17	09	 37607772	 37770703	 37689237
RP11-16N10	12	20	17	09	 69008752	 69176495	 69092623
RP11-8D10	12	21	17	09	 82079078	 82209078	 82144078
RP11-22C13	12	22	17	09	 82539143	 82707467	 82623305
RP11-142P12	12	23	17	09	 83246695	 83400807	 83323751
RP11-20B20	12	24	17	09	 84865139	 84995139	 84930139
RP11-41K9	12	25	17	09	 86802342	 86932342	 86867342
RP11-88J16_1	12	 1	18	09	 88247300	 88427843	 88337571
RP11-106N7	12	 2	18	09	 97924515	 98093688	 98009101
RP11-32A11	12	 3	18	09	 98129626	 98130355	 98129990
RP11-20E13	12	 4	18	09	 98986283	 99116283	 99051283
RP11-52E12	12	 5	18	09	 99949923	100109727	100029825
RP11-84C18	12	 6	18	09	 99811048	 99811377	 99811212
RP11-5K11	12	 7	18	09	100142823	100327175	100234999
RP11-57F14	12	 8	18	11	  5363393	  5523139	  5443266
RP11-30I3	12	 9	18	11	  6270497	  6431042	  6350769
RP11-25D22	12	10	18	11	  7687390	  7817390	  7752390
RP11-28I11	12	11	18	11	 10492617	 10492765	 10492691
RP11-82L24	12	12	18	11	 11677615	 11677935	 11677775
RP11-206L19	12	13	18	11	 11681592	 11828351	 11754971
RP11-140J4	12	14	18	11	 19988279	 20164494	 20076386
RP11-2C23	12	15	18	11	 19951964	 20135909	 20043936
RP11-16H3	12	16	18	11	 26552621	 26723462	 26638041
RP11-1L12	12	17	18	11	 27033269	 27213374	 27123321
RP11-246J1	12	18	18	11	 30497126	 30632438	 30564782
RP11-51J14	12	19	18	11	 33302224	 33432224	 33367224
RP11-79G4_1	12	20	18	11	 41558232	 41710577	 41634404
RP11-12D19	12	21	18	11	 43681667	 43842756	 43762211
RP11-206I1	12	22	18	11	 45047399	 45224812	 45136105
RP11-29O22	12	23	18	11	 46582987	 46722148	 46652567
RP11-56E13	12	24	18	11	 47989032	 48119032	 48054032
RP11-222G13	12	25	18	11	 48464298	 48464506	 48464402
RP11-256P19	12	 1	19	11	 71610465	 71610635	 71610550
RP11-96D22	12	 2	19	11	 72716086	 72868556	 72792321
RP11-91P18	12	 3	19	11	 74878806	 75008806	 74943806
RP11-165C10	12	 4	19	11	 75018621	 75180303	 75099462
RP11-98G24	12	 5	19	11	 76964745	 77094745	 77029745
RP11-31F2	12	 6	19	11	 77218045	 77348045	 77283045
RP11-63C16	12	 7	19	13	 30131054	 30272332	 30201693
RP11-53F19	12	 8	19	13	 39905442	 40035442	 39970442
RP11-88N4_1	12	 9	19	13	 40708134	 40876134	 40792134
RP11-21H9	12	10	19	13	 41945945	 42089411	 42017678
RP11-17I11	12	11	19	13	 42577659	 42766463	 42672061
RP11-30N18	12	12	19	13	 44481779	 44611779	 44546779
RP11-30C8	12	13	19	13	 72854046	 72984046	 72919046
RP11-46L3	12	14	19	13	 73510380	 73672828	 73591604
RP11-43P9	12	15	19	13	 75065780	 75227940	 75146860
RP11-122N18	12	16	19	13	 77314550	 77489832	 77402191
RP11-118K20	12	17	19	13	 83758823	 83888823	 83823823
RP11-86C3	12	18	19	13	 89049118	 89214348	 89131733
RP11-211J11	12	19	19	13	 52111041	 52111313	 52111177
RP11-183A20	12	20	19	13	107717307	107865111	107791209
RP11-230A15	12	21	19	13	110170935	110171421	110171178
RP11-19O15	12	22	19	13	112386529	112516529	112451529
RP11-94A1	12	23	19	13	 18360157	 18502664	 18431410
CTD-2202J2	12	24	19	13	 39942273	 40072273	 40007273
RP11-88N4_2	12	25	19	13	 40708134	 40876134	 40792134
RP11-89D16	12	 1	20	13	 20858775	 20988775	 20923775
RP11-89J10	12	 2	20	13	 26724456	 26854456	 26789456
RP11-90C11	12	 3	20	13	100477930	100637276	100557603
RP11-90K7	12	 4	20	13	 48069306	 48242971	 48156138
RP11-90M15	12	 5	20	13	 24639727	 24796857	 24718292
RP11-140K16	12	 6	20	16	 82993991	 83152337	 83073164
RP11-59A12	12	 7	20	16	 83442826	 83572826	 83507826
RP11-60B6	12	 8	20	16	 83893496	 83893746	 83893621
RP11-7D23_1	12	 9	20	16	 88297301	 88465228	 88381264
RP11-368N21	12	10	20	16	 29408697	 29609853	 29509275
CTD-2007N1	12	11	20	16	   258356	   258529	   258442
RP11-81L21	12	12	20	16	 70009987	 70163285	 70086636
RP11-89C10	12	13	20	16	 64421380	 64579967	 64500673
RP11-89M4	12	14	20	16	  4523242	  4697230	  4610236
RP11-89O14	12	15	20	16	 57476831	 57653333	 57565082
RP11-89N7	12	16	20	16	 50018681	 50173498	 50096089
RP11-90H1	12	17	20	16	 53966219	 54127805	 54047012
RP11-167B4	12	18	20	16	  6165922	  6339853	  6252887
RP11-21B23	12	19	20	16	 48934950	 49090411	 49012680
RP11-2D4	12	20	20	16	 54226896	 54397137	 54312016
RP11-35P16	12	21	20	16	  4441449	  4598898	  4520173
RP11-433P17	12	22	20	16	  3292430	  3471943	  3382186
RP11-475D10	12	23	20	16	  8598165	  8783442	  8690803
RP11-42F12	12	24	20	17	 14153980	 14314061	 14234020
RP11-73F15	12	25	20	17	 26053148	 26183148	 26118148
RP11-58O8	12	 1	21	17	 30896260	 31026260	 30961260
RP11-58O9	12	 2	21	17	 35754736	 35920945	 35837840
RP11-241H2	12	 3	21	17	 35692236	 35833467	 35762851
RP11-266I24	12	 4	21	17	 38235011	 38412429	 38323720
RP11-15H6	12	 5	21	21	 26643204	 26798261	 26720732
RP11-44F3	12	 6	21	21	 26441537	 26603298	 26522417
RP11-6I7	12	 7	21	21	 26776963	 26923374	 26850168
RP11-12M14	12	 8	21	21	 31204602	 31363718	 31284160
RP11-108H5	12	 9	21	21	 26788596	 26960676	 26874636
RP11-70L17	12	10	21	21	 29576993	 29706993	 29641993
RP11-105O24	12	11	21	21	 37717327	 37872927	 37795127
RP11-66C14	12	12	21	21	 38716580	 38716946	 38716763
RP11-114H1	12	13	21	21	 41110820	 41272864	 41191842
RP11-190A24	12	14	21	21	 44148292	 44148594	 44148443
CTD-2035F24	12	15	21	21	 26174732	 26175854	 26175293
CTD-2103O7	12	16	21	21	 41752582	 41752979	 41752780
RP11-451M12	12	17	21	21	 35302676	 35500392	 35401534
RP11-100K2	12	18	21	22	 16792168	 16966188	 16879178
RP11-36N5	12	19	21	22	 20289397	 20419397	 20354397
RP11-13J4	12	20	21	22	 24221800	 24398577	 24310188
RP11-65F22	12	21	21		NA	NA	NA
RP11-5O6	12	22	21	22	 26243204	 26243615	 26243409
RP11-49M22	12	23	21	22	 43411157	 43579114	 43495135
RP11-66M5	12	24	21	22	 46600002	 46762453	 46681227
RP11-66F9	12	25	21	22	 15756122	 15931462	 15843792
CTD-2164I18	12	 1	22	22	 24443742	 24444188	 24443965
RP11-79G6	12	 2	22	22	 28896348	 29079659	 28988003
RP11-81B3	12	 3	22	22	 16792243	 16984468	 16888355
RP11-186B13	12	 4	22	18	 49166730	 49323443	 49245086
RP11-188P20	12	 5	22	03	 43292868	 43435902	 43364385
RP11-193D24	12	 6	22	06	151743714	151919380	151831547
RP11-195B17	12	 7	22	02	 27193819	 27353526	 27273672
RP11-195F19	12	 8	22	09	 34634467	 34820900	 34727683
RP11-196P12	12	 9	22	17	 31262983	 31443599	 31353291
RP11-209M4	12	10	22	17	 39047604	 39205560	 39126582
RP11-211E17	12	11	22	11	  6433952	  6626210	  6530081
RP11-213P13	12	12	22	01	 56593281	 56762346	 56677813
RP11-214N16	12	13	22	09	 76317748	 76501606	 76409677
RP11-215H18	12	14	22	11	117662914	117753170	117708042
RP11-215K24	12	15	22	03	 70082272	 70235455	 70158863
RP11-234D19	12	16	22	01	 85388186	 85485976	 85437081
RP11-237C13	12	17	22	12	109473086	109638318	109555702
RP11-240H8	12	18	22	07	 22528823	 22620015	 22574419
RP11-242D8	12	19	22	17	 38491120	 38621120	 38556120
RP11-243K18	12	20	22	16	   266993	   431803	   349398
RP11-251N10	12	21	22	01	 13805523	 13998156	 13901839
RP11-266J6	12	22	22	03	  9665620	  9852213	  9758916
RP11-269C23	12	23	22	13	 43763726	 43908562	 43836144
RP11-270G15	12	24	22	03	156238356	156401193	156319774
RP11-271O1_2	12	25	22	08	 67573801	 67732186	 67652993
RP11-272P3	12	 1	23	01	 94692701	 94892707	 94792704
RP11-275J11	12	 2	23	03	 12474739	 12625546	 12550142
RP11-552F3	12	 3	23	17	 71257310	 71461062	 71359186
RP11-556G18	12	 4	23	03	 14053910	 14216520	 14135215
RP11-557L19	12	 5	23	02	  7346655	  7453291	  7399973
RP11-560A15	12	 6	23	20	 55075395	 55200242	 55137818
RP11-564A8	12	 7	23	01	203409711	203602276	203505993
RP11-568N1	12	 8	23	02	 70552651	 70737830	 70645240
RP11-602P21	12	 9	23	06	 33276697	 33500727	 33388712
RP11-605B16	12	10	23	02	156880526	157055606	156968066
RP11-607F22	12	11	23	15	 23260672	 23452928	 23356800
RP11-608N6	12	12	23	02	157843879	158030176	157937027
RP11-613D13	12	13	23	11	 43752885	 43941852	 43847368
RP11-618A20	12	14	23	09	130252614	130425637	130339125
RP11-655A17	12	15	23	03	 87099697	 87270490	 87185093
RP11-658E8	12	16	23	02	  9531626	  9738681	  9635153
RP11-659P16	12	17	23	03	 25516684	 25705992	 25611338
RP11-667B21	12	18	23	13	 26499973	 26541591	 26520782
RP11-671C15	12	19	23	01	   849475	  1038212	   943843
RP11-675J9	12	20	23		NA	NA	NA
RP11-697H17	12	21	23	07	 79915150	 80098996	 80007073
RP11-706A13	12	22	23	11	 44198236	 44392852	 44295544
RP11-708D1	12	23	23	03	 14651544	 14803222	 14727383
RP11-713N11	12	24	23	12	 25028582	 25181819	 25105200
RP11-716A19	12	25	23	X	 16588103	 16760718	 16674410
RP11-720L3	12	 1	24	18	 13652268	 13827849	 13740058
RP11-139H14	12	 2	24	13	 45543685	 45724365	 45634025
RP11-141M3	12	 3	24	03	 42812666	 42988806	 42900736
RP11-144B2	12	 4	24	12	119040684	119225424	119133054
RP11-147K16	12	 5	24	17	  3241550	  3398993	  3320271
RP11-150L22	12	 6	24	01	239848752	240032059	239940405
RP11-158G19	12	 7	24	19	 59041159	 59235466	 59138312
RP11-177A2	12	 8	24	01	175661891	175824392	175743141
RP11-180A14	12	 9	24	01	197518664	197685966	197602315
RP11-181K3	12	10	24	01	179794770	179958854	179876812
RP11-182B22	12	11	24	01	233330840	233503593	233417216
RP11-184A2	12	12	24	10	  3722437	  3816599	  3769518
RP11-190C22	12	13	24	03	120684353	120844091	120764222
RP11-215P8	12	14	24	05	133668049	133810324	133739186
RP11-221E20	12	15	24	03	129991754	130058439	130025096
RP11-224O19	12	16	24	01	214854371	215040162	214947266
RP11-227L6	12	17	24	02	173072109	173241695	173156902
RP11-238E12	12	18	24	X	149404183	149559522	149481852
RP11-242J7	12	19	24	04	185824194	185996855	185910524
RP11-265B8	12	20	24	09	 68778952	 68967116	 68873034
RP11-275F13	12	21	24	01	 51437975	 51597421	 51517698
RP11-278J17	12	22	24	01	 51147793	 51275817	 51211805
RP11-282O18	12	23	24	12	122202693	122332693	122267693
RP11-284O21	12	24	24	11	116430107	116618856	116524481
RP11-286H15	12	25	24	02	127923137	128127280	128025208
RP11-754A4	12	 1	25	05	180044369	180214113	180129241
RP11-755I3	12	 2	25	11	 73918326	 74098054	 74008190
RP11-762B21	12	 3	25	11	122398007	122594984	122496495
RP11-791G15	12	 4	25	02	 10760770	 10952850	 10856810
RP11-795B6	12	 5	25	19	 55987852	 56202501	 56095176
RP11-799C6	12	 6	25	01	110548255	110760450	110654352
RP11-21N8	12	 7	25	03	131810603	131961221	131885912
RP11-57D16	12	 8	25	01	176568602	176725365	176646983
RP11-104N13	12	 9	25	06	165032657	165108996	165070826
RP11-138D23	12	10	25	13	 66378427	 66543031	 66460729
RP11-159D14	12	11	25	18	 48053986	 48218621	 48136303
RP11-260G22	12	12	25	02	 53032451	 53196368	 53114409
RP11-89P2	13	 1	 1	01	167230040	167360040	167295040
RP11-89P12	13	 2	 1	01	 99238716	 99368716	 99303716
RP11-90A11	13	 3	 1	01	160276140	160445402	160360771
RP11-90B21	13	 4	 1	01	180757247	180942554	180849900
RP11-90D21	13	 5	 1	01	 65959447	 66115880	 66037663
RP11-90F23	13	 6	 1	01	208746486	208899933	208823209
RP11-91C15	13	 7	 1	01	206582150	206712150	206647150
RP11-91G5	13	 8	 1	01	154391405	154547465	154469435
RP11-91G12	13	 9	 1	01	193336091	193504146	193420118
RP11-10P13	13	10	 1	01	156312582	156471292	156391937
RP11-451E8	13	11	 1	01	 69935176	 70149094	 70042135
RP11-449D21	13	12	 1	01	163432534	163614111	163523322
RP11-71J7_1	13	13	 1	02	 31327626	 31515961	 31421793
RP11-163N23_1	13	14	 1	02	 36511019	 36641019	 36576019
RP11-128C5_1	13	15	 1	02	 43985633	 43985897	 43985765
RP11-180L21_1	13	16	 1	02	 46177272	 46177583	 46177427
RP11-24P23_1	13	17	 1	02	 70462962	 70623458	 70543210
RP11-63D13_1	13	18	 1	02	 79619418	 79762286	 79690852
RP11-67J2_1	13	19	 1	02	145247715	145410543	145329129
RP11-13C20_1	13	20	 1	02	151506658	151636658	151571658
RP11-191I9_1	13	21	 1	02	156108565	156109000	156108782
RP11-39A8	13	22	 1	02	167814326	167814597	167814461
RP11-61N23_1	13	23	 1	02	175281795	175282056	175281925
RP11-95I17_1	13	24	 1	02	179380658	179554232	179467445
RP11-79F5	13	25	 1	03	 83969162	 84151891	 84060526
RP11-79H17	13	 1	 2	03	113040465	113184528	113112496
RP11-79L21	13	 2	 2	03	133974807	134122734	134048770
RP11-80H8_1	13	 3	 2	03	144202927	144394401	144298664
RP11-80H18	13	 4	 2	03	 58149198	 58327213	 58238205
RP11-80P4	13	 5	 2	04	182113271	182243271	182178271
RP11-89F18	13	 6	 2	03	 23404803	 23575751	 23490277
RP11-89H10	13	 7	 2	03	 76104466	 76262853	 76183659
RP11-89L22	13	 8	 2	03	154700298	154830298	154765298
RP11-90H15	13	 9	 2	03	 71172842	 71304638	 71238740
RP11-90I9	13	10	 2	03	 19033520	 19203548	 19118534
RP11-90I19	13	11	 2	03	105952065	106128967	106040516
RP11-91K4	13	12	 2	03	  9124754	  9283673	  9204213
RP11-91K16	13	13	 2	03	  4329969	  4517349	  4423659
RP11-91A15	13	14	 2	03	 89591682	 89771786	 89681734
RP11-91E4	13	15	 2	03	 38003978	 38133978	 38068978
RP11-91G2	13	16	 2	03	153223485	153387191	153305338
RP11-451C4	13	17	 2	03	 25697610	 25886416	 25792013
RP11-17I9	13	18	 2	04	  9681528	  9860876	  9771202
RP11-143I20	13	19	 2	04	 13468336	 13620285	 13544310
RP11-79N22	13	20	 2	04	 18456043	 18586043	 18521043
RP11-151G21	13	21	 2	04	 19970034	 20126431	 20048232
RP11-35E16	13	22	 2	04	 23220448	 23350448	 23285448
RP11-118C24	13	23	 2	04	 25256072	 25256444	 25256258
RP11-62D9	13	24	 2	05	 76265702	 76395702	 76330702
RP11-1E10	13	25	 2	05	 78923166	 78923491	 78923328
RP11-47N20	13	 1	 3	05	 81339335	 81493366	 81416350
RP11-258M21	13	 2	 3	05	 85443997	 85587282	 85515639
RP11-45O11	13	 3	 3	05	 89802072	 89802397	 89802234
RP11-10L13	13	 4	 3	10	 92760430	 92924796	 92842613
RP11-45L19	13	 5	 3	05	128180598	128337301	128258949
RP11-4E3	13	 6	 3	05	133142681	133272681	133207681
RP11-21J3	13	 7	 3	05	134423056	134591494	134507275
RP11-115I4	13	 8	 3	05	139832154	139990256	139911205
RP11-14K13	13	 9	 3	05	141626456	141800036	141713246
RP11-82P23	13	10	 3	05	148347522	148347888	148347705
RP11-88J19	13	11	 3	05	162086436	162086757	162086596
RP11-13H20	13	12	 3	05	164757642	164916683	164837162
RP11-173F9	13	13	 3	05	164851953	164981953	164916953
RP11-14K9	13	14	 3	05	168358454	168532236	168445345
RP11-182E4	13	15	 3	05	170102583	170102945	170102764
RP11-69A18	13	16	 3	05	171149816	171316611	171233213
RP11-526D16	13	17	 3	05	 95842117	 96007448	 95924782
CTD-2041D13	13	18	 3		NA	NA	NA
CTD-2129M9	13	19	 3	05	172093938	172231783	172162860
RP11-79G1	13	20	 3	05	 11123638	 11300741	 11212189
RP11-79C4	13	21	 3	05	 62788210	 62943594	 62865902
RP11-79C20	13	22	 3	05	 64662940	 64848897	 64755918
RP11-9C22	13	23	 3	07	127209175	127209520	127209347
RP11-66F23	13	24	 3	07	127949548	128131974	128040761
RP11-16N7	13	25	 3	07	129528577	129699617	129614097
RP11-129G6	13	 1	 4	07	 55905570	 55905891	 55905730
RP11-29B3	13	 2	 4	07	136957155	137112297	137034726
RP11-172L23	13	 3	 4	07	138514761	138515011	138514886
CTD-2067A9	13	 4	 4	07	 79492993	 79493269	 79493131
RP11-79G17	13	 5	 4	07	 17416667	 17590241	 17503454
RP11-79K9	13	 6	 4	07	153441322	153586968	153514145
RP11-79O7	13	 7	 4	07	 93466410	 93640947	 93553678
RP11-79G16	13	 8	 4	07	 13592499	 13742614	 13667556
RP11-79D17	13	 9	 4	07	 22805613	 22982651	 22894132
RP11-88B20	13	10	 4	07	 28559975	 28724255	 28642115
RP11-88H20	13	11	 4	07	 69908100	 70038100	 69973100
RP11-88J20	13	12	 4	07	112791448	112950877	112871162
RP11-89E20	13	13	 4	03	112584211	112730465	112657338
RP11-89O20	13	14	 4	07	112104510	112243261	112173885
RP11-89D2	13	15	 4	07	 92590064	 92720064	 92655064
RP11-90N9	13	16	 4	07	 82865102	 83012223	 82938662
RP11-90N13	13	17	 4	07	108530568	108684654	108607611
RP11-91P1	13	18	 4	07	148313994	148443994	148378994
RP11-91M13	13	19	 4	07	 86300488	 86447373	 86373930
RP11-91E1	13	20	 4	07	 78192971	 78362256	 78277613
RP11-91C6	13	21	 4	07	 65025863	 65155863	 65090863
RP11-44C14	13	22	 4	09	116238449	116403764	116321106
RP11-150L1	13	23	 4	09	117492104	117654717	117573410
RP11-85P21	13	24	 4	09	120005880	120006068	120005974
RP11-62A6	13	25	 4	09	124479347	124632312	124555829
RP11-17O4	13	 1	 5	09	129342000	129472000	129407000
RP11-40A7	13	 2	 5	09	131414549	131590323	131502436
RP11-79D13	13	 3	 5	09	 78281981	 78437177	 78359579
RP11-80F16	13	 4	 5	09	 82469581	 82631921	 82550751
RP11-80H20	13	 5	 5	09	 83627706	 83817511	 83722608
RP11-80J12	13	 6	 5	09	 25085762	 25235432	 25160597
RP11-81B11	13	 7	 5	09	 18502807	 18657760	 18580283
RP11-81L3	13	 8	 5	09	 77971499	 78142517	 78057008
RP11-89J9	13	 9	 5	09	 17225744	 17394593	 17310168
RP11-89L5	13	10	 5	09	 94362669	 94529111	 94445890
RP11-89P10	13	11	 5	09	120539847	120669847	120604847
RP11-90F15	13	12	 5	09	117904553	118034553	117969553
RP11-91D17	13	13	 5	12	  9154907	  9284907	  9219907
RP11-91N11	13	14	 5	09	108191343	108346352	108268847
RP11-59D4	13	15	 5	10	  4336670	  4491362	  4414016
RP11-85M7	13	16	 5	10	  6685013	  6815013	  6750013
RP11-5B23	13	17	 5	10	  6570235	  6700235	  6635235
RP11-72C6	13	18	 5	10	  7937407	  8067407	  8002407
RP11-29D1	13	19	 5	10	  8461380	  8461741	  8461560
RP11-197K17	13	20	 5	10	  8155992	  8156391	  8156191
RP11-217E8	13	21	 5	11	 93871959	 93918940	 93895449
RP11-56F12	13	22	 5	11	 93581796	 93739951	 93660873
RP11-13L14	13	23	 5	11	 95126424	 95307883	 95217153
RP11-267L1	13	24	 5	11	 97393198	 97534216	 97463707
RP11-5G24	13	25	 5	11	101149074	101149443	101149258
RP11-33F6	13	 1	 6	11	102367333	102497333	102432333
RP11-113M2	13	 2	 6	11	113658533	113788533	113723533
RP11-35P15	13	 3	 6	11	117022824	117194571	117108697
RP11-163A13	13	 4	 6	11	111394706	111524706	111459706
RP11-112I9	13	 5	 6	11	118055311	118220294	118137802
RP11-62A14	13	 6	 6	11	118829643	118992466	118911054
RP11-94C16	13	 7	 6	11	119453585	119453887	119453736
RP11-27H17	13	 8	 6	11	133556875	133686875	133621875
RP11-28I24	13	 9	 6	11	101722104	101886737	101804420
CTD-2029L11	13	10	 6	11	 64251009	 64251180	 64251094
CTD-2039J19	13	11	 6	11	 66238563	 66238729	 66238646
CTD-2080L19	13	12	 6	11	128186333	128187520	128186926
RP11-79E9	13	13	 6	11	 29674513	 29817914	 29746213
RP11-80P16	13	14	 6	11	 85278442	 85430245	 85354343
RP11-88H18	13	15	 6	11	102253678	102424014	102338846
RP11-89C24	13	16	 6	11	119966283	120096283	120031283
RP11-89G12	13	17	 6	11	 38672937	 38837211	 38755074
RP11-89O6	13	18	 6	11	  6473074	  6642613	  6557843
RP11-89F15	13	19	 6	11	  1299306	  1482389	  1390847
RP11-84D12	13	20	 6	14	 20534815	 20534929	 20534872
RP11-14J7	13	21	 6	14	 20007404	 20172932	 20090168
RP11-152G22	13	22	 6	14	 20306623	 20484683	 20395653
RP11-70F9	13	23	 6	14	 22278370	 22443910	 22361140
RP11-256C2	13	24	 6	14	 23608219	 23705612	 23656915
RP11-170D9	13	25	 6	14	 24938235	 25068836	 25003535
RP11-189H22	13	 1	 7	14	 40920946	 40921274	 40921110
RP11-94K16	13	 2	 7	14	 48148555	 48298851	 48223703
RP11-218E20	13	 3	 7	14	 50391555	 50566348	 50478951
RP11-262M8	13	 4	 7	14	 51766983	 51964774	 51865878
RP11-82A8	13	 5	 7	14	 51649411	 51649725	 51649568
RP11-221K16	13	 6	 7	14	 53956546	 53956682	 53956614
RP11-182D6	13	 7	 7	14	 66527720	 66528032	 66527876
RP11-74M3	13	 8	 7	14	 68410041	 68581432	 68495736
RP11-59M15	13	 9	 7	14	 69022329	 69152329	 69087329
RP11-18G18	13	10	 7	14	 69652604	 69652944	 69652774
RP11-81O20	13	11	 7	14	 75620334	 75793171	 75706752
RP11-46L17	13	12	 7	14	 78510416	 78640416	 78575416
RP11-80F23	13	13	 7	14	 95378024	 95525643	 95451833
RP11-86O9	13	14	 7	14	 99137698	 99137859	 99137778
RP11-90G22	13	15	 7	14	100210923	100389009	100299966
RP11-123M6	13	16	 7	14	100295974	100461023	100378498
CTD-2098M1	13	17	 7	08	111636977	111637144	111637060
RP11-79I3	13	18	 7	14	 61309601	 61449452	 61379526
RP11-65C22	13	19	 7	17	 68165339	 68348074	 68256706
RP11-225G19	13	20	 7	17	 69992349	 69992528	 69992438
RP11-76G4	13	21	 7	17	 70695484	 70882076	 70788780
RP11-26B13	13	22	 7	17	 74060841	 74190841	 74125841
RP11-128J1	13	23	 7	17	 74811433	 74811653	 74811543
RP11-160F4_1	13	24	 7	17	 75981826	 75982171	 75981998
RP11-88B16	13	25	 7	17	 25173283	 25351863	 25262573
RP11-89K6	13	 1	 8	17	 13030350	 13199220	 13114785
RP11-89D11	13	 2	 8	17	  7436435	  7603767	  7520101
RP11-89H15	13	 3	 8	17	 59472568	 59627245	 59549906
RP11-89L7	13	 4	 8	17	 61469371	 61644232	 61556801
RP11-90A23	13	 5	 8	17	 28794278	 28960529	 28877403
RP11-106O1	13	 6	 8	18	  3649284	  3649553	  3649418
RP11-113J12	13	 7	 8	18	  3431435	  3596336	  3513885
RP11-105C15	13	 8	 8	18	  5910724	  6063460	  5987092
RP11-67I20	13	 9	 8	18	  9999821	 10129821	 10064821
RP11-7E5	13	10	 8	18	 10732701	 10893325	 10813013
RP11-96I11	13	11	 8	18	 12904782	 12904961	 12904871
RP11-20H17	13	12	 8	18	 44018808	 44172443	 44095625
RP11-160B24	13	13	 8	18	 51861142	 51993728	 51927435
RP11-4G8	13	14	 8	18	 54598491	 54739047	 54668769
RP11-40D15	13	15	 8	18	 56872541	 56872870	 56872705
RP11-75O12	13	16	 8	18	 59638194	 59781804	 59709999
RP11-105L16	13	17	 8	18	 64478283	 64627510	 64552896
RP11-143E20	13	18	 8	X	  7483618	  7654997	  7569307
RP11-128B23	13	19	 8	X	 18594681	 18595021	 18594851
RP11-2K15	13	20	 8	X	 16758718	 16943870	 16851294
RP11-122N14	13	21	 8	X	 31276805	 31440002	 31358403
RP11-39E13	13	22	 8	X	 40903890	 40904271	 40904080
RP11-30M20	13	23	 8	X	 65045681	 65138492	 65092086
RP11-51L20	13	24	 8	X	 71230163	 71402104	 71316133
RP11-223K4	13	25	 8	X	102538076	102588520	102563298
RP11-224D23	13	 1	 9	X	110809772	110810020	110809896
RP11-80K1	13	 2	 9	X	105841731	105997832	105919781
RP11-96G7	13	 3	 9	X	126321665	126451665	126386665
RP11-155A5	13	 4	 9	X	130451442	130589797	130520619
CTD-2115P10	13	 5	 9	X	130507585	130507738	130507661
CTD-2288L23	13	 6	 9	X	132292486	132421285	132356885
RP11-79C1	13	 7	 9	X	 74011160	 74156843	 74084001
RP11-79C15	13	 8	 9	X	125308024	125458401	125383212
RP11-79A6	13	 9	 9	X	119364867	119511656	119438261
RP11-79P11	13	10	 9	04	 15120886	 15299106	 15209996
RP11-90P17	13	11	 9	X	 66078956	 66252178	 66165567
RP11-91I18	13	12	 9	X	 19000530	 19177642	 19089086
RP11-91G23	13	13	 9	X	 79069193	 79229466	 79149329
RP11-451A4	13	14	 9	X	 67961262	 68112580	 68036921
RP11-65G9	13	15	 9	Y	 21486309	 21651188	 21568748
RP11-247J14	13	16	 9		NA	NA	NA
RP11-288O18	13	17	 9		NA	NA	NA
RP11-290H9	13	18	 9	17	 42648240	 42822806	 42735523
RP11-291A16	13	19	 9	01	 40431821	 40597650	 40514735
RP11-291N5	13	20	 9	04	104378741	104547052	104462896
RP11-292P13	13	21	 9	15	 42756153	 42947129	 42851641
RP11-295N18	13	22	 9	02	148358041	148546394	148452217
RP11-305D15	13	23	 9	13	 47760579	 47897921	 47829250
RP11-312E2	13	24	 9	02	175638479	175813124	175725801
RP11-313J18	13	25	 9	08	 41825740	 42044367	 41935053
RP11-314C9	13	 1	10	02	 38190939	 38400095	 38295517
RP11-316E19	13	 2	10	08	134021976	134180369	134101172
RP11-316M21_2	13	 3	10	10	101835645	102030561	101933103
RP11-324F21	13	 4	10	07	 65973863	 66145651	 66059757
RP11-325E17	13	 5	10	01	 46425202	 46624292	 46524747
RP11-327O12	13	 6	10	08	 84969859	 85116885	 85043372
RP11-329K12	13	 7	10	14	 29020850	 29163547	 29092198
RP11-330I7	13	 8	10	19	  6523443	  6701804	  6612623
RP11-331F9	13	 9	10	09	 35581888	 35670216	 35626052
RP11-339H12	13	10	10	02	 43250441	 43465973	 43358207
RP11-340A14	13	11	10	07	 75774949	 75789424	 75782186
RP11-342D11	13	12	10	10	 33416407	 33594590	 33505498
RP11-342K6	13	13	10	02	 75725891	 75924478	 75825184
RP11-345K20	13	14	10	10	 74746892	 74955234	 74851063
RP11-346I8	13	15	10	09	 83801647	 84004502	 83903074
RP11-746M1	13	16	10	17	 20819113	 21055082	 20937097
RP11-749I16	13	17	10	17	 35464796	 35659588	 35562192
RP11-752I11	13	18	10	18	  5167933	  5335476	  5251704
RP11-757C15	13	19	10	11	 71236121	 71432551	 71334336
RP11-762M18	13	20	10	15	 74957586	 75112717	 75035151
RP11-774I22	13	21	10	12	 52058834	 52240720	 52149777
RP11-796A5	13	22	10	11	 88548675	 88696036	 88622355
RP11-799B12	13	23	10	18	 19900452	 20090215	 19995333
RP11-801M10	13	24	10	01	 32039879	 32268386	 32154132
RP11-803J6	13	25	10	02	219795869	219968129	219881999
RP11-808B21	13	 1	11	04	  2703937	  2914995	  2809466
RP11-813J7	13	 2	11	07	 73536367	 73705979	 73621173
RP11-890D8	13	 3	11	11	101687334	101727299	101707316
RP11-948G15	13	 4	11	17	 38235011	 38425999	 38330505
RP11-956N15	13	 5	11	09	 90543050	 90741551	 90642300
RP11-973D8	13	 6	11	12	 54583953	 54651150	 54617551
RP11-1021O19	13	 7	11	10	 38379741	 38399594	 38389667
RP11-1094M14	13	 8	11	17	 30763584	 30945123	 30854353
RP11-104D9	13	 9	11	06	135408214	135589039	135498626
RP11-113D19	13	10	11	09	 20996400	 21158464	 21077432
RP11-134N3	13	11	11	07	 88830747	 89004241	 88917494
RP11-180M15_2	13	12	11	12	 12614232	 12772124	 12693178
RP11-240O9	13	13	11	03	187990397	188060966	188025681
RP11-295P2	13	14	11	02	 47443801	 47615788	 47529794
RP11-301H24	13	15	11	04	146696701	146862630	146779665
RP11-304L19	13	16	11	16	  2067654	  2267413	  2167533
RP11-307C12	13	17	11	01	151657111	151839277	151748194
RP11-313I2	13	18	11	11	 88959978	 89158872	 89059425
RP11-320F15	13	19	11	10	 92621333	 92671444	 92646388
RP11-321A17	13	20	11	17	 24318011	 24516677	 24417344
RP11-345J6	13	21	11	03	 32006659	 32204802	 32105730
RP11-346J19	13	22	11	06	 32135717	 32352214	 32243965
RP11-347C18	13	23	11	08	 95916612	 96081538	 95999075
RP11-348G16	13	24	11	02	108690206	108869724	108779965
RP11-351D16	13	25	11	10	 42817196	 43022992	 42920094
RP11-353K12	13	 1	12	08	 20005292	 20179287	 20092289
RP11-370F5	13	 2	12	09	 92940840	 93116637	 93028738
RP11-372E15	13	 3	12	07	132155848	132317490	132236669
RP11-373L24	13	 4	12	02	 60985331	 61194391	 61089861
RP11-376O6	13	 5	12	04	178545765	178737430	178641597
RP11-380D11	13	 6	12	15	 39583714	 39754407	 39669060
RP11-380P16	13	 7	12	09	 21210771	 21335262	 21273016
RP11-400F19	13	 8	12	17	 37904425	 38083571	 37993998
RP11-401M16	13	 9	12	01	 20549992	 20745068	 20647530
RP11-403P17	13	10	12	16	 65069420	 65257963	 65163691
RP11-404F10	13	11	12	01	157395586	157591565	157493575
RP11-408B11	13	12	12	12	 84189643	 84356816	 84273229
RP11-416L21	13	13	12	02	 60746249	 60928550	 60837399
RP11-803A13	13	14	12	02	130723399	130890118	130806758
RP11-806H10	13	15	12	17	 73845425	 73945627	 73895526
RP11-809N8	13	16	12	11	 72767211	 72957131	 72862171
RP11-811J9	13	17	12	07	142594566	142666611	142630588
RP11-823E8	13	18	12	12	 88070767	 88249918	 88160342
RP11-845M18	13	19	12	12	 50803959	 50962257	 50883108
RP11-299C5	13	20	12	02	 42391940	 42576891	 42484415
RP11-383M2	13	21	12	X	 85514242	 85537842	 85526042
RP11-430I3	13	22	12	13	 59572764	 59746364	 59659564
RP11-487M22	13	23	12	X	 28209582	 28385141	 28297361
RP11-570O20	13	24	12	X	143807739	143876865	143842302
RP11-665J20	13	25	12	12	119716714	119811260	119763987
RP11-89P2	13	13	13	01	167230040	167360040	167295040
RP11-89P12	13	14	13	01	 99238716	 99368716	 99303716
RP11-90A11	13	15	13	01	160276140	160445402	160360771
RP11-90B21	13	16	13	01	180757247	180942554	180849900
RP11-90D21	13	17	13	01	 65959447	 66115880	 66037663
RP11-90F23	13	18	13	01	208746486	208899933	208823209
RP11-91C15	13	19	13	01	206582150	206712150	206647150
RP11-91G5	13	20	13	01	154391405	154547465	154469435
RP11-91G12	13	21	13	01	193336091	193504146	193420118
RP11-10P13	13	22	13	01	156312582	156471292	156391937
RP11-451E8	13	23	13	01	 69935176	 70149094	 70042135
RP11-449D21	13	24	13	01	163432534	163614111	163523322
RP11-71J7_1	13	25	13	02	 31327626	 31515961	 31421793
RP11-163N23_1	13	 1	14	02	 36511019	 36641019	 36576019
RP11-128C5_1	13	 2	14	02	 43985633	 43985897	 43985765
RP11-180L21_1	13	 3	14	02	 46177272	 46177583	 46177427
RP11-24P23_1	13	 4	14	02	 70462962	 70623458	 70543210
RP11-63D13_1	13	 5	14	02	 79619418	 79762286	 79690852
RP11-67J2_1	13	 6	14	02	145247715	145410543	145329129
RP11-13C20_1	13	 7	14	02	151506658	151636658	151571658
RP11-191I9_1	13	 8	14	02	156108565	156109000	156108782
RP11-39A8	13	 9	14	02	167814326	167814597	167814461
RP11-61N23_1	13	10	14	02	175281795	175282056	175281925
RP11-95I17_1	13	11	14	02	179380658	179554232	179467445
RP11-79F5	13	12	14	03	 83969162	 84151891	 84060526
RP11-79H17	13	13	14	03	113040465	113184528	113112496
RP11-79L21	13	14	14	03	133974807	134122734	134048770
RP11-80H8_1	13	15	14	03	144202927	144394401	144298664
RP11-80H18	13	16	14	03	 58149198	 58327213	 58238205
RP11-80P4	13	17	14	04	182113271	182243271	182178271
RP11-89F18	13	18	14	03	 23404803	 23575751	 23490277
RP11-89H10	13	19	14	03	 76104466	 76262853	 76183659
RP11-89L22	13	20	14	03	154700298	154830298	154765298
RP11-90H15	13	21	14	03	 71172842	 71304638	 71238740
RP11-90I9	13	22	14	03	 19033520	 19203548	 19118534
RP11-90I19	13	23	14	03	105952065	106128967	106040516
RP11-91K4	13	24	14	03	  9124754	  9283673	  9204213
RP11-91K16	13	25	14	03	  4329969	  4517349	  4423659
RP11-91A15	13	 1	15	03	 89591682	 89771786	 89681734
RP11-91E4	13	 2	15	03	 38003978	 38133978	 38068978
RP11-91G2	13	 3	15	03	153223485	153387191	153305338
RP11-451C4	13	 4	15	03	 25697610	 25886416	 25792013
RP11-17I9	13	 5	15	04	  9681528	  9860876	  9771202
RP11-143I20	13	 6	15	04	 13468336	 13620285	 13544310
RP11-79N22	13	 7	15	04	 18456043	 18586043	 18521043
RP11-151G21	13	 8	15	04	 19970034	 20126431	 20048232
RP11-35E16	13	 9	15	04	 23220448	 23350448	 23285448
RP11-118C24	13	10	15	04	 25256072	 25256444	 25256258
RP11-62D9	13	11	15	05	 76265702	 76395702	 76330702
RP11-1E10	13	12	15	05	 78923166	 78923491	 78923328
RP11-47N20	13	13	15	05	 81339335	 81493366	 81416350
RP11-258M21	13	14	15	05	 85443997	 85587282	 85515639
RP11-45O11	13	15	15	05	 89802072	 89802397	 89802234
RP11-10L13	13	16	15	10	 92760430	 92924796	 92842613
RP11-45L19	13	17	15	05	128180598	128337301	128258949
RP11-4E3	13	18	15	05	133142681	133272681	133207681
RP11-21J3	13	19	15	05	134423056	134591494	134507275
RP11-115I4	13	20	15	05	139832154	139990256	139911205
RP11-14K13	13	21	15	05	141626456	141800036	141713246
RP11-82P23	13	22	15	05	148347522	148347888	148347705
RP11-88J19	13	23	15	05	162086436	162086757	162086596
RP11-13H20	13	24	15	05	164757642	164916683	164837162
RP11-173F9	13	25	15	05	164851953	164981953	164916953
RP11-14K9	13	 1	16	05	168358454	168532236	168445345
RP11-182E4	13	 2	16	05	170102583	170102945	170102764
RP11-69A18	13	 3	16	05	171149816	171316611	171233213
RP11-526D16	13	 4	16	05	 95842117	 96007448	 95924782
CTD-2041D13	13	 5	16		NA	NA	NA
CTD-2129M9	13	 6	16	05	172093938	172231783	172162860
RP11-79G1	13	 7	16	05	 11123638	 11300741	 11212189
RP11-79C4	13	 8	16	05	 62788210	 62943594	 62865902
RP11-79C20	13	 9	16	05	 64662940	 64848897	 64755918
RP11-9C22	13	10	16	07	127209175	127209520	127209347
RP11-66F23	13	11	16	07	127949548	128131974	128040761
RP11-16N7	13	12	16	07	129528577	129699617	129614097
RP11-129G6	13	13	16	07	 55905570	 55905891	 55905730
RP11-29B3	13	14	16	07	136957155	137112297	137034726
RP11-172L23	13	15	16	07	138514761	138515011	138514886
CTD-2067A9	13	16	16	07	 79492993	 79493269	 79493131
RP11-79G17	13	17	16	07	 17416667	 17590241	 17503454
RP11-79K9	13	18	16	07	153441322	153586968	153514145
RP11-79O7	13	19	16	07	 93466410	 93640947	 93553678
RP11-79G16	13	20	16	07	 13592499	 13742614	 13667556
RP11-79D17	13	21	16	07	 22805613	 22982651	 22894132
RP11-88B20	13	22	16	07	 28559975	 28724255	 28642115
RP11-88H20	13	23	16	07	 69908100	 70038100	 69973100
RP11-88J20	13	24	16	07	112791448	112950877	112871162
RP11-89E20	13	25	16	03	112584211	112730465	112657338
RP11-89O20	13	 1	17	07	112104510	112243261	112173885
RP11-89D2	13	 2	17	07	 92590064	 92720064	 92655064
RP11-90N9	13	 3	17	07	 82865102	 83012223	 82938662
RP11-90N13	13	 4	17	07	108530568	108684654	108607611
RP11-91P1	13	 5	17	07	148313994	148443994	148378994
RP11-91M13	13	 6	17	07	 86300488	 86447373	 86373930
RP11-91E1	13	 7	17	07	 78192971	 78362256	 78277613
RP11-91C6	13	 8	17	07	 65025863	 65155863	 65090863
RP11-44C14	13	 9	17	09	116238449	116403764	116321106
RP11-150L1	13	10	17	09	117492104	117654717	117573410
RP11-85P21	13	11	17	09	120005880	120006068	120005974
RP11-62A6	13	12	17	09	124479347	124632312	124555829
RP11-17O4	13	13	17	09	129342000	129472000	129407000
RP11-40A7	13	14	17	09	131414549	131590323	131502436
RP11-79D13	13	15	17	09	 78281981	 78437177	 78359579
RP11-80F16	13	16	17	09	 82469581	 82631921	 82550751
RP11-80H20	13	17	17	09	 83627706	 83817511	 83722608
RP11-80J12	13	18	17	09	 25085762	 25235432	 25160597
RP11-81B11	13	19	17	09	 18502807	 18657760	 18580283
RP11-81L3	13	20	17	09	 77971499	 78142517	 78057008
RP11-89J9	13	21	17	09	 17225744	 17394593	 17310168
RP11-89L5	13	22	17	09	 94362669	 94529111	 94445890
RP11-89P10	13	23	17	09	120539847	120669847	120604847
RP11-90F15	13	24	17	09	117904553	118034553	117969553
RP11-91D17	13	25	17	12	  9154907	  9284907	  9219907
RP11-91N11	13	 1	18	09	108191343	108346352	108268847
RP11-59D4	13	 2	18	10	  4336670	  4491362	  4414016
RP11-85M7	13	 3	18	10	  6685013	  6815013	  6750013
RP11-5B23	13	 4	18	10	  6570235	  6700235	  6635235
RP11-72C6	13	 5	18	10	  7937407	  8067407	  8002407
RP11-29D1	13	 6	18	10	  8461380	  8461741	  8461560
RP11-197K17	13	 7	18	10	  8155992	  8156391	  8156191
RP11-217E8	13	 8	18	11	 93871959	 93918940	 93895449
RP11-56F12	13	 9	18	11	 93581796	 93739951	 93660873
RP11-13L14	13	10	18	11	 95126424	 95307883	 95217153
RP11-267L1	13	11	18	11	 97393198	 97534216	 97463707
RP11-5G24	13	12	18	11	101149074	101149443	101149258
RP11-33F6	13	13	18	11	102367333	102497333	102432333
RP11-113M2	13	14	18	11	113658533	113788533	113723533
RP11-35P15	13	15	18	11	117022824	117194571	117108697
RP11-163A13	13	16	18	11	111394706	111524706	111459706
RP11-112I9	13	17	18	11	118055311	118220294	118137802
RP11-62A14	13	18	18	11	118829643	118992466	118911054
RP11-94C16	13	19	18	11	119453585	119453887	119453736
RP11-27H17	13	20	18	11	133556875	133686875	133621875
RP11-28I24	13	21	18	11	101722104	101886737	101804420
CTD-2029L11	13	22	18	11	 64251009	 64251180	 64251094
CTD-2039J19	13	23	18	11	 66238563	 66238729	 66238646
CTD-2080L19	13	24	18	11	128186333	128187520	128186926
RP11-79E9	13	25	18	11	 29674513	 29817914	 29746213
RP11-80P16	13	 1	19	11	 85278442	 85430245	 85354343
RP11-88H18	13	 2	19	11	102253678	102424014	102338846
RP11-89C24	13	 3	19	11	119966283	120096283	120031283
RP11-89G12	13	 4	19	11	 38672937	 38837211	 38755074
RP11-89O6	13	 5	19	11	  6473074	  6642613	  6557843
RP11-89F15	13	 6	19	11	  1299306	  1482389	  1390847
RP11-84D12	13	 7	19	14	 20534815	 20534929	 20534872
RP11-14J7	13	 8	19	14	 20007404	 20172932	 20090168
RP11-152G22	13	 9	19	14	 20306623	 20484683	 20395653
RP11-70F9	13	10	19	14	 22278370	 22443910	 22361140
RP11-256C2	13	11	19	14	 23608219	 23705612	 23656915
RP11-170D9	13	12	19	14	 24938235	 25068836	 25003535
RP11-189H22	13	13	19	14	 40920946	 40921274	 40921110
RP11-94K16	13	14	19	14	 48148555	 48298851	 48223703
RP11-218E20	13	15	19	14	 50391555	 50566348	 50478951
RP11-262M8	13	16	19	14	 51766983	 51964774	 51865878
RP11-82A8	13	17	19	14	 51649411	 51649725	 51649568
RP11-221K16	13	18	19	14	 53956546	 53956682	 53956614
RP11-182D6	13	19	19	14	 66527720	 66528032	 66527876
RP11-74M3	13	20	19	14	 68410041	 68581432	 68495736
RP11-59M15	13	21	19	14	 69022329	 69152329	 69087329
RP11-18G18	13	22	19	14	 69652604	 69652944	 69652774
RP11-81O20	13	23	19	14	 75620334	 75793171	 75706752
RP11-46L17	13	24	19	14	 78510416	 78640416	 78575416
RP11-80F23	13	25	19	14	 95378024	 95525643	 95451833
RP11-86O9	13	 1	20	14	 99137698	 99137859	 99137778
RP11-90G22	13	 2	20	14	100210923	100389009	100299966
RP11-123M6	13	 3	20	14	100295974	100461023	100378498
CTD-2098M1	13	 4	20	08	111636977	111637144	111637060
RP11-79I3	13	 5	20	14	 61309601	 61449452	 61379526
RP11-65C22	13	 6	20	17	 68165339	 68348074	 68256706
RP11-225G19	13	 7	20	17	 69992349	 69992528	 69992438
RP11-76G4	13	 8	20	17	 70695484	 70882076	 70788780
RP11-26B13	13	 9	20	17	 74060841	 74190841	 74125841
RP11-128J1	13	10	20	17	 74811433	 74811653	 74811543
RP11-160F4_1	13	11	20	17	 75981826	 75982171	 75981998
RP11-88B16	13	12	20	17	 25173283	 25351863	 25262573
RP11-89K6	13	13	20	17	 13030350	 13199220	 13114785
RP11-89D11	13	14	20	17	  7436435	  7603767	  7520101
RP11-89H15	13	15	20	17	 59472568	 59627245	 59549906
RP11-89L7	13	16	20	17	 61469371	 61644232	 61556801
RP11-90A23	13	17	20	17	 28794278	 28960529	 28877403
RP11-106O1	13	18	20	18	  3649284	  3649553	  3649418
RP11-113J12	13	19	20	18	  3431435	  3596336	  3513885
RP11-105C15	13	20	20	18	  5910724	  6063460	  5987092
RP11-67I20	13	21	20	18	  9999821	 10129821	 10064821
RP11-7E5	13	22	20	18	 10732701	 10893325	 10813013
RP11-96I11	13	23	20	18	 12904782	 12904961	 12904871
RP11-20H17	13	24	20	18	 44018808	 44172443	 44095625
RP11-160B24	13	25	20	18	 51861142	 51993728	 51927435
RP11-4G8	13	 1	21	18	 54598491	 54739047	 54668769
RP11-40D15	13	 2	21	18	 56872541	 56872870	 56872705
RP11-75O12	13	 3	21	18	 59638194	 59781804	 59709999
RP11-105L16	13	 4	21	18	 64478283	 64627510	 64552896
RP11-143E20	13	 5	21	X	  7483618	  7654997	  7569307
RP11-128B23	13	 6	21	X	 18594681	 18595021	 18594851
RP11-2K15	13	 7	21	X	 16758718	 16943870	 16851294
RP11-122N14	13	 8	21	X	 31276805	 31440002	 31358403
RP11-39E13	13	 9	21	X	 40903890	 40904271	 40904080
RP11-30M20	13	10	21	X	 65045681	 65138492	 65092086
RP11-51L20	13	11	21	X	 71230163	 71402104	 71316133
RP11-223K4	13	12	21	X	102538076	102588520	102563298
RP11-224D23	13	13	21	X	110809772	110810020	110809896
RP11-80K1	13	14	21	X	105841731	105997832	105919781
RP11-96G7	13	15	21	X	126321665	126451665	126386665
RP11-155A5	13	16	21	X	130451442	130589797	130520619
CTD-2115P10	13	17	21	X	130507585	130507738	130507661
CTD-2288L23	13	18	21	X	132292486	132421285	132356885
RP11-79C1	13	19	21	X	 74011160	 74156843	 74084001
RP11-79C15	13	20	21	X	125308024	125458401	125383212
RP11-79A6	13	21	21	X	119364867	119511656	119438261
RP11-79P11	13	22	21	04	 15120886	 15299106	 15209996
RP11-90P17	13	23	21	X	 66078956	 66252178	 66165567
RP11-91I18	13	24	21	X	 19000530	 19177642	 19089086
RP11-91G23	13	25	21	X	 79069193	 79229466	 79149329
RP11-451A4	13	 1	22	X	 67961262	 68112580	 68036921
RP11-65G9	13	 2	22	Y	 21486309	 21651188	 21568748
RP11-247J14	13	 3	22		NA	NA	NA
RP11-288O18	13	 4	22		NA	NA	NA
RP11-290H9	13	 5	22	17	 42648240	 42822806	 42735523
RP11-291A16	13	 6	22	01	 40431821	 40597650	 40514735
RP11-291N5	13	 7	22	04	104378741	104547052	104462896
RP11-292P13	13	 8	22	15	 42756153	 42947129	 42851641
RP11-295N18	13	 9	22	02	148358041	148546394	148452217
RP11-305D15	13	10	22	13	 47760579	 47897921	 47829250
RP11-312E2	13	11	22	02	175638479	175813124	175725801
RP11-313J18	13	12	22	08	 41825740	 42044367	 41935053
RP11-314C9	13	13	22	02	 38190939	 38400095	 38295517
RP11-316E19	13	14	22	08	134021976	134180369	134101172
RP11-316M21_2	13	15	22	10	101835645	102030561	101933103
RP11-324F21	13	16	22	07	 65973863	 66145651	 66059757
RP11-325E17	13	17	22	01	 46425202	 46624292	 46524747
RP11-327O12	13	18	22	08	 84969859	 85116885	 85043372
RP11-329K12	13	19	22	14	 29020850	 29163547	 29092198
RP11-330I7	13	20	22	19	  6523443	  6701804	  6612623
RP11-331F9	13	21	22	09	 35581888	 35670216	 35626052
RP11-339H12	13	22	22	02	 43250441	 43465973	 43358207
RP11-340A14	13	23	22	07	 75774949	 75789424	 75782186
RP11-342D11	13	24	22	10	 33416407	 33594590	 33505498
RP11-342K6	13	25	22	02	 75725891	 75924478	 75825184
RP11-345K20	13	 1	23	10	 74746892	 74955234	 74851063
RP11-346I8	13	 2	23	09	 83801647	 84004502	 83903074
RP11-746M1	13	 3	23	17	 20819113	 21055082	 20937097
RP11-749I16	13	 4	23	17	 35464796	 35659588	 35562192
RP11-752I11	13	 5	23	18	  5167933	  5335476	  5251704
RP11-757C15	13	 6	23	11	 71236121	 71432551	 71334336
RP11-762M18	13	 7	23	15	 74957586	 75112717	 75035151
RP11-774I22	13	 8	23	12	 52058834	 52240720	 52149777
RP11-796A5	13	 9	23	11	 88548675	 88696036	 88622355
RP11-799B12	13	10	23	18	 19900452	 20090215	 19995333
RP11-801M10	13	11	23	01	 32039879	 32268386	 32154132
RP11-803J6	13	12	23	02	219795869	219968129	219881999
RP11-808B21	13	13	23	04	  2703937	  2914995	  2809466
RP11-813J7	13	14	23	07	 73536367	 73705979	 73621173
RP11-890D8	13	15	23	11	101687334	101727299	101707316
RP11-948G15	13	16	23	17	 38235011	 38425999	 38330505
RP11-956N15	13	17	23	09	 90543050	 90741551	 90642300
RP11-973D8	13	18	23	12	 54583953	 54651150	 54617551
RP11-1021O19	13	19	23	10	 38379741	 38399594	 38389667
RP11-1094M14	13	20	23	17	 30763584	 30945123	 30854353
RP11-104D9	13	21	23	06	135408214	135589039	135498626
RP11-113D19	13	22	23	09	 20996400	 21158464	 21077432
RP11-134N3	13	23	23	07	 88830747	 89004241	 88917494
RP11-180M15_2	13	24	23	12	 12614232	 12772124	 12693178
RP11-240O9	13	25	23	03	187990397	188060966	188025681
RP11-295P2	13	 1	24	02	 47443801	 47615788	 47529794
RP11-301H24	13	 2	24	04	146696701	146862630	146779665
RP11-304L19	13	 3	24	16	  2067654	  2267413	  2167533
RP11-307C12	13	 4	24	01	151657111	151839277	151748194
RP11-313I2	13	 5	24	11	 88959978	 89158872	 89059425
RP11-320F15	13	 6	24	10	 92621333	 92671444	 92646388
RP11-321A17	13	 7	24	17	 24318011	 24516677	 24417344
RP11-345J6	13	 8	24	03	 32006659	 32204802	 32105730
RP11-346J19	13	 9	24	06	 32135717	 32352214	 32243965
RP11-347C18	13	10	24	08	 95916612	 96081538	 95999075
RP11-348G16	13	11	24	02	108690206	108869724	108779965
RP11-351D16	13	12	24	10	 42817196	 43022992	 42920094
RP11-353K12	13	13	24	08	 20005292	 20179287	 20092289
RP11-370F5	13	14	24	09	 92940840	 93116637	 93028738
RP11-372E15	13	15	24	07	132155848	132317490	132236669
RP11-373L24	13	16	24	02	 60985331	 61194391	 61089861
RP11-376O6	13	17	24	04	178545765	178737430	178641597
RP11-380D11	13	18	24	15	 39583714	 39754407	 39669060
RP11-380P16	13	19	24	09	 21210771	 21335262	 21273016
RP11-400F19	13	20	24	17	 37904425	 38083571	 37993998
RP11-401M16	13	21	24	01	 20549992	 20745068	 20647530
RP11-403P17	13	22	24	16	 65069420	 65257963	 65163691
RP11-404F10	13	23	24	01	157395586	157591565	157493575
RP11-408B11	13	24	24	12	 84189643	 84356816	 84273229
RP11-416L21	13	25	24	02	 60746249	 60928550	 60837399
RP11-803A13	13	 1	25	02	130723399	130890118	130806758
RP11-806H10	13	 2	25	17	 73845425	 73945627	 73895526
RP11-809N8	13	 3	25	11	 72767211	 72957131	 72862171
RP11-811J9	13	 4	25	07	142594566	142666611	142630588
RP11-823E8	13	 5	25	12	 88070767	 88249918	 88160342
RP11-845M18	13	 6	25	12	 50803959	 50962257	 50883108
RP11-299C5	13	 7	25	02	 42391940	 42576891	 42484415
RP11-383M2	13	 8	25	X	 85514242	 85537842	 85526042
RP11-430I3	13	 9	25	13	 59572764	 59746364	 59659564
RP11-487M22	13	10	25	X	 28209582	 28385141	 28297361
RP11-570O20	13	11	25	X	143807739	143876865	143842302
RP11-665J20	13	12	25	12	119716714	119811260	119763987
RP11-68H19	14	 1	 1	02	225417762	225589573	225503667
RP11-71H20_1	14	 2	 1	02	231937955	232067955	232002955
RP11-156M13_1	14	 3	 1		NA	NA	NA
RP11-116M19_1	14	 4	 1	02	236411955	236412301	236412128
RP11-32C20	14	 5	 1	02	130417762	130583205	130500483
RP11-375P12	14	 6	 1	02	 12289583	 12376807	 12333195
RP11-79O3	14	 7	 1	02	 80208045	 80369529	 80288787
RP11-79C24	14	 8	 1	02	211213228	211372780	211293004
RP11-79B5	14	 9	 1	02	155401610	155575129	155488369
RP11-79H11	14	10	 1	02	 65046653	 65176653	 65111653
RP11-80D14	14	11	 1	02	171093941	171255093	171174517
RP11-80L12	14	12	 1	02	135823329	135975853	135899591
RP11-88F6	14	13	 1	02	 26705178	 26873941	 26789559
RP11-88F20	14	14	 1	02	 64691266	 64873006	 64782136
RP11-88L20	14	15	 1	02	190273172	190460864	190367018
RP11-88P18	14	16	 1	02	238420472	238550472	238485472
RP11-88P24	14	17	 1	02	214989288	215119288	215054288
RP11-89G16	14	18	 1	02	 49511077	 49665844	 49588460
RP11-89J16	14	19	 1	02	198545587	198675587	198610587
RP11-89P16	14	20	 1	02	 36551269	 36681269	 36616269
RP11-90C5	14	21	 1	02	188460313	188617368	188538840
RP11-90C9	14	22	 1	02	 77191967	 77352881	 77272424
RP11-90B13	14	23	 1	02	 64117413	 64266763	 64192088
RP11-90D19	14	24	 1	02	206810017	206978260	206894138
RP11-108H14	14	25	 1	04	 36998587	 37199746	 37099166
RP11-126C7	14	 1	 2	04	 38087293	 38242092	 38164692
RP11-264N7	14	 2	 2	04	 41202372	 41364564	 41283468
RP11-138F23	14	 3	 2	04	 40652443	 40782443	 40717443
RP11-105F21	14	 4	 2	04	 44664722	 44822922	 44743822
RP11-238D1	14	 5	 2	04	 45646447	 45776447	 45711447
RP11-42G2	14	 6	 2	04	 61933914	 62106390	 62020152
RP11-234L24	14	 7	 2	04	 67579974	 67580291	 67580132
RP11-121P15	14	 8	 2	04	 71432007	 71562007	 71497007
RP11-155P6	14	 9	 2	04	 74322497	 74453501	 74387999
RP11-94K4	14	10	 2	04	 75100494	 75282835	 75191664
RP11-80I4	14	11	 2	04	 76270171	 76429795	 76349983
RP11-31I17	14	12	 2	04	 86665470	 86665657	 86665563
RP11-130O10	14	13	 2	04	 87637254	 87638014	 87637634
RP11-17P8	14	14	 2	04	 89759710	 89945876	 89852793
RP11-132F20	14	15	 2	04	 90489952	 90490295	 90490123
RP11-221M14	14	16	 2	04	 91609027	 91609237	 91609132
RP11-16I17	14	17	 2	04	 94801023	 94976533	 94888778
RP11-101N17	14	18	 2	04	120563175	120720926	120642050
RP11-32D22	14	19	 2	04	123965076	123965435	123965255
RP11-130M1	14	20	 2	04	124105467	124173602	124139534
RP11-107E21	14	21	 2	04	125033842	125203885	125118863
RP11-2L11	14	22	 2	01	 14887436	 15017436	 14952436
RP11-11P20	14	23	 2	04	128874744	129034162	128954453
RP11-88H2	14	24	 2	05	146178673	146333305	146255989
RP11-88J2	14	25	 2	05	 70983509	 71169783	 71076646
RP11-88L14	14	 1	 3	05	110411340	110574795	110493067
RP11-88L18_2	14	 2	 3	05	 17465419	 17636603	 17551011
RP11-89G4_1	14	 3	 3	05	131752034	131921419	131836726
RP11-89F5	14	 4	 3	05	105746748	105918961	105832854
RP11-90N23_2	14	 5	 3	05	159818160	159984761	159901460
RP11-91L13	14	 6	 3	05	 24374566	 24551479	 24463022
RP11-91M11	14	 7	 3	05	 73253814	 73423047	 73338430
RP11-91I22	14	 8	 3	05	 50107903	 50274622	 50191262
RP11-91M12	14	 9	 3	05	  9865613	 10044066	  9954839
RP11-91E7	14	10	 3	05	  9086318	  9240476	  9163397
RP11-177C16	14	11	 3	06	  7367940	  7560439	  7464189
RP11-66E14	14	12	 3	06	  8798647	  8798996	  8798821
RP11-83B17	14	13	 3	06	 14557159	 14557429	 14557294
RP11-88E14	14	14	 3	06	 16498740	 16499114	 16498927
RP11-22P23	14	15	 3	06	 17056003	 17056373	 17056188
RP11-159C8	14	16	 3	06	 20442776	 20622576	 20532676
RP11-174E21	14	17	 3	06	 37652029	 37652377	 37652203
RP11-136C6	14	18	 3	06	 39212774	 39385513	 39299143
RP11-14G23	14	19	 3	06	 40452868	 40632593	 40542730
RP11-91H14	14	20	 3	06	 43872302	 44044656	 43958479
RP11-3M23	14	21	 3	06	 47418696	 47419048	 47418872
RP11-58P9	14	22	 3	06	 48122069	 48252069	 48187069
RP11-235I5_1	14	23	 3	08	 11538839	 11721811	 11630325
RP11-254E10	14	24	 3	08	 11164155	 11164458	 11164306
RP11-235F10	14	25	 3	08	  9234674	  9381782	  9308228
RP11-112G9	14	 1	 4	08	 10038624	 10226504	 10132564
RP11-252K12	14	 2	 4	08	 10893274	 11073332	 10983303
RP11-31B7	14	 3	 4	08	 12684851	 12814851	 12749851
RP11-89M8_1	14	 4	 4	08	 22779033	 22949883	 22864458
RP11-76B12	14	 5	 4	08	 25245633	 25375633	 25310633
RP11-164H24	14	 6	 4	08	 25349758	 25479758	 25414758
RP11-232J22	14	 7	 4	08	 26316409	 26446409	 26381409
RP11-116F9	14	 8	 4	08	 28140630	 28270630	 28205630
RP11-188F16	14	 9	 4	08	 28762956	 28763299	 28763127
RP11-100B16	14	10	 4	08	 38358838	 38522417	 38440627
RP11-133O7	14	11	 4	08	 39956893	 40086893	 40021893
RP11-48D21	14	12	 4	08	 40583162	 40742585	 40662873
RP11-213C20	14	13	 4	08	 42361448	 42528859	 42445153
RP11-73M19	14	14	 4	08	 43102830	 43270290	 43186560
RP11-12L15_1	14	15	 4	08	 47924445	 48076131	 48000288
RP11-234F8	14	16	 4	08	 64090116	 64090566	 64090341
RP11-182B21	14	17	 4	08	 65371846	 65372228	 65372037
RP11-282D10	14	18	 4	08	 67411074	 67411334	 67411204
RP11-271O1_1	14	19	 4	08	 67573801	 67732186	 67652993
RP11-148M7	14	20	 4	08	 73660083	 73829609	 73744846
RP11-107F3	14	21	 4	08	 74334389	 74496719	 74415554
RP11-43K6	14	22	 4	10	 21903086	 22067760	 21985423
RP11-18B14	14	23	 4	10	 21805410	 21935410	 21870410
RP11-73J23	14	24	 4	10	 23622100	 23752100	 23687100
RP11-176P2	14	25	 4	10	 24596174	 24736301	 24666237
RP11-66P13	14	 1	 5	10	 26528582	 26697629	 26613105
RP11-218D6	14	 2	 5	10	 28204714	 28410912	 28307813
RP11-71N21	14	 3	 5	10	 51838414	 51968414	 51903414
RP11-67O23	14	 4	 5	10	 53350639	 53505579	 53428109
RP11-179B15	14	 5	 5	10	 59627591	 59779357	 59703474
RP11-72F15	14	 6	 5	10	 62300565	 62301247	 62300906
RP11-8D13	14	 7	 5	11	 70756232	 70886232	 70821232
RP11-237J7	14	 8	 5	10	 66348125	 66506725	 66427425
RP11-69I18	14	 9	 5	10	 73256828	 73406411	 73331619
RP11-62E15	14	10	 5	10	 75463864	 75593864	 75528864
RP11-243C1	14	11	 5	10	 75443194	 75622143	 75532668
RP11-45P20	14	12	 5	10	 78515307	 78697046	 78606176
RP11-19C18	14	13	 5	10	 78621099	 78751099	 78686099
RP11-78F9	14	14	 5	10	 80532209	 80699276	 80615742
RP11-19K9	14	15	 5	10	 99620303	 99750303	 99685303
RP11-4G4	14	16	 5	10	101635168	101783765	101709466
RP11-260L2	14	17	 5	10	101982043	101982377	101982210
RP11-34D15	14	18	 5	10	101983946	102143839	102063892
RP11-19I17	14	19	 5	04	106229011	106359011	106294011
RP11-80B2	14	20	 5	10	105052686	105053047	105052866
RP11-91M10	14	21	 5	11	 84821842	 84975001	 84898421
RP11-91A3	14	22	 5	11	 79994803	 80132679	 80063741
RP11-91G22	14	23	 5	11	 35278494	 35446305	 35362399
RP11-27N2	14	24	 5	11	  4499239	  4681349	  4590294
RP11-560B16	14	25	 5	11	  6747314	  6920925	  6834119
RP11-607L20	14	 1	 6	11	 57672781	 57802781	 57737781
RP11-11N17	14	 2	 6	11	 28748143	 28908091	 28828117
RP11-230G20	14	 3	 6	11	 25048819	 25049177	 25048998
RP11-47D7	14	 4	 6	11	 11602849	 11769753	 11686301
RP11-156A13	14	 5	 6	11	 11677615	 11709431	 11693523
RP11-98J9	14	 6	 6	11	 13759384	 13908443	 13833913
RP11-611I10	14	 7	 6	11	  6740911	  6940836	  6840873
RP11-841N1	14	 8	 6	11	123810491	123940491	123875491
RP11-24N12	14	 9	 6	12	  2977825	  3145569	  3061697
RP11-166G2	14	10	 6	12	  5614752	  5783146	  5698949
RP11-96K24	14	11	 6	12	 13644251	 13809265	 13726758
RP11-85G7	14	12	 6	12	 18506564	 18636564	 18571564
RP11-49G2	14	13	 6	12	 22094438	 22250748	 22172593
RP11-88M8	14	14	 6	12	 50857232	 50987232	 50922232
RP11-97N16	14	15	 6	12	 51246558	 51376558	 51311558
RP11-132H4	14	16	 6	12	 52480478	 52480818	 52480648
RP11-35G5	14	17	 6	12	 58732627	 58917311	 58824969
RP11-97A6	14	18	 6	12	 60917552	 61052698	 60985125
RP11-220L3	14	19	 6	12	 63255234	 63422468	 63338851
RP11-89K22	14	20	 6	14	 24548288	 24715396	 24631842
RP11-89H23	14	21	 6	14	 72834058	 72978338	 72906198
RP11-89J20	14	22	 6	14	 53148920	 53278920	 53213920
RP11-90P19	14	23	 6	14	 91057509	 91211949	 91134729
RP11-91J1	14	24	 6	14	 45258184	 45462464	 45360324
RP11-91K19_2	14	25	 6	14	 31150740	 31318688	 31234714
RP11-256M2	14	 1	 7	15	 25673627	 25674128	 25673877
RP11-15C9	14	 2	 7	15	 31434776	 31564776	 31499776
RP11-3D4	14	 3	 7	15	 31802399	 31975487	 31888943
RP11-70A17	14	 4	 7	15	 32722398	 32894037	 32808217
RP11-173E7	14	 5	 7	15	 34024177	 34051094	 34037635
RP11-6L16	14	 6	 7	15	 44648869	 44808589	 44728729
RP11-57J20	14	 7	 7	15	 49259342	 49418574	 49338958
RP11-39N23	14	 8	 7	15	 49583452	 49583742	 49583597
RP11-47P5	14	 9	 7	15	 52666775	 52815249	 52741012
RP11-25G4	14	10	 7	15	 53796449	 53926449	 53861449
RP11-276O16	14	11	 7	15	 55295663	 55296055	 55295859
RP11-34O20	14	12	 7	15	 56266838	 56414971	 56340904
RP11-30M4	14	13	 7	15	 63656121	 63656445	 63656283
RP11-85E15	14	14	 7	15	 65219920	 65349920	 65284920
RP11-101C13	14	15	 7	15	 67720647	 67874610	 67797628
RP11-64K10	14	16	 7	15	 68619293	 68768615	 68693954
RP11-106M3	14	17	 7	15	 70295483	 70480124	 70387803
RP11-46C10	14	18	 7		NA	NA	NA
RP11-79G13	14	19	 7	18	 26532500	 26698513	 26615506
RP11-79O10	14	20	 7	18	  6228127	  6358127	  6293127
RP11-79L5	14	21	 7	18	 53192567	 53367243	 53279905
RP11-80P2	14	22	 7	18	 44643091	 44773091	 44708091
RP11-88J4	14	23	 7	18	 56946719	 57105294	 57026006
RP11-89I22	14	24	 7	18	 60340433	 60487236	 60413834
RP11-90L7	14	25	 7	18	 21609086	 21774952	 21692019
RP11-91B23	14	 1	 8		NA	NA	NA
RP11-91F15	14	 2	 8	02	209751003	209881003	209816003
RP11-91I8	14	 3	 8	18	  6626369	  6760832	  6693600
RP11-91C19	14	 4	 8	18	 75021265	 75181066	 75101165
RP11-75H6	14	 5	 8	19	   902641	  1095485	   999063
RP11-110J19	14	 6	 8	19	 34464882	 34664148	 34564515
RP11-18J6	14	 7	 8	19	 36556714	 36686714	 36621714
RP11-32H17	14	 8	 8	19	 40185716	 40186036	 40185876
RP11-91H20	14	 9	 8	19	 43015766	 43182195	 43098980
RP11-140E1	14	10	 8	19	 43372949	 43537375	 43455162
RP11-133A7	14	11	 8	19	 45983418	 46113418	 46048418
RP11-12C9	14	12	 8	19	 62473811	 62624158	 62548984
CTD-2111I12	14	13	 8	19	 44591175	 44591404	 44591289
RP11-79A3	14	14	 8	19	 57130624	 57310014	 57220319
RP11-79A10	14	15	 8	19	  3767729	  3897729	  3832729
RP11-79E22	14	16	 8	19	 17607866	 17777501	 17692683
RP11-79F15	14	17	 8	19	  8714331	  8864039	  8789185
RP11-4B12	14	18	 8	02	102122464	102302418	102212441
RP11-5K23	14	19	 8	01	158226186	158356091	158291138
RP11-6K5	14	20	 8	11	 20206575	 20372540	 20289557
RP11-7D5	14	21	 8	10	 97316079	 97482952	 97399515
RP11-8A2	14	22	 8	X	 48174425	 48335104	 48254764
RP11-8N6	14	23	 8	09	 36614615	 36774305	 36694460
RP11-16O9	14	24	 8	15	 39392419	 39589022	 39490720
RP11-18M9	14	25	 8	X	 13950889	 14106723	 14028806
RP11-22E14	14	 1	 9	08	 57031738	 57210594	 57121166
RP11-23B19	14	 2	 9	04	 87167641	 87298033	 87232837
RP11-23O12_2	14	 3	 9	10	  3658177	  3829073	  3743625
RP11-24C10	14	 4	 9	01	 32470953	 32527071	 32499012
RP11-35D12	14	 5	 9	14	 68241628	 68401574	 68321601
RP11-42O15	14	 6	 9	01	 70572139	 70723917	 70648028
RP11-45A17	14	 7	 9	10	133629567	133778458	133704012
RP11-46C23	14	 8	 9	11	129599849	129764776	129682312
RP11-47A1	14	 9	 9	01	 41604922	 41769099	 41687010
RP11-48M17	14	10	 9	09	  2136329	  2296367	  2216348
RP11-63B13	14	11	 9	04	123018921	123168740	123093830
RP11-63L7	14	12	 9	06	 89784581	 89965724	 89875152
RP11-64L12	14	13	 9	16	   535528	   715973	   625750
RP11-65L3	14	14	 9	02	179083644	179256472	179170058
RP11-66D17	14	15	 9	01	153434240	153594838	153514539
RP11-67F24	14	16	 9	03	161145014	161320814	161232914
RP11-359B12	14	17	 9	12	   858583	  1084640	   971611
RP11-361K8	14	18	 9	17	 43957671	 44125742	 44041706
RP11-363M20	14	19	 9	14	 61039377	 61219669	 61129523
RP11-364M22	14	20	 9	09	 12344848	 12480002	 12412425
RP11-367C15	14	21	 9	08	117853641	118047006	117950323
RP11-368A17	14	22	 9	02	113063672	113232094	113147883
RP11-386A21	14	23	 9	19	 11302759	 11477786	 11390272
RP11-386I23	14	24	 9	01	 93080957	 93133878	 93107417
RP11-387H17	14	25	 9	17	 35207008	 35434854	 35320931
RP11-388M20	14	 1	10	16	 31035907	 31163676	 31099791
RP11-389H23	14	 2	10	22	 31535271	 31732277	 31633774
RP11-392A23	14	 3	10	06	 52696851	 52901674	 52799262
RP11-402H20	14	 4	10	X	153772075	153951934	153862004
RP11-403G3	14	 5	10	17	 40552630	 40737608	 40645119
RP11-408I18	14	 6	10	12	123294167	123499450	123396808
RP11-410F19	14	 7	10	03	187018983	187165361	187092172
RP11-413N8	14	 8	10	08	 97657191	 97858259	 97757725
RP11-415K6	14	 9	10	05	 14596375	 14781538	 14688956
RP11-429G19	14	10	10	10	 97477245	 97669187	 97573216
RP11-432E18	14	11	10	01	155477177	155658176	155567676
RP11-433J6	14	12	10	12	  6579329	  6767135	  6673232
RP11-434D2	14	13	10	17	 20227885	 20422653	 20325269
RP11-436M6	14	14	10	03	196916501	197109775	197013138
RP11-438E8	14	15	10	12	 44097613	 44127313	 44112463
RP11-166F3	14	16	10	03	   230125	   397141	   313633
RP11-460I19	14	17	10	04	   906615	  1084572	   995593
RP11-794H3	14	18	10	06	170707793	170881221	170794507
RP11-713A20	14	19	10	07	   106476	   257550	   182013
RP11-91F24	14	20	10	08	145963320	146122245	146042782
RP11-1105F21	14	21	10	09	138162449	138341716	138252082
RP11-266K16	14	22	10	20	 62267315	 62430362	 62348838
RP11-1113I2	14	23	10	22	 48765941	 48929845	 48847893
RP11-479B17	14	24	10		NA	NA	NA
RP11-715K2	14	25	10	17	 32246319	 32422331	 32334325
RP11-840I8	14	 1	11	07	 50353776	 50575319	 50464547
RP11-662D2	14	 2	11	X	 30014387	 30193666	 30104026
RP11-235I5_2	14	 3	11	08	 11538839	 11721811	 11630325
RP11-656J16	14	 4	11	16	   976721	  1171089	  1073905
RP11-1107G21	14	 5	11	17	 26415259	 26627398	 26521328
RP11-79L17_2	14	 6	11	05	 11256926	 11429967	 11343446
RP11-116D18	14	 7	11	11	  2718756	  2904558	  2811657
RP11-400O10_2	14	 8	11	Y	  2692881	  2821914	  2757397
RP11-12K18	14	 9	11	08	103580572	103765104	103672838
RP11-14H3	14	10	11	06	 17639468	 17735670	 17687569
RP11-16C1	14	11	11	17	 70781174	 70934384	 70857779
RP11-16L21	14	12	11	09	111398971	111560419	111479695
RP11-18K7	14	13	11	18	 17908960	 18073471	 17991215
RP11-20I23	14	14	11	16	  2425370	  2583241	  2504305
RP11-432D10	14	15	11	03	198203773	198345367	198274570
RP11-435O5	14	16	11	09	 95213045	 95402688	 95307866
RP11-438J1	14	17	11	03	 10137480	 10347535	 10242507
RP11-443G18	14	18	11	01	153057344	153165163	153111253
RP11-446L19	14	19	11	21	 43237423	 43423519	 43330471
RP11-449G13	14	20	11	16	 18628868	 18801175	 18715021
RP11-472F14	14	21	11	09	  6427960	  6601726	  6514843
RP11-474G23	14	22	11	02	 68219272	 68417550	 68318411
RP11-475G3	14	23	11	02	241875812	242072725	241974268
RP11-478G16	14	24	11	12	101669979	101837377	101753678
RP11-483G21	14	25	11	07	 72133381	 72320597	 72226989
RP11-490B18	14	 1	12	16	 74114435	 74309268	 74211851
RP11-506M12	14	 2	12	07	 99314203	 99446967	 99380585
RP11-511H9	14	 3	12	12	100616620	100790851	100703735
RP11-515O17	14	 4	12	17	 50654233	 50836281	 50745257
RP11-518L10	14	 5	12	01	240830941	240911103	240871022
RP11-520H14	14	 6	12	01	224611903	224741903	224676903
RP11-521O16	14	 7	12	02	127449270	127635237	127542253
RP11-542P2	14	 8	12	04	141649647	141836017	141742832
RP11-544H14	14	 9	12	02	203497614	203705638	203601626
RP11-559K16	14	10	12	17	 74241341	 74412130	 74326735
RP11-561O7	14	11	12	02	224264670	224444130	224354400
RP11-563J2	14	12	12	10	  6377826	  6567593	  6472709
RP11-564H16	14	13	12	02	 54700758	 54869308	 54785033
RP11-934P3	14	14	12	12	 69742721	 69901252	 69821986
RP11-951I11	14	15	12	12	107348149	107528889	107438519
RP11-1002K11	14	16	12	08	 32715278	 32909251	 32812264
RP11-1091N2	14	17	12	09	 90735040	 90945632	 90840336
RP11-1163J22	14	18	12	02	219966127	220027708	219996917
RP11-1370M13	14	19	12	02	241864342	241877813	241871077
RP11-68H19	14	13	13	02	225417762	225589573	225503667
RP11-71H20_1	14	14	13	02	231937955	232067955	232002955
RP11-156M13_1	14	15	13		NA	NA	NA
RP11-116M19_1	14	16	13	02	236411955	236412301	236412128
RP11-32C20	14	17	13	02	130417762	130583205	130500483
RP11-375P12	14	18	13	02	 12289583	 12376807	 12333195
RP11-79O3	14	19	13	02	 80208045	 80369529	 80288787
RP11-79C24	14	20	13	02	211213228	211372780	211293004
RP11-79B5	14	21	13	02	155401610	155575129	155488369
RP11-79H11	14	22	13	02	 65046653	 65176653	 65111653
RP11-80D14	14	23	13	02	171093941	171255093	171174517
RP11-80L12	14	24	13	02	135823329	135975853	135899591
RP11-88F6	14	25	13	02	 26705178	 26873941	 26789559
RP11-88F20	14	 1	14	02	 64691266	 64873006	 64782136
RP11-88L20	14	 2	14	02	190273172	190460864	190367018
RP11-88P18	14	 3	14	02	238420472	238550472	238485472
RP11-88P24	14	 4	14	02	214989288	215119288	215054288
RP11-89G16	14	 5	14	02	 49511077	 49665844	 49588460
RP11-89J16	14	 6	14	02	198545587	198675587	198610587
RP11-89P16	14	 7	14	02	 36551269	 36681269	 36616269
RP11-90C5	14	 8	14	02	188460313	188617368	188538840
RP11-90C9	14	 9	14	02	 77191967	 77352881	 77272424
RP11-90B13	14	10	14	02	 64117413	 64266763	 64192088
RP11-90D19	14	11	14	02	206810017	206978260	206894138
RP11-108H14	14	12	14	04	 36998587	 37199746	 37099166
RP11-126C7	14	13	14	04	 38087293	 38242092	 38164692
RP11-264N7	14	14	14	04	 41202372	 41364564	 41283468
RP11-138F23	14	15	14	04	 40652443	 40782443	 40717443
RP11-105F21	14	16	14	04	 44664722	 44822922	 44743822
RP11-238D1	14	17	14	04	 45646447	 45776447	 45711447
RP11-42G2	14	18	14	04	 61933914	 62106390	 62020152
RP11-234L24	14	19	14	04	 67579974	 67580291	 67580132
RP11-121P15	14	20	14	04	 71432007	 71562007	 71497007
RP11-155P6	14	21	14	04	 74322497	 74453501	 74387999
RP11-94K4	14	22	14	04	 75100494	 75282835	 75191664
RP11-80I4	14	23	14	04	 76270171	 76429795	 76349983
RP11-31I17	14	24	14	04	 86665470	 86665657	 86665563
RP11-130O10	14	25	14	04	 87637254	 87638014	 87637634
RP11-17P8	14	 1	15	04	 89759710	 89945876	 89852793
RP11-132F20	14	 2	15	04	 90489952	 90490295	 90490123
RP11-221M14	14	 3	15	04	 91609027	 91609237	 91609132
RP11-16I17	14	 4	15	04	 94801023	 94976533	 94888778
RP11-101N17	14	 5	15	04	120563175	120720926	120642050
RP11-32D22	14	 6	15	04	123965076	123965435	123965255
RP11-130M1	14	 7	15	04	124105467	124173602	124139534
RP11-107E21	14	 8	15	04	125033842	125203885	125118863
RP11-2L11	14	 9	15	01	 14887436	 15017436	 14952436
RP11-11P20	14	10	15	04	128874744	129034162	128954453
RP11-88H2	14	11	15	05	146178673	146333305	146255989
RP11-88J2	14	12	15	05	 70983509	 71169783	 71076646
RP11-88L14	14	13	15	05	110411340	110574795	110493067
RP11-88L18_2	14	14	15	05	 17465419	 17636603	 17551011
RP11-89G4_1	14	15	15	05	131752034	131921419	131836726
RP11-89F5	14	16	15	05	105746748	105918961	105832854
RP11-90N23_2	14	17	15	05	159818160	159984761	159901460
RP11-91L13	14	18	15	05	 24374566	 24551479	 24463022
RP11-91M11	14	19	15	05	 73253814	 73423047	 73338430
RP11-91I22	14	20	15	05	 50107903	 50274622	 50191262
RP11-91M12	14	21	15	05	  9865613	 10044066	  9954839
RP11-91E7	14	22	15	05	  9086318	  9240476	  9163397
RP11-177C16	14	23	15	06	  7367940	  7560439	  7464189
RP11-66E14	14	24	15	06	  8798647	  8798996	  8798821
RP11-83B17	14	25	15	06	 14557159	 14557429	 14557294
RP11-88E14	14	 1	16	06	 16498740	 16499114	 16498927
RP11-22P23	14	 2	16	06	 17056003	 17056373	 17056188
RP11-159C8	14	 3	16	06	 20442776	 20622576	 20532676
RP11-174E21	14	 4	16	06	 37652029	 37652377	 37652203
RP11-136C6	14	 5	16	06	 39212774	 39385513	 39299143
RP11-14G23	14	 6	16	06	 40452868	 40632593	 40542730
RP11-91H14	14	 7	16	06	 43872302	 44044656	 43958479
RP11-3M23	14	 8	16	06	 47418696	 47419048	 47418872
RP11-58P9	14	 9	16	06	 48122069	 48252069	 48187069
RP11-235I5_1	14	10	16	08	 11538839	 11721811	 11630325
RP11-254E10	14	11	16	08	 11164155	 11164458	 11164306
RP11-235F10	14	12	16	08	  9234674	  9381782	  9308228
RP11-112G9	14	13	16	08	 10038624	 10226504	 10132564
RP11-252K12	14	14	16	08	 10893274	 11073332	 10983303
RP11-31B7	14	15	16	08	 12684851	 12814851	 12749851
RP11-89M8_1	14	16	16	08	 22779033	 22949883	 22864458
RP11-76B12	14	17	16	08	 25245633	 25375633	 25310633
RP11-164H24	14	18	16	08	 25349758	 25479758	 25414758
RP11-232J22	14	19	16	08	 26316409	 26446409	 26381409
RP11-116F9	14	20	16	08	 28140630	 28270630	 28205630
RP11-188F16	14	21	16	08	 28762956	 28763299	 28763127
RP11-100B16	14	22	16	08	 38358838	 38522417	 38440627
RP11-133O7	14	23	16	08	 39956893	 40086893	 40021893
RP11-48D21	14	24	16	08	 40583162	 40742585	 40662873
RP11-213C20	14	25	16	08	 42361448	 42528859	 42445153
RP11-73M19	14	 1	17	08	 43102830	 43270290	 43186560
RP11-12L15_1	14	 2	17	08	 47924445	 48076131	 48000288
RP11-234F8	14	 3	17	08	 64090116	 64090566	 64090341
RP11-182B21	14	 4	17	08	 65371846	 65372228	 65372037
RP11-282D10	14	 5	17	08	 67411074	 67411334	 67411204
RP11-271O1_1	14	 6	17	08	 67573801	 67732186	 67652993
RP11-148M7	14	 7	17	08	 73660083	 73829609	 73744846
RP11-107F3	14	 8	17	08	 74334389	 74496719	 74415554
RP11-43K6	14	 9	17	10	 21903086	 22067760	 21985423
RP11-18B14	14	10	17	10	 21805410	 21935410	 21870410
RP11-73J23	14	11	17	10	 23622100	 23752100	 23687100
RP11-176P2	14	12	17	10	 24596174	 24736301	 24666237
RP11-66P13	14	13	17	10	 26528582	 26697629	 26613105
RP11-218D6	14	14	17	10	 28204714	 28410912	 28307813
RP11-71N21	14	15	17	10	 51838414	 51968414	 51903414
RP11-67O23	14	16	17	10	 53350639	 53505579	 53428109
RP11-179B15	14	17	17	10	 59627591	 59779357	 59703474
RP11-72F15	14	18	17	10	 62300565	 62301247	 62300906
RP11-8D13	14	19	17	11	 70756232	 70886232	 70821232
RP11-237J7	14	20	17	10	 66348125	 66506725	 66427425
RP11-69I18	14	21	17	10	 73256828	 73406411	 73331619
RP11-62E15	14	22	17	10	 75463864	 75593864	 75528864
RP11-243C1	14	23	17	10	 75443194	 75622143	 75532668
RP11-45P20	14	24	17	10	 78515307	 78697046	 78606176
RP11-19C18	14	25	17	10	 78621099	 78751099	 78686099
RP11-78F9	14	 1	18	10	 80532209	 80699276	 80615742
RP11-19K9	14	 2	18	10	 99620303	 99750303	 99685303
RP11-4G4	14	 3	18	10	101635168	101783765	101709466
RP11-260L2	14	 4	18	10	101982043	101982377	101982210
RP11-34D15	14	 5	18	10	101983946	102143839	102063892
RP11-19I17	14	 6	18	04	106229011	106359011	106294011
RP11-80B2	14	 7	18	10	105052686	105053047	105052866
RP11-91M10	14	 8	18	11	 84821842	 84975001	 84898421
RP11-91A3	14	 9	18	11	 79994803	 80132679	 80063741
RP11-91G22	14	10	18	11	 35278494	 35446305	 35362399
RP11-27N2	14	11	18	11	  4499239	  4681349	  4590294
RP11-560B16	14	12	18	11	  6747314	  6920925	  6834119
RP11-607L20	14	13	18	11	 57672781	 57802781	 57737781
RP11-11N17	14	14	18	11	 28748143	 28908091	 28828117
RP11-230G20	14	15	18	11	 25048819	 25049177	 25048998
RP11-47D7	14	16	18	11	 11602849	 11769753	 11686301
RP11-156A13	14	17	18	11	 11677615	 11709431	 11693523
RP11-98J9	14	18	18	11	 13759384	 13908443	 13833913
RP11-611I10	14	19	18	11	  6740911	  6940836	  6840873
RP11-841N1	14	20	18	11	123810491	123940491	123875491
RP11-24N12	14	21	18	12	  2977825	  3145569	  3061697
RP11-166G2	14	22	18	12	  5614752	  5783146	  5698949
RP11-96K24	14	23	18	12	 13644251	 13809265	 13726758
RP11-85G7	14	24	18	12	 18506564	 18636564	 18571564
RP11-49G2	14	25	18	12	 22094438	 22250748	 22172593
RP11-88M8	14	 1	19	12	 50857232	 50987232	 50922232
RP11-97N16	14	 2	19	12	 51246558	 51376558	 51311558
RP11-132H4	14	 3	19	12	 52480478	 52480818	 52480648
RP11-35G5	14	 4	19	12	 58732627	 58917311	 58824969
RP11-97A6	14	 5	19	12	 60917552	 61052698	 60985125
RP11-220L3	14	 6	19	12	 63255234	 63422468	 63338851
RP11-89K22	14	 7	19	14	 24548288	 24715396	 24631842
RP11-89H23	14	 8	19	14	 72834058	 72978338	 72906198
RP11-89J20	14	 9	19	14	 53148920	 53278920	 53213920
RP11-90P19	14	10	19	14	 91057509	 91211949	 91134729
RP11-91J1	14	11	19	14	 45258184	 45462464	 45360324
RP11-91K19_2	14	12	19	14	 31150740	 31318688	 31234714
RP11-256M2	14	13	19	15	 25673627	 25674128	 25673877
RP11-15C9	14	14	19	15	 31434776	 31564776	 31499776
RP11-3D4	14	15	19	15	 31802399	 31975487	 31888943
RP11-70A17	14	16	19	15	 32722398	 32894037	 32808217
RP11-173E7	14	17	19	15	 34024177	 34051094	 34037635
RP11-6L16	14	18	19	15	 44648869	 44808589	 44728729
RP11-57J20	14	19	19	15	 49259342	 49418574	 49338958
RP11-39N23	14	20	19	15	 49583452	 49583742	 49583597
RP11-47P5	14	21	19	15	 52666775	 52815249	 52741012
RP11-25G4	14	22	19	15	 53796449	 53926449	 53861449
RP11-276O16	14	23	19	15	 55295663	 55296055	 55295859
RP11-34O20	14	24	19	15	 56266838	 56414971	 56340904
RP11-30M4	14	25	19	15	 63656121	 63656445	 63656283
RP11-85E15	14	 1	20	15	 65219920	 65349920	 65284920
RP11-101C13	14	 2	20	15	 67720647	 67874610	 67797628
RP11-64K10	14	 3	20	15	 68619293	 68768615	 68693954
RP11-106M3	14	 4	20	15	 70295483	 70480124	 70387803
RP11-46C10	14	 5	20		NA	NA	NA
RP11-79G13	14	 6	20	18	 26532500	 26698513	 26615506
RP11-79O10	14	 7	20	18	  6228127	  6358127	  6293127
RP11-79L5	14	 8	20	18	 53192567	 53367243	 53279905
RP11-80P2	14	 9	20	18	 44643091	 44773091	 44708091
RP11-88J4	14	10	20	18	 56946719	 57105294	 57026006
RP11-89I22	14	11	20	18	 60340433	 60487236	 60413834
RP11-90L7	14	12	20	18	 21609086	 21774952	 21692019
RP11-91B23	14	13	20		NA	NA	NA
RP11-91F15	14	14	20	02	209751003	209881003	209816003
RP11-91I8	14	15	20	18	  6626369	  6760832	  6693600
RP11-91C19	14	16	20	18	 75021265	 75181066	 75101165
RP11-75H6	14	17	20	19	   902641	  1095485	   999063
RP11-110J19	14	18	20	19	 34464882	 34664148	 34564515
RP11-18J6	14	19	20	19	 36556714	 36686714	 36621714
RP11-32H17	14	20	20	19	 40185716	 40186036	 40185876
RP11-91H20	14	21	20	19	 43015766	 43182195	 43098980
RP11-140E1	14	22	20	19	 43372949	 43537375	 43455162
RP11-133A7	14	23	20	19	 45983418	 46113418	 46048418
RP11-12C9	14	24	20	19	 62473811	 62624158	 62548984
CTD-2111I12	14	25	20	19	 44591175	 44591404	 44591289
RP11-79A3	14	 1	21	19	 57130624	 57310014	 57220319
RP11-79A10	14	 2	21	19	  3767729	  3897729	  3832729
RP11-79E22	14	 3	21	19	 17607866	 17777501	 17692683
RP11-79F15	14	 4	21	19	  8714331	  8864039	  8789185
RP11-4B12	14	 5	21	02	102122464	102302418	102212441
RP11-5K23	14	 6	21	01	158226186	158356091	158291138
RP11-6K5	14	 7	21	11	 20206575	 20372540	 20289557
RP11-7D5	14	 8	21	10	 97316079	 97482952	 97399515
RP11-8A2	14	 9	21	X	 48174425	 48335104	 48254764
RP11-8N6	14	10	21	09	 36614615	 36774305	 36694460
RP11-16O9	14	11	21	15	 39392419	 39589022	 39490720
RP11-18M9	14	12	21	X	 13950889	 14106723	 14028806
RP11-22E14	14	13	21	08	 57031738	 57210594	 57121166
RP11-23B19	14	14	21	04	 87167641	 87298033	 87232837
RP11-23O12_2	14	15	21	10	  3658177	  3829073	  3743625
RP11-24C10	14	16	21	01	 32470953	 32527071	 32499012
RP11-35D12	14	17	21	14	 68241628	 68401574	 68321601
RP11-42O15	14	18	21	01	 70572139	 70723917	 70648028
RP11-45A17	14	19	21	10	133629567	133778458	133704012
RP11-46C23	14	20	21	11	129599849	129764776	129682312
RP11-47A1	14	21	21	01	 41604922	 41769099	 41687010
RP11-48M17	14	22	21	09	  2136329	  2296367	  2216348
RP11-63B13	14	23	21	04	123018921	123168740	123093830
RP11-63L7	14	24	21	06	 89784581	 89965724	 89875152
RP11-64L12	14	25	21	16	   535528	   715973	   625750
RP11-65L3	14	 1	22	02	179083644	179256472	179170058
RP11-66D17	14	 2	22	01	153434240	153594838	153514539
RP11-67F24	14	 3	22	03	161145014	161320814	161232914
RP11-359B12	14	 4	22	12	   858583	  1084640	   971611
RP11-361K8	14	 5	22	17	 43957671	 44125742	 44041706
RP11-363M20	14	 6	22	14	 61039377	 61219669	 61129523
RP11-364M22	14	 7	22	09	 12344848	 12480002	 12412425
RP11-367C15	14	 8	22	08	117853641	118047006	117950323
RP11-368A17	14	 9	22	02	113063672	113232094	113147883
RP11-386A21	14	10	22	19	 11302759	 11477786	 11390272
RP11-386I23	14	11	22	01	 93080957	 93133878	 93107417
RP11-387H17	14	12	22	17	 35207008	 35434854	 35320931
RP11-388M20	14	13	22	16	 31035907	 31163676	 31099791
RP11-389H23	14	14	22	22	 31535271	 31732277	 31633774
RP11-392A23	14	15	22	06	 52696851	 52901674	 52799262
RP11-402H20	14	16	22	X	153772075	153951934	153862004
RP11-403G3	14	17	22	17	 40552630	 40737608	 40645119
RP11-408I18	14	18	22	12	123294167	123499450	123396808
RP11-410F19	14	19	22	03	187018983	187165361	187092172
RP11-413N8	14	20	22	08	 97657191	 97858259	 97757725
RP11-415K6	14	21	22	05	 14596375	 14781538	 14688956
RP11-429G19	14	22	22	10	 97477245	 97669187	 97573216
RP11-432E18	14	23	22	01	155477177	155658176	155567676
RP11-433J6	14	24	22	12	  6579329	  6767135	  6673232
RP11-434D2	14	25	22	17	 20227885	 20422653	 20325269
RP11-436M6	14	 1	23	03	196916501	197109775	197013138
RP11-438E8	14	 2	23	12	 44097613	 44127313	 44112463
RP11-166F3	14	 3	23	03	   230125	   397141	   313633
RP11-460I19	14	 4	23	04	   906615	  1084572	   995593
RP11-794H3	14	 5	23	06	170707793	170881221	170794507
RP11-713A20	14	 6	23	07	   106476	   257550	   182013
RP11-91F24	14	 7	23	08	145963320	146122245	146042782
RP11-1105F21	14	 8	23	09	138162449	138341716	138252082
RP11-266K16	14	 9	23	20	 62267315	 62430362	 62348838
RP11-1113I2	14	10	23	22	 48765941	 48929845	 48847893
RP11-479B17	14	11	23		NA	NA	NA
RP11-715K2	14	12	23	17	 32246319	 32422331	 32334325
RP11-840I8	14	13	23	07	 50353776	 50575319	 50464547
RP11-662D2	14	14	23	X	 30014387	 30193666	 30104026
RP11-235I5_2	14	15	23	08	 11538839	 11721811	 11630325
RP11-656J16	14	16	23	16	   976721	  1171089	  1073905
RP11-1107G21	14	17	23	17	 26415259	 26627398	 26521328
RP11-79L17_2	14	18	23	05	 11256926	 11429967	 11343446
RP11-116D18	14	19	23	11	  2718756	  2904558	  2811657
RP11-400O10_2	14	20	23	Y	  2692881	  2821914	  2757397
RP11-12K18	14	21	23	08	103580572	103765104	103672838
RP11-14H3	14	22	23	06	 17639468	 17735670	 17687569
RP11-16C1	14	23	23	17	 70781174	 70934384	 70857779
RP11-16L21	14	24	23	09	111398971	111560419	111479695
RP11-18K7	14	25	23	18	 17908960	 18073471	 17991215
RP11-20I23	14	 1	24	16	  2425370	  2583241	  2504305
RP11-432D10	14	 2	24	03	198203773	198345367	198274570
RP11-435O5	14	 3	24	09	 95213045	 95402688	 95307866
RP11-438J1	14	 4	24	03	 10137480	 10347535	 10242507
RP11-443G18	14	 5	24	01	153057344	153165163	153111253
RP11-446L19	14	 6	24	21	 43237423	 43423519	 43330471
RP11-449G13	14	 7	24	16	 18628868	 18801175	 18715021
RP11-472F14	14	 8	24	09	  6427960	  6601726	  6514843
RP11-474G23	14	 9	24	02	 68219272	 68417550	 68318411
RP11-475G3	14	10	24	02	241875812	242072725	241974268
RP11-478G16	14	11	24	12	101669979	101837377	101753678
RP11-483G21	14	12	24	07	 72133381	 72320597	 72226989
RP11-490B18	14	13	24	16	 74114435	 74309268	 74211851
RP11-506M12	14	14	24	07	 99314203	 99446967	 99380585
RP11-511H9	14	15	24	12	100616620	100790851	100703735
RP11-515O17	14	16	24	17	 50654233	 50836281	 50745257
RP11-518L10	14	17	24	01	240830941	240911103	240871022
RP11-520H14	14	18	24	01	224611903	224741903	224676903
RP11-521O16	14	19	24	02	127449270	127635237	127542253
RP11-542P2	14	20	24	04	141649647	141836017	141742832
RP11-544H14	14	21	24	02	203497614	203705638	203601626
RP11-559K16	14	22	24	17	 74241341	 74412130	 74326735
RP11-561O7	14	23	24	02	224264670	224444130	224354400
RP11-563J2	14	24	24	10	  6377826	  6567593	  6472709
RP11-564H16	14	25	24	02	 54700758	 54869308	 54785033
RP11-934P3	14	 1	25	12	 69742721	 69901252	 69821986
RP11-951I11	14	 2	25	12	107348149	107528889	107438519
RP11-1002K11	14	 3	25	08	 32715278	 32909251	 32812264
RP11-1091N2	14	 4	25	09	 90735040	 90945632	 90840336
RP11-1163J22	14	 5	25	02	219966127	220027708	219996917
RP11-1370M13	14	 6	25	02	241864342	241877813	241871077
RP11-89P8	15	 1	 1	01	 30534880	 30664880	 30599880
RP11-90A5	15	 2	 1	01	209093983	209251270	209172626
RP11-90C19	15	 3	 1	01	173928116	174113266	174020691
RP11-90D15	15	 4	 1	01	 12798944	 12961246	 12880095
RP11-90F17	15	 5	 1	01	 48215170	 48372587	 48293878
RP11-90H3	15	 6	 1	01	106012867	106171905	106092386
RP11-91E21	15	 7	 1	01	180249896	180412398	180331147
RP11-91G6	15	 8	 1	01	209262364	209427471	209344917
RP11-91G14	15	 9	 1	01	156842796	156998855	156920825
RP11-451C22	15	10	 1	01	 85453742	 85583742	 85518742
RP11-449D11	15	11	 1	01	 14780822	 14910822	 14845822
RP11-449B23	15	12	 1	01	160910439	161063703	160987071
RP11-77G15_1	15	13	 1	02	 34191612	 34356053	 34273832
RP11-163N11	15	14	 1	02	 37828547	 37958547	 37893547
RP11-119J12_1	15	15	 1	02	 45722682	 45896568	 45809625
RP11-81L7_1	15	16	 1	02	 57065869	 57218868	 57142368
RP11-87C16_1	15	17	 1	02	 73327095	 73327385	 73327240
RP11-113N17_1	15	18	 1	02	 82523780	 82682205	 82602992
RP11-72H23_1	15	19	 1	02	148636288	148766288	148701288
RP11-185M22_1	15	20	 1	02	152488388	152667424	152577906
RP11-50J20_1	15	21	 1	02	160394495	160524495	160459495
RP11-218D15_1	15	22	 1	02	171199763	171200132	171199947
RP11-12N7_1	15	23	 1	02	175850411	176023129	175936770
RP11-250B10	15	24	 1	02	179481731	179482120	179481925
RP11-79F11	15	25	 1	03	165317576	165466440	165392008
RP11-79L9	15	 1	 2	03	139736336	139888324	139812330
RP11-80D24	15	 2	 2	03	 17181327	 17345316	 17263321
RP11-80H24	15	 3	 2	03	 83663409	 83818948	 83741178
RP11-80L14	15	 4	 2	03	165220246	165392762	165306504
RP11-81D17	15	 5	 2	03	 83454311	 83606092	 83530201
RP11-89F24	15	 6	 2	03	158902681	159032681	158967681
RP11-89J17	15	 7	 2	03	175774668	175941775	175858221
RP11-90B15	15	 8	 2	03	 40114413	 40265880	 40190146
RP11-90H23	15	 9	 2	03	 38360376	 38540543	 38450459
RP11-90I13	15	10	 2	03	108357997	108518260	108438128
RP11-90M7	15	11	 2	03	164366662	164516640	164441651
RP11-91K8	15	12	 2	03	134600393	134771767	134686080
RP11-91M24	15	13	 2	03	161356212	161536133	161446172
RP11-91A17	15	14	 2	03	175284032	175453150	175368591
RP11-91E8	15	15	 2	03	 45989823	 46150261	 46070042
RP11-451E6	15	16	 2		NA	NA	NA
RP11-451A20	15	17	 2	03	 17960804	 18148477	 18054640
RP11-34C20	15	18	 2	04	 11010385	 11140385	 11075385
RP11-171P21	15	19	 2	04	 15121503	 15280107	 15200805
RP11-11M9	15	20	 2	04	 19113233	 19264204	 19188718
RP11-238L9	15	21	 2	04	 20339949	 20469949	 20404949
RP11-276O17	15	22	 2		NA	NA	NA
RP11-119N7	15	23	 2	04	 25760196	 25940926	 25850561
RP11-1H14	15	24	 2	05	 77882778	 78047813	 77965295
RP11-207B2	15	25	 2	05	 81708786	 81709141	 81708963
RP11-275E14	15	 1	 3	05	 82802677	 82948633	 82875655
RP11-135F5	15	 2	 3	05	 85972037	 86118543	 86045290
RP11-204D12	15	 3	 3	05	 95832945	 95833289	 95833117
RP11-203J7	15	 4	 3	05	102680445	102841325	102760885
RP11-42M12	15	 5	 3	05	127176867	127327843	127252355
RP11-21C10	15	 6	 3	05	133880078	134045975	133963026
RP11-233E5	15	 7	 3	05	137606195	137606553	137606374
RP11-55M16	15	 8	 3	05	141030989	141196500	141113744
RP11-109G16	15	 9	 3	05	147210085	147295681	147252883
RP11-216N13	15	10	 3	05	147210085	147295681	147252883
RP11-94L2	15	11	 3	05	163254098	163422484	163338291
RP11-128E4	15	12	 3	05	164910279	164910625	164910452
RP11-35O10	15	13	 3	05	166928205	166928548	166928376
RP11-15F10	15	14	 3	05	169073439	169267747	169170593
RP11-9I14	15	15	 3	05	171131260	171131478	171131369
RP11-88L12_1	15	16	 3	05	172525555	172659287	172592421
CTD-2040C2	15	17	 3	05	 14563022	 14563146	 14563084
CTD-2090L24	15	18	 3	05	135426974	135427405	135427189
RP11-79E13	15	19	 3	05	 20454045	 20638418	 20546231
RP11-79I9	15	20	 3	05	144422706	144594364	144508535
RP11-79C6_1	15	21	 3	05	 35825919	 35991223	 35908571
RP11-79I6	15	22	 3	05	150272828	150434140	150353484
RP11-19G12	15	23	 3	07	129031108	129161108	129096108
RP11-35B6	15	24	 3	07	128540689	128708642	128624665
RP11-38P11	15	25	 3	07	129557648	129557976	129557812
RP11-88K4	15	 1	 4	07	136070649	136223639	136147144
RP11-22G20	15	 2	 4	07	136641566	136808402	136724984
RP11-236O18	15	 3	 4	07	138444631	138445061	138444846
RP11-79E7	15	 4	 4	07	133346521	133508041	133427281
RP11-79G19	15	 5	 4	07	106954782	107084782	107019782
RP11-79K23	15	 6	 4	07	147191958	147343032	147267495
RP11-79O21	15	 7	 4	07	 11826764	 11967665	 11897214
RP11-79M8	15	 8	 4	07	144254564	144381963	144318263
RP11-80J6	15	 9	 4	07	 29525391	 29691185	 29608288
RP11-88D24	15	10	 4	07	 84594874	 84797946	 84696410
RP11-88H22	15	11	 4	07	 69740328	 69907866	 69824097
RP11-89A20	15	12	 4	07	 73591648	 73751830	 73671739
RP11-89M2	15	13	 4	07	106258220	106426274	106342247
RP11-89B15	15	14	 4	07	 15439547	 15590902	 15515224
RP11-89D15	15	15	 4	07	 67384611	 67537380	 67460995
RP11-90N11	15	16	 4	07	 53704725	 53864621	 53784673
RP11-91F7	15	17	 4	07	111223787	111381705	111302746
RP11-91L7	15	18	 4		NA	NA	NA
RP11-91C9	15	19	 4	07	 52203658	 52372302	 52287980
RP11-91A24	15	20	 4	07	 15739212	 15921028	 15830120
RP11-91E16	15	21	 4	07	 35427720	 35587255	 35507487
RP11-229N14	15	22	 4	09	116740742	116741128	116740935
RP11-102F20	15	23	 4	09	118051291	118207106	118129198
RP11-13C11	15	24	 4	09	124186424	124316424	124251424
RP11-59O19	15	25	 4	09	121607922	121608385	121608153
RP11-81P5_1	15	 1	 5	09	132115449	132308214	132211831
RP11-130E20	15	 2	 5	09	131403485	131403635	131403560
RP11-79I21	15	 3	 5	09	 86382439	 86536303	 86459371
RP11-80H12	15	 4	 5	09	100788634	100957682	100873158
RP11-80J10	15	 5	 5	09	 90495687	 90659165	 90577426
RP11-80N14	15	 6	 5	09	103308723	103436402	103372562
RP11-81B19	15	 7	 5	09	 27342516	 27492813	 27417664
RP11-81L11	15	 8	 5	09	131544223	131699592	131621907
RP11-89J21	15	 9	 5	09	136124422	136254422	136189422
RP11-89N14	15	10	 5	09	111045358	111175358	111110358
RP11-90B11	15	11	 5	09	135385345	135554504	135469924
RP11-91D7	15	12	 5	09	 98864875	 99033074	 98948974
RP11-91L19	15	13	 5	09	102123900	102280695	102202297
RP11-91M3	15	14	 5	09	 86036496	 86197287	 86116891
RP11-77O20	15	15	 5	10	  5622356	  5844765	  5733560
RP11-33J8	15	16	 5	10	  7223296	  7353296	  7288296
RP11-30L1	15	17	 5	10	  6380505	  6523870	  6452187
RP11-35I11	15	18	 5	10	  8917259	  9047259	  8982259
RP11-42I17	15	19	 5	10	  8218574	  8348574	  8283574
RP11-11L13	15	20	 5	10	 11831014	 11961014	 11896014
RP11-184G18	15	21	 5	11	 94521012	 94521387	 94521199
RP11-15J1	15	22	 5	11	 93845955	 93975955	 93910955
RP11-97D3	15	23	 5	11	 95154708	 95284708	 95219708
RP11-258C1	15	24	 5	11	 99810208	 99988933	 99899570
RP11-134G19	15	25	 5	11	101470600	101600600	101535600
RP11-179B7	15	 1	 6	11	103803542	103965030	103884286
RP11-36M5	15	 2	 6	11	113498565	113670911	113584738
RP11-270N1	15	 3	 6	11	111424180	111554180	111489180
RP11-158I9	15	 4	 6	11	118158911	118354320	118256615
RP11-45N4	15	 5	 6	11	117978549	118170478	118074513
RP11-8K10	15	 6	 6	11	119158031	119335760	119246895
RP11-117K21	15	 7	 6	11	119773356	119939639	119856497
RP11-121G24	15	 8	 6	11	127376748	127572076	127474412
CTD-2012D15	15	 9	 6	11	104171070	104301070	104236070
CTD-2039C11	15	10	 6	11	101713532	101713633	101713582
CTD-2051G10	15	11	 6	11	 47415921	 47416114	 47416017
CTD-2137G15	15	12	 6	11	101736992	101866992	101801992
RP11-79O11	15	13	 6	11	 43796634	 43946801	 43871717
RP11-81D23	15	14	 6	11	 18150599	 18307445	 18229022
RP11-89A24	15	15	 6	11	 34735445	 34883935	 34809690
RP11-89G10	15	16	 6	11	 74416662	 74580961	 74498811
RP11-89M14	15	17	 6	11	 83673727	 83842293	 83758010
RP11-89B9	15	18	 6	11	  4907175	  5070333	  4988754
RP11-89H11_2	15	19	 6	11	 86725843	 86890447	 86808145
RP11-67G19	15	20	 6	14	 20307106	 20463883	 20385494
RP11-14O20	15	21	 6	14	 20231795	 20232170	 20231982
RP11-68M15	15	22	 6	14	 22546684	 22722266	 22634475
RP11-189N14	15	23	 6	14	 23608219	 23620284	 23614251
RP11-256D1	15	24	 6	14	 23608219	 23620284	 23614251
RP11-94D17	15	25	 6	14	 25688025	 25863159	 25775592
RP11-52O23	15	 1	 7	14	 47210218	 47340218	 47275218
RP11-90K14	15	 2	 7	14	 50926108	 51082605	 51004356
RP11-137D17	15	 3	 7	14	 51003055	 51163616	 51083335
RP11-122A4	15	 4	 7	14	 51983833	 52138209	 52061021
RP11-12P7	15	 5	 7	14	 53126974	 53278923	 53202948
RP11-172G1	15	 6	 7	14	 54600496	 54730496	 54665496
RP11-156E22	15	 7	 7	14	 66847837	 67014199	 66931018
RP11-1J10	15	 8	 7	01	236183893	236384595	236284244
RP11-72J8	15	 9	 7	14	 69266041	 69440807	 69353424
RP11-92H20	15	10	 7	14	 74381659	 74551240	 74466449
RP11-29N19	15	11	 7	14	 76177039	 76307039	 76242039
RP11-285P21	15	12	 7	14	 77615202	 77626345	 77620773
RP11-111F22	15	13	 7	14	 98898186	 99028186	 98963186
RP11-128L1	15	14	 7	14	 99817214	 99817389	 99817301
RP11-9D19	15	15	 7	14	100327127	100457127	100392127
RP11-121H7	15	16	 7	14	101461362	101461762	101461562
CTD-2209E7	15	17	 7	14	 60977407	 61107407	 61042407
RP11-79M1	15	18	 7	14	 59822512	 59952512	 59887512
RP11-41E12	15	19	 7	17	 68729134	 68859134	 68794134
RP11-145C11	15	20	 7	17	 70573094	 70573570	 70573332
RP11-201E5	15	21	 7	17	 71406319	 71406634	 71406476
RP11-84J3	15	22	 7	17	 74557252	 74557432	 74557342
RP11-46E14	15	23	 7	17	 75316873	 75477363	 75397118
RP11-160F4_2	15	24	 7	17	 75981826	 75982171	 75981998
RP11-89A22	15	25	 7	17	 36023271	 36186130	 36104700
RP11-89B11	15	 1	 8	17	 71812479	 71959499	 71885989
RP11-89F21	15	 2	 8	17	 15021682	 15151682	 15086682
RP11-89J11	15	 3	 8	17	 70312822	 70482383	 70397602
RP11-89L2	15	 4	 8	17	 48890711	 49020711	 48955711
RP11-90G21	15	 5	 8	17	 15321343	 15511681	 15416512
RP11-106J7	15	 6	 8	18	  3268728	  3443000	  3355864
RP11-102E12	15	 7	 8	18	  4457862	  4614130	  4535996
RP11-102O20	15	 8	 8	18	  9932013	 10105177	 10018595
RP11-24G5	15	 9	 8	18	 10150207	 10317495	 10233851
RP11-151D11	15	10	 8	18	 13082482	 13212482	 13147482
RP11-16A21	15	11	 8	18	 12586865	 12587248	 12587056
RP11-43K24	15	12	 8	18	 45622770	 45796804	 45709787
RP11-153B11	15	13	 8	18	 52818203	 52977905	 52898054
RP11-12J12	15	14	 8	18	 55424497	 55607583	 55516040
RP11-15C15	15	15	 8	18	 57210436	 57340436	 57275436
RP11-3K7	15	16	 8	18	 61064092	 61219700	 61141896
RP11-64C15	15	17	 8	18	 65506195	 65660915	 65583555
RP11-258I23	15	18	 8	X	 40883525	 41063701	 40973613
RP11-180F16	15	19	 8	X	 19243413	 19243801	 19243607
RP11-46A23_1	15	20	 8	X	 30874687	 31028427	 30951557
RP11-70D7	15	21	 8	X	 34149876	 34279876	 34214876
RP11-126A13	15	22	 8	X	 55300034	 55467771	 55383902
RP11-204D21	15	23	 8	X	 68051930	 68222259	 68137094
RP11-177A4	15	24	 8	X	 69047580	 69196884	 69122232
RP11-270O24	15	25	 8	X	 99735635	 99735885	 99735760
RP11-63E7	15	 1	 9	X	122162569	122361961	122262265
RP11-79N19_1	15	 2	 9	X	110626553	110776708	110701630
RP11-65I1	15	 3	 9	X	130139678	130140087	130139882
RP11-97N5	15	 4	 9	X	134702950	134880261	134791605
CTD-2193N9	15	 5	 9	X	 30082130	 30082326	 30082228
RP11-79B3	15	 6	 9	X	 24031969	 24224112	 24128040
RP11-79C13	15	 7	 9	X	 73682478	 73852483	 73767480
RP11-79J11	15	 8	 9	X	103968427	104126472	104047449
RP11-79N19_2	15	 9	 9	X	110626553	110776708	110701630
RP11-80F14	15	10	 9	X	110995254	111157201	111076227
RP11-91I16	15	11	 9	X	 39019190	 39195099	 39107144
RP11-91K14	15	12	 9	X	 98030187	 98179321	 98104754
RP11-451G24	15	13	 9	X	  9293357	  9478124	  9385740
RP11-451A22	15	14	 9	X	 77422432	 77552432	 77487432
RP11-185N10	15	15	 9	Y	 21488846	 21618846	 21553846
RP11-140H23	15	16	 9	Y	 23540723	 23735286	 23638004
RP11-290D2	15	17	 9	13	 44666354	 44827651	 44747002
RP11-290M5	15	18	 9	01	 85672020	 85852594	 85762307
RP11-291H24	15	19	 9	15	 53784368	 53984710	 53884539
RP11-292O3	15	20	 9	01	116969019	117069987	117019503
RP11-294A3	15	21	 9	16	 45188242	 45375530	 45281886
RP11-296A16	15	22	 9	15	 41764307	 41935933	 41850120
RP11-309L24	15	23	 9	07	128044854	128245051	128144952
RP11-313B13	15	24	 9	04	111934708	112064708	111999708
RP11-313L9	15	25	 9	13	109059437	109253923	109156680
RP11-315O6	15	 1	10	11	101724636	101939137	101831886
RP11-316J16	15	 2	10	03	 23759859	 23949788	 23854823
RP11-317B10	15	 3	10	09	133520036	133650036	133585036
RP11-324G2	15	 4	10	18	   168383	   340511	   254447
RP11-326F20	15	 5	10	09	 33086347	 33249752	 33168049
RP11-328D5	15	 6	10	01	204422292	204621198	204521745
RP11-330H6	15	 7	10	03	 52033265	 52242518	 52137891
RP11-331D5	15	 8	10	07	156680451	156871297	156775874
RP11-331G2	15	 9	10	03	 39135071	 39311656	 39223363
RP11-339I2	15	10	10	01	182933804	183127274	183030539
RP11-341H1	15	11	10	02	135429177	135593357	135511267
RP11-342I1	15	12	10	04	140977612	141071654	141024633
RP11-344G20	15	13	10	20	 43793269	 43973797	 43883533
RP11-345O18	15	14	10	11	 86172466	 86363320	 86267893
RP11-347O8	15	15	10	04	103744494	103938493	103841493
RP11-747O10	15	16	10	18	 43499253	 43667415	 43583334
RP11-750A9	15	17	10	11	 47277667	 47456545	 47367106
RP11-757A13	15	18	10	07	 98937882	 99061660	 98999771
RP11-758M15	15	19	10	03	 52177496	 52359557	 52268526
RP11-772K10	15	20	10	11	 64281448	 64471160	 64376304
RP11-774P10	15	21	10	16	 55894946	 56053884	 55974415
RP11-796E2	15	22	10	12	 90910670	 91127510	 91019090
RP11-799H21	15	23	10	08	 29147481	 29342627	 29245054
RP11-802E16	15	24	10	11	 67395614	 67616071	 67505842
RP11-804M4	15	25	10	02	215961119	216057747	216009433
RP11-809C23	15	 1	11	02	136639025	136811306	136725165
RP11-815E8	15	 2	11	19	  6671442	  6845407	  6758424
RP11-892K21	15	 3	11	11	118286182	118491533	118388857
RP11-949J7	15	 4	11	03	 49393331	 49579894	 49486612
RP11-968A15	15	 5	11	12	 52908874	 53049877	 52979375
RP11-1016H17	15	 6	11	03	  9969833	 10177540	 10073686
RP11-1060G2	15	 7	11	12	 92731060	 92904825	 92817942
RP11-1136G11	15	 8	11	12	 51745454	 51903261	 51824357
RP11-1078O11	15	 9	11	22	 39813226	 39980698	 39896962
RP11-124K18	15	10	11	05	112042378	112226654	112134516
RP11-163N6	15	11	11	08	 61361247	 61535036	 61448141
RP11-199F11	15	12	11	17	  7438407	  7599152	  7518779
RP11-262M10	15	13	11	01	 58797818	 58963509	 58880663
RP11-298C17	15	14	11	19	  9998864	 10195739	 10097301
RP11-302K17	15	15	11	10	103807990	103966424	103887207
RP11-305G6	15	16	11	05	178970248	179177189	179073718
RP11-313F11	15	17	11	03	197210939	197374610	197292774
RP11-315M18	15	18	11	18	 75310952	 75520057	 75415504
RP11-320J20	15	19	11	12	 15366806	 15658372	 15512589
RP11-324I22	15	20	11	10	 35535787	 35726477	 35631132
RP11-346I14	15	21	11	02	237726562	237804292	237765427
RP11-346N8	15	22	11	06	 93895951	 94095174	 93995562
RP11-348A14	15	23	11	15	 46349993	 46542061	 46446027
RP11-349H15	15	24	11	15	 63341485	 63542459	 63441972
RP11-351I24	15	25	11	11	 10200311	 10390198	 10295254
RP11-354C13	15	 1	12	05	177410187	177581223	177495705
RP11-371F15	15	 2	12	04	140278803	140399637	140339220
RP11-373D23	15	 3	12	02	 28472603	 28630268	 28551435
RP11-375H24	15	 4	12	01	223345872	223475872	223410872
RP11-379K17	15	 5	12	03	171099042	171303959	171201500
RP11-380G21	15	 6	12	07	 97120935	 97292680	 97206807
RP11-382J12	15	 7	12	08	 71614506	 71778503	 71696504
RP11-400L8	15	 8	12	02	  9443666	  9615319	  9529492
RP11-403P14	15	 9	12	01	161535853	161733335	161634594
RP11-404C6	15	10	12	10	 70784880	 70979123	 70882001
RP11-406H21	15	11	12	10	 17108128	 17255408	 17181768
RP11-412M16	15	12	12	11	   474042	   626401	   550221
RP11-417F21	15	13	12	02	 46604397	 46785802	 46695099
RP11-804H8	15	14	12	03	 50533656	 50725980	 50629818
RP11-808F20	15	15	12	18	 13529783	 13722981	 13626382
RP11-810O3	15	16	12	X	113906291	114053579	113979935
RP11-818O24	15	17	12	17	  1099691	  1299375	  1199533
RP11-832D10	15	18	12	07	 50368182	 50553951	 50461066
RP11-875H7	15	19	12	03	 55336445	 55537823	 55437134
RP11-324P13	15	20	12	06	145667121	145765669	145716395
RP11-419C9	15	21	12	05	 28711576	 28921480	 28816528
RP11-449F7	15	22	12	03	 99049002	 99258538	 99153770
RP11-518F7	15	23	12	X	140118608	140161097	140139852
RP11-574A21	15	24	12	X	 96205322	 96276491	 96240906
RP11-801I18	15	25	12	06	 82669014	 82866445	 82767729
RP11-89P8	15	13	13	01	 30534880	 30664880	 30599880
RP11-90A5	15	14	13	01	209093983	209251270	209172626
RP11-90C19	15	15	13	01	173928116	174113266	174020691
RP11-90D15	15	16	13	01	 12798944	 12961246	 12880095
RP11-90F17	15	17	13	01	 48215170	 48372587	 48293878
RP11-90H3	15	18	13	01	106012867	106171905	106092386
RP11-91E21	15	19	13	01	180249896	180412398	180331147
RP11-91G6	15	20	13	01	209262364	209427471	209344917
RP11-91G14	15	21	13	01	156842796	156998855	156920825
RP11-451C22	15	22	13	01	 85453742	 85583742	 85518742
RP11-449D11	15	23	13	01	 14780822	 14910822	 14845822
RP11-449B23	15	24	13	01	160910439	161063703	160987071
RP11-77G15_1	15	25	13	02	 34191612	 34356053	 34273832
RP11-163N11	15	 1	14	02	 37828547	 37958547	 37893547
RP11-119J12_1	15	 2	14	02	 45722682	 45896568	 45809625
RP11-81L7_1	15	 3	14	02	 57065869	 57218868	 57142368
RP11-87C16_1	15	 4	14	02	 73327095	 73327385	 73327240
RP11-113N17_1	15	 5	14	02	 82523780	 82682205	 82602992
RP11-72H23_1	15	 6	14	02	148636288	148766288	148701288
RP11-185M22_1	15	 7	14	02	152488388	152667424	152577906
RP11-50J20_1	15	 8	14	02	160394495	160524495	160459495
RP11-218D15_1	15	 9	14	02	171199763	171200132	171199947
RP11-12N7_1	15	10	14	02	175850411	176023129	175936770
RP11-250B10	15	11	14	02	179481731	179482120	179481925
RP11-79F11	15	12	14	03	165317576	165466440	165392008
RP11-79L9	15	13	14	03	139736336	139888324	139812330
RP11-80D24	15	14	14	03	 17181327	 17345316	 17263321
RP11-80H24	15	15	14	03	 83663409	 83818948	 83741178
RP11-80L14	15	16	14	03	165220246	165392762	165306504
RP11-81D17	15	17	14	03	 83454311	 83606092	 83530201
RP11-89F24	15	18	14	03	158902681	159032681	158967681
RP11-89J17	15	19	14	03	175774668	175941775	175858221
RP11-90B15	15	20	14	03	 40114413	 40265880	 40190146
RP11-90H23	15	21	14	03	 38360376	 38540543	 38450459
RP11-90I13	15	22	14	03	108357997	108518260	108438128
RP11-90M7	15	23	14	03	164366662	164516640	164441651
RP11-91K8	15	24	14	03	134600393	134771767	134686080
RP11-91M24	15	25	14	03	161356212	161536133	161446172
RP11-91A17	15	 1	15	03	175284032	175453150	175368591
RP11-91E8	15	 2	15	03	 45989823	 46150261	 46070042
RP11-451E6	15	 3	15		NA	NA	NA
RP11-451A20	15	 4	15	03	 17960804	 18148477	 18054640
RP11-34C20	15	 5	15	04	 11010385	 11140385	 11075385
RP11-171P21	15	 6	15	04	 15121503	 15280107	 15200805
RP11-11M9	15	 7	15	04	 19113233	 19264204	 19188718
RP11-238L9	15	 8	15	04	 20339949	 20469949	 20404949
RP11-276O17	15	 9	15		NA	NA	NA
RP11-119N7	15	10	15	04	 25760196	 25940926	 25850561
RP11-1H14	15	11	15	05	 77882778	 78047813	 77965295
RP11-207B2	15	12	15	05	 81708786	 81709141	 81708963
RP11-275E14	15	13	15	05	 82802677	 82948633	 82875655
RP11-135F5	15	14	15	05	 85972037	 86118543	 86045290
RP11-204D12	15	15	15	05	 95832945	 95833289	 95833117
RP11-203J7	15	16	15	05	102680445	102841325	102760885
RP11-42M12	15	17	15	05	127176867	127327843	127252355
RP11-21C10	15	18	15	05	133880078	134045975	133963026
RP11-233E5	15	19	15	05	137606195	137606553	137606374
RP11-55M16	15	20	15	05	141030989	141196500	141113744
RP11-109G16	15	21	15	05	147210085	147295681	147252883
RP11-216N13	15	22	15	05	147210085	147295681	147252883
RP11-94L2	15	23	15	05	163254098	163422484	163338291
RP11-128E4	15	24	15	05	164910279	164910625	164910452
RP11-35O10	15	25	15	05	166928205	166928548	166928376
RP11-15F10	15	 1	16	05	169073439	169267747	169170593
RP11-9I14	15	 2	16	05	171131260	171131478	171131369
RP11-88L12_1	15	 3	16	05	172525555	172659287	172592421
CTD-2040C2	15	 4	16	05	 14563022	 14563146	 14563084
CTD-2090L24	15	 5	16	05	135426974	135427405	135427189
RP11-79E13	15	 6	16	05	 20454045	 20638418	 20546231
RP11-79I9	15	 7	16	05	144422706	144594364	144508535
RP11-79C6_1	15	 8	16	05	 35825919	 35991223	 35908571
RP11-79I6	15	 9	16	05	150272828	150434140	150353484
RP11-19G12	15	10	16	07	129031108	129161108	129096108
RP11-35B6	15	11	16	07	128540689	128708642	128624665
RP11-38P11	15	12	16	07	129557648	129557976	129557812
RP11-88K4	15	13	16	07	136070649	136223639	136147144
RP11-22G20	15	14	16	07	136641566	136808402	136724984
RP11-236O18	15	15	16	07	138444631	138445061	138444846
RP11-79E7	15	16	16	07	133346521	133508041	133427281
RP11-79G19	15	17	16	07	106954782	107084782	107019782
RP11-79K23	15	18	16	07	147191958	147343032	147267495
RP11-79O21	15	19	16	07	 11826764	 11967665	 11897214
RP11-79M8	15	20	16	07	144254564	144381963	144318263
RP11-80J6	15	21	16	07	 29525391	 29691185	 29608288
RP11-88D24	15	22	16	07	 84594874	 84797946	 84696410
RP11-88H22	15	23	16	07	 69740328	 69907866	 69824097
RP11-89A20	15	24	16	07	 73591648	 73751830	 73671739
RP11-89M2	15	25	16	07	106258220	106426274	106342247
RP11-89B15	15	 1	17	07	 15439547	 15590902	 15515224
RP11-89D15	15	 2	17	07	 67384611	 67537380	 67460995
RP11-90N11	15	 3	17	07	 53704725	 53864621	 53784673
RP11-91F7	15	 4	17	07	111223787	111381705	111302746
RP11-91L7	15	 5	17		NA	NA	NA
RP11-91C9	15	 6	17	07	 52203658	 52372302	 52287980
RP11-91A24	15	 7	17	07	 15739212	 15921028	 15830120
RP11-91E16	15	 8	17	07	 35427720	 35587255	 35507487
RP11-229N14	15	 9	17	09	116740742	116741128	116740935
RP11-102F20	15	10	17	09	118051291	118207106	118129198
RP11-13C11	15	11	17	09	124186424	124316424	124251424
RP11-59O19	15	12	17	09	121607922	121608385	121608153
RP11-81P5_1	15	13	17	09	132115449	132308214	132211831
RP11-130E20	15	14	17	09	131403485	131403635	131403560
RP11-79I21	15	15	17	09	 86382439	 86536303	 86459371
RP11-80H12	15	16	17	09	100788634	100957682	100873158
RP11-80J10	15	17	17	09	 90495687	 90659165	 90577426
RP11-80N14	15	18	17	09	103308723	103436402	103372562
RP11-81B19	15	19	17	09	 27342516	 27492813	 27417664
RP11-81L11	15	20	17	09	131544223	131699592	131621907
RP11-89J21	15	21	17	09	136124422	136254422	136189422
RP11-89N14	15	22	17	09	111045358	111175358	111110358
RP11-90B11	15	23	17	09	135385345	135554504	135469924
RP11-91D7	15	24	17	09	 98864875	 99033074	 98948974
RP11-91L19	15	25	17	09	102123900	102280695	102202297
RP11-91M3	15	 1	18	09	 86036496	 86197287	 86116891
RP11-77O20	15	 2	18	10	  5622356	  5844765	  5733560
RP11-33J8	15	 3	18	10	  7223296	  7353296	  7288296
RP11-30L1	15	 4	18	10	  6380505	  6523870	  6452187
RP11-35I11	15	 5	18	10	  8917259	  9047259	  8982259
RP11-42I17	15	 6	18	10	  8218574	  8348574	  8283574
RP11-11L13	15	 7	18	10	 11831014	 11961014	 11896014
RP11-184G18	15	 8	18	11	 94521012	 94521387	 94521199
RP11-15J1	15	 9	18	11	 93845955	 93975955	 93910955
RP11-97D3	15	10	18	11	 95154708	 95284708	 95219708
RP11-258C1	15	11	18	11	 99810208	 99988933	 99899570
RP11-134G19	15	12	18	11	101470600	101600600	101535600
RP11-179B7	15	13	18	11	103803542	103965030	103884286
RP11-36M5	15	14	18	11	113498565	113670911	113584738
RP11-270N1	15	15	18	11	111424180	111554180	111489180
RP11-158I9	15	16	18	11	118158911	118354320	118256615
RP11-45N4	15	17	18	11	117978549	118170478	118074513
RP11-8K10	15	18	18	11	119158031	119335760	119246895
RP11-117K21	15	19	18	11	119773356	119939639	119856497
RP11-121G24	15	20	18	11	127376748	127572076	127474412
CTD-2012D15	15	21	18	11	104171070	104301070	104236070
CTD-2039C11	15	22	18	11	101713532	101713633	101713582
CTD-2051G10	15	23	18	11	 47415921	 47416114	 47416017
CTD-2137G15	15	24	18	11	101736992	101866992	101801992
RP11-79O11	15	25	18	11	 43796634	 43946801	 43871717
RP11-81D23	15	 1	19	11	 18150599	 18307445	 18229022
RP11-89A24	15	 2	19	11	 34735445	 34883935	 34809690
RP11-89G10	15	 3	19	11	 74416662	 74580961	 74498811
RP11-89M14	15	 4	19	11	 83673727	 83842293	 83758010
RP11-89B9	15	 5	19	11	  4907175	  5070333	  4988754
RP11-89H11_2	15	 6	19	11	 86725843	 86890447	 86808145
RP11-67G19	15	 7	19	14	 20307106	 20463883	 20385494
RP11-14O20	15	 8	19	14	 20231795	 20232170	 20231982
RP11-68M15	15	 9	19	14	 22546684	 22722266	 22634475
RP11-189N14	15	10	19	14	 23608219	 23620284	 23614251
RP11-256D1	15	11	19	14	 23608219	 23620284	 23614251
RP11-94D17	15	12	19	14	 25688025	 25863159	 25775592
RP11-52O23	15	13	19	14	 47210218	 47340218	 47275218
RP11-90K14	15	14	19	14	 50926108	 51082605	 51004356
RP11-137D17	15	15	19	14	 51003055	 51163616	 51083335
RP11-122A4	15	16	19	14	 51983833	 52138209	 52061021
RP11-12P7	15	17	19	14	 53126974	 53278923	 53202948
RP11-172G1	15	18	19	14	 54600496	 54730496	 54665496
RP11-156E22	15	19	19	14	 66847837	 67014199	 66931018
RP11-1J10	15	20	19	01	236183893	236384595	236284244
RP11-72J8	15	21	19	14	 69266041	 69440807	 69353424
RP11-92H20	15	22	19	14	 74381659	 74551240	 74466449
RP11-29N19	15	23	19	14	 76177039	 76307039	 76242039
RP11-285P21	15	24	19	14	 77615202	 77626345	 77620773
RP11-111F22	15	25	19	14	 98898186	 99028186	 98963186
RP11-128L1	15	 1	20	14	 99817214	 99817389	 99817301
RP11-9D19	15	 2	20	14	100327127	100457127	100392127
RP11-121H7	15	 3	20	14	101461362	101461762	101461562
CTD-2209E7	15	 4	20	14	 60977407	 61107407	 61042407
RP11-79M1	15	 5	20	14	 59822512	 59952512	 59887512
RP11-41E12	15	 6	20	17	 68729134	 68859134	 68794134
RP11-145C11	15	 7	20	17	 70573094	 70573570	 70573332
RP11-201E5	15	 8	20	17	 71406319	 71406634	 71406476
RP11-84J3	15	 9	20	17	 74557252	 74557432	 74557342
RP11-46E14	15	10	20	17	 75316873	 75477363	 75397118
RP11-160F4_2	15	11	20	17	 75981826	 75982171	 75981998
RP11-89A22	15	12	20	17	 36023271	 36186130	 36104700
RP11-89B11	15	13	20	17	 71812479	 71959499	 71885989
RP11-89F21	15	14	20	17	 15021682	 15151682	 15086682
RP11-89J11	15	15	20	17	 70312822	 70482383	 70397602
RP11-89L2	15	16	20	17	 48890711	 49020711	 48955711
RP11-90G21	15	17	20	17	 15321343	 15511681	 15416512
RP11-106J7	15	18	20	18	  3268728	  3443000	  3355864
RP11-102E12	15	19	20	18	  4457862	  4614130	  4535996
RP11-102O20	15	20	20	18	  9932013	 10105177	 10018595
RP11-24G5	15	21	20	18	 10150207	 10317495	 10233851
RP11-151D11	15	22	20	18	 13082482	 13212482	 13147482
RP11-16A21	15	23	20	18	 12586865	 12587248	 12587056
RP11-43K24	15	24	20	18	 45622770	 45796804	 45709787
RP11-153B11	15	25	20	18	 52818203	 52977905	 52898054
RP11-12J12	15	 1	21	18	 55424497	 55607583	 55516040
RP11-15C15	15	 2	21	18	 57210436	 57340436	 57275436
RP11-3K7	15	 3	21	18	 61064092	 61219700	 61141896
RP11-64C15	15	 4	21	18	 65506195	 65660915	 65583555
RP11-258I23	15	 5	21	X	 40883525	 41063701	 40973613
RP11-180F16	15	 6	21	X	 19243413	 19243801	 19243607
RP11-46A23_1	15	 7	21	X	 30874687	 31028427	 30951557
RP11-70D7	15	 8	21	X	 34149876	 34279876	 34214876
RP11-126A13	15	 9	21	X	 55300034	 55467771	 55383902
RP11-204D21	15	10	21	X	 68051930	 68222259	 68137094
RP11-177A4	15	11	21	X	 69047580	 69196884	 69122232
RP11-270O24	15	12	21	X	 99735635	 99735885	 99735760
RP11-63E7	15	13	21	X	122162569	122361961	122262265
RP11-79N19_1	15	14	21	X	110626553	110776708	110701630
RP11-65I1	15	15	21	X	130139678	130140087	130139882
RP11-97N5	15	16	21	X	134702950	134880261	134791605
CTD-2193N9	15	17	21	X	 30082130	 30082326	 30082228
RP11-79B3	15	18	21	X	 24031969	 24224112	 24128040
RP11-79C13	15	19	21	X	 73682478	 73852483	 73767480
RP11-79J11	15	20	21	X	103968427	104126472	104047449
RP11-79N19_2	15	21	21	X	110626553	110776708	110701630
RP11-80F14	15	22	21	X	110995254	111157201	111076227
RP11-91I16	15	23	21	X	 39019190	 39195099	 39107144
RP11-91K14	15	24	21	X	 98030187	 98179321	 98104754
RP11-451G24	15	25	21	X	  9293357	  9478124	  9385740
RP11-451A22	15	 1	22	X	 77422432	 77552432	 77487432
RP11-185N10	15	 2	22	Y	 21488846	 21618846	 21553846
RP11-140H23	15	 3	22	Y	 23540723	 23735286	 23638004
RP11-290D2	15	 4	22	13	 44666354	 44827651	 44747002
RP11-290M5	15	 5	22	01	 85672020	 85852594	 85762307
RP11-291H24	15	 6	22	15	 53784368	 53984710	 53884539
RP11-292O3	15	 7	22	01	116969019	117069987	117019503
RP11-294A3	15	 8	22	16	 45188242	 45375530	 45281886
RP11-296A16	15	 9	22	15	 41764307	 41935933	 41850120
RP11-309L24	15	10	22	07	128044854	128245051	128144952
RP11-313B13	15	11	22	04	111934708	112064708	111999708
RP11-313L9	15	12	22	13	109059437	109253923	109156680
RP11-315O6	15	13	22	11	101724636	101939137	101831886
RP11-316J16	15	14	22	03	 23759859	 23949788	 23854823
RP11-317B10	15	15	22	09	133520036	133650036	133585036
RP11-324G2	15	16	22	18	   168383	   340511	   254447
RP11-326F20	15	17	22	09	 33086347	 33249752	 33168049
RP11-328D5	15	18	22	01	204422292	204621198	204521745
RP11-330H6	15	19	22	03	 52033265	 52242518	 52137891
RP11-331D5	15	20	22	07	156680451	156871297	156775874
RP11-331G2	15	21	22	03	 39135071	 39311656	 39223363
RP11-339I2	15	22	22	01	182933804	183127274	183030539
RP11-341H1	15	23	22	02	135429177	135593357	135511267
RP11-342I1	15	24	22	04	140977612	141071654	141024633
RP11-344G20	15	25	22	20	 43793269	 43973797	 43883533
RP11-345O18	15	 1	23	11	 86172466	 86363320	 86267893
RP11-347O8	15	 2	23	04	103744494	103938493	103841493
RP11-747O10	15	 3	23	18	 43499253	 43667415	 43583334
RP11-750A9	15	 4	23	11	 47277667	 47456545	 47367106
RP11-757A13	15	 5	23	07	 98937882	 99061660	 98999771
RP11-758M15	15	 6	23	03	 52177496	 52359557	 52268526
RP11-772K10	15	 7	23	11	 64281448	 64471160	 64376304
RP11-774P10	15	 8	23	16	 55894946	 56053884	 55974415
RP11-796E2	15	 9	23	12	 90910670	 91127510	 91019090
RP11-799H21	15	10	23	08	 29147481	 29342627	 29245054
RP11-802E16	15	11	23	11	 67395614	 67616071	 67505842
RP11-804M4	15	12	23	02	215961119	216057747	216009433
RP11-809C23	15	13	23	02	136639025	136811306	136725165
RP11-815E8	15	14	23	19	  6671442	  6845407	  6758424
RP11-892K21	15	15	23	11	118286182	118491533	118388857
RP11-949J7	15	16	23	03	 49393331	 49579894	 49486612
RP11-968A15	15	17	23	12	 52908874	 53049877	 52979375
RP11-1016H17	15	18	23	03	  9969833	 10177540	 10073686
RP11-1060G2	15	19	23	12	 92731060	 92904825	 92817942
RP11-1136G11	15	20	23	12	 51745454	 51903261	 51824357
RP11-1078O11	15	21	23	22	 39813226	 39980698	 39896962
RP11-124K18	15	22	23	05	112042378	112226654	112134516
RP11-163N6	15	23	23	08	 61361247	 61535036	 61448141
RP11-199F11	15	24	23	17	  7438407	  7599152	  7518779
RP11-262M10	15	25	23	01	 58797818	 58963509	 58880663
RP11-298C17	15	 1	24	19	  9998864	 10195739	 10097301
RP11-302K17	15	 2	24	10	103807990	103966424	103887207
RP11-305G6	15	 3	24	05	178970248	179177189	179073718
RP11-313F11	15	 4	24	03	197210939	197374610	197292774
RP11-315M18	15	 5	24	18	 75310952	 75520057	 75415504
RP11-320J20	15	 6	24	12	 15366806	 15658372	 15512589
RP11-324I22	15	 7	24	10	 35535787	 35726477	 35631132
RP11-346I14	15	 8	24	02	237726562	237804292	237765427
RP11-346N8	15	 9	24	06	 93895951	 94095174	 93995562
RP11-348A14	15	10	24	15	 46349993	 46542061	 46446027
RP11-349H15	15	11	24	15	 63341485	 63542459	 63441972
RP11-351I24	15	12	24	11	 10200311	 10390198	 10295254
RP11-354C13	15	13	24	05	177410187	177581223	177495705
RP11-371F15	15	14	24	04	140278803	140399637	140339220
RP11-373D23	15	15	24	02	 28472603	 28630268	 28551435
RP11-375H24	15	16	24	01	223345872	223475872	223410872
RP11-379K17	15	17	24	03	171099042	171303959	171201500
RP11-380G21	15	18	24	07	 97120935	 97292680	 97206807
RP11-382J12	15	19	24	08	 71614506	 71778503	 71696504
RP11-400L8	15	20	24	02	  9443666	  9615319	  9529492
RP11-403P14	15	21	24	01	161535853	161733335	161634594
RP11-404C6	15	22	24	10	 70784880	 70979123	 70882001
RP11-406H21	15	23	24	10	 17108128	 17255408	 17181768
RP11-412M16	15	24	24	11	   474042	   626401	   550221
RP11-417F21	15	25	24	02	 46604397	 46785802	 46695099
RP11-804H8	15	 1	25	03	 50533656	 50725980	 50629818
RP11-808F20	15	 2	25	18	 13529783	 13722981	 13626382
RP11-810O3	15	 3	25	X	113906291	114053579	113979935
RP11-818O24	15	 4	25	17	  1099691	  1299375	  1199533
RP11-832D10	15	 5	25	07	 50368182	 50553951	 50461066
RP11-875H7	15	 6	25	03	 55336445	 55537823	 55437134
RP11-324P13	15	 7	25	06	145667121	145765669	145716395
RP11-419C9	15	 8	25	05	 28711576	 28921480	 28816528
RP11-449F7	15	 9	25	03	 99049002	 99258538	 99153770
RP11-518F7	15	10	25	X	140118608	140161097	140139852
RP11-574A21	15	11	25	X	 96205322	 96276491	 96240906
RP11-801I18	15	12	25	06	 82669014	 82866445	 82767729
RP11-188B21_1	16	 1	 1	02	233533279	233533666	233533472
RP11-176L22_1	16	 2	 1	02	233261162	233411463	233336312
RP11-21K1_1	16	 3	 1	02	235359842	235560352	235460097
RP11-155J6	16	 4	 1	02	236997077	237160381	237078729
RP11-44N6	16	 5	 1	02	154687037	154827502	154757269
RP11-171B14	16	 6	 1	02	137892718	138062646	137977682
RP11-79C2	16	 7	 1	02	224577925	224744460	224661192
RP11-79E20	16	 8	 1	02	 19899402	 20095951	 19997676
RP11-79D11	16	 9	 1	02	173327763	173457763	173392763
RP11-79L13	16	10	 1	02	162827775	163000845	162914310
RP11-80H16	16	11	 1	02	 23152390	 23333054	 23242722
RP11-81B17	16	12	 1	02	117260763	117433905	117347334
RP11-88F14	16	13	 1	02	105412085	105542085	105477085
RP11-88H14	16	14	 1	02	 31723668	 31888889	 31806278
RP11-88L24	16	15	 1	02	179362190	179554241	179458215
RP11-88P22	16	16	 1	02	177536856	177708149	177622502
RP11-89C12	16	17	 1	02	 81645069	 81844745	 81744907
RP11-89K8	16	18	 1	02	206103078	206264936	206184007
RP11-89L12	16	19	 1	02	117048343	117178343	117113343
RP11-90A1	16	20	 1	02	 59184118	 59384931	 59284524
RP11-90C7	16	21	 1	02	 86158822	 86327867	 86243344
RP11-90E11	16	22	 1	02	242080843	242258437	242169640
RP11-90D1	16	23	 1	02	 59184123	 59384904	 59284513
RP11-90H11	16	24	 1	02	  2292890	  2434127	  2363508
RP11-24G16	16	25	 1	04	 37927768	 38103870	 38015819
RP11-113F10	16	 1	 2	04	 42263408	 42427822	 42345615
RP11-38M16	16	 2	 2	04	 40138962	 40214695	 40176828
RP11-253O5	16	 3	 2	04	 44399298	 44400116	 44399707
RP11-42A17	16	 4	 2	04	 45744550	 45940192	 45842371
RP11-232D21	16	 5	 2	04	 48027639	 48028065	 48027852
RP11-63E13	16	 6	 2	04	 66429318	 66573257	 66501287
RP11-111K19	16	 7	 2	04	 68281385	 68475605	 68378495
RP11-117B11	16	 8	 2	04	 73387091	 73517091	 73452091
RP11-69P19	16	 9	 2	04	 75102490	 75258584	 75180537
RP11-78K8	16	10	 2	04	 75218717	 75269440	 75244078
RP11-115K14	16	11	 2	04	 75956684	 76129869	 76043276
RP11-120B2	16	12	 2	04	 87267933	 87441327	 87354630
RP11-203P12	16	13	 2	04	 88420522	 88550522	 88485522
RP11-36K8	16	14	 2	04	 90332193	 90486858	 90409525
RP11-49M7	16	15	 2	04	 91372661	 91514419	 91443540
RP11-115O16	16	16	 2	04	 94057008	 94187008	 94122008
RP11-21O14	16	17	 2	04	 97033562	 97188971	 97111266
RP11-26M17	16	18	 2	04	121097199	121097535	121097367
RP11-100E15	16	19	 2	04	123956718	124124639	124040678
RP11-27C19	16	20	 2	04	124646605	124779864	124713234
RP11-15O17	16	21	 2	04	126492866	126657913	126575389
RP11-52O3	16	22	 2	04	128490418	128646191	128568304
RP11-46O15	16	23	 2	04	129091486	129223693	129157589
RP11-88H16	16	24	 2	05	 23270416	 23444477	 23357446
RP11-88L12_2	16	25	 2	05	172525555	172659287	172592421
RP11-88L16	16	 1	 3	05	109732028	109913406	109822717
RP11-89C2	16	 2	 3	05	100535664	100711341	100623502
RP11-89F1	16	 3	 3	05	147438124	147609841	147523982
RP11-89N5	16	 4	 3	05	 62743588	 62907449	 62825518
RP11-90P7	16	 5	 3	05	 37971494	 38143787	 38057640
RP11-91I17	16	 6	 3	05	 77688731	 77862316	 77775523
RP11-91M19	16	 7	 3	05	  8165044	  8321512	  8243278
RP11-91M6	16	 8	 3	05	 40952566	 41122371	 41037468
RP11-91A5	16	 9	 3	05	 19485529	 19656108	 19570818
RP11-91G9	16	10	 3	05	112365146	112540350	112452748
RP11-1J24	16	11	 3	06	  7898180	  8041794	  7969987
RP11-126J14	16	12	 3	06	 13498387	 13658678	 13578532
RP11-113K20	16	13	 3	06	 15945330	 16075330	 16010330
RP11-163E21	16	14	 3	06	 16761167	 16923748	 16842457
RP11-43B4	16	15	 3	06	 20054590	 20184590	 20119590
RP11-288M24	16	16	 3	06	 20478015	 20495417	 20486716
RP11-133J6	16	17	 3	06	 39247684	 39433103	 39340393
RP11-105P7	16	18	 3	06	 40383155	 40383521	 40383338
RP11-10M23	16	19	 3	06	 43206594	 43206939	 43206766
RP11-121G20	16	20	 3	06	 44229174	 44385866	 44307520
RP11-39C2	16	21	 3	06	 47011433	 47165877	 47088655
RP11-40P17	16	22	 3	06	 51096440	 51096752	 51096596
RP11-218N24	16	23	 3	08	 11733527	 11733927	 11733727
RP11-241I4	16	24	 3	08	 10208528	 10365071	 10286799
RP11-262B15	16	25	 3	08	  9852835	  9989112	  9920973
RP11-235O5	16	 1	 4	08	 10512582	 10642582	 10577582
RP11-287P18	16	 2	 4	08	  7156823	  7328299	  7242561
RP11-92C1	16	 3	 4	08	 12880229	 13024002	 12952115
RP11-158F9	16	 4	 4	08	 24892794	 25022794	 24957794
RP11-70L1	16	 5	 4	08	 25332692	 25478056	 25405374
RP11-199N14	16	 6	 4	08	 26268358	 26398358	 26333358
RP11-138J2	16	 7	 4	08	 27277245	 27462612	 27369928
RP11-275K7	16	 8	 4	08	 28922992	 28923242	 28923117
RP11-277I21	16	 9	 4	08	 28997156	 28997369	 28997262
RP11-262I23	16	10	 4	08	 39846706	 40045213	 39945959
RP11-284J3	16	11	 4	08	 40762948	 40763242	 40763095
RP11-282J24	16	12	 4	08	 41764757	 41765007	 41764882
RP11-64C22	16	13	 4	08	 42469064	 42504177	 42486620
RP11-217N16	16	14	 4	08	 48143884	 48144225	 48144054
RP11-12L15_2	16	15	 4	08	 47924445	 48076131	 48000288
RP11-252M13	16	16	 4	08	 64446868	 64576868	 64511868
RP11-92M10	16	17	 4	08	 65806972	 65968093	 65887532
RP11-212P10	16	18	 4	08	 67505018	 67505512	 67505265
RP11-120N14	16	19	 4	08	 70476167	 70643235	 70559701
RP11-24L2	16	20	 4	08	 53518729	 53665974	 53592351
RP11-225J6	16	21	 4	08	 75821162	 75821465	 75821313
RP11-14A8	16	22	 4	10	 22173943	 22174301	 22174122
RP11-200C22	16	23	 4	10	 22658477	 22658879	 22658678
RP11-75N18	16	24	 4	10	 24876224	 24876393	 24876308
RP11-29I13	16	25	 4	10	 25629404	 25795512	 25712458
RP11-80C16	16	 1	 5		NA	NA	NA
RP11-15H10	16	 2	 5	10	 29617393	 29797223	 29707308
RP11-27P22	16	 3	 5		NA	NA	NA
RP11-133C15	16	 4	 5	10	 53584261	 53714261	 53649261
RP11-50A5	16	 5	 5	10	 60458334	 60588334	 60523334
RP11-8E20	16	 6	 5	10	 64236667	 64237086	 64236876
RP11-14I14	16	 7	 5	10	 64866984	 64996984	 64931984
RP11-48P18	16	 8	 5	10	 67324796	 67325187	 67324991
RP11-152N13	16	 9	 5	10	 74547474	 74697200	 74622337
RP11-282N18	16	10	 5	10	 74329218	 74329597	 74329407
RP11-112F5	16	11	 5	10	 77226915	 77356915	 77291915
RP11-17O5	16	12	 5	10	 78921398	 79059744	 78990571
RP11-21B16	16	13	 5	10	 79027041	 79157041	 79092041
RP11-31L4	16	14	 5	10	 80780241	 80947353	 80863797
RP11-80H11	16	15	 5	10	101392986	101533581	101463283
RP11-89G15	16	16	 5	10	103867137	103997137	103932137
RP11-37L21	16	17	 5	10	102716525	102846525	102781525
RP11-105N15	16	18	 5	10	103286013	103438878	103362445
RP11-21N23	16	19	 5	10	103910376	104040376	103975376
RP11-16H23_1	16	20	 5	10	105726308	105868279	105797293
RP11-91O4	16	21	 5	11	 93214215	 93381011	 93297613
RP11-91E22	16	22	 5	11	 87924468	 88085525	 88004996
RP11-164A10	16	23	 5	11	123678353	123844655	123761504
RP11-290F24	16	24	 5	11	  6061554	  6248175	  6154864
RP11-585L11	16	25	 5	11	  7737156	  7906746	  7821951
RP11-614C4	16	 1	 6	11	 14879390	 15009390	 14944390
RP11-215H22	16	 2	 6	11	 29826288	 29985929	 29906108
RP11-113M18	16	 3	 6	11	 29790258	 29956382	 29873320
RP11-632F3	16	 4	 6	11	  6786642	  6932850	  6859746
RP11-583C8	16	 5	 6	11	 14901488	 15031488	 14966488
RP11-33H21	16	 6	 6	11	  9086485	  9086878	  9086681
RP11-5F17	16	 7	 6	11	 61087210	 61296602	 61191906
RP11-110K11	16	 8	 6	12	   174175	   329903	   252039
RP11-74M9	16	 9	 6	12	  4177492	  4307492	  4242492
RP11-59H1_1	16	10	 6	12	 12766218	 12961341	 12863779
RP11-174L5	16	11	 6	12	 14735668	 14736047	 14735857
RP11-206D16	16	12	 6	12	 18416939	 18599946	 18508442
RP11-64J22	16	13	 6	12	 25753554	 25883554	 25818554
RP11-74I8	16	14	 6	12	 51016426	 51149115	 51082770
RP11-101H10	16	15	 6	12	 52180087	 52327387	 52253737
RP11-39G24	16	16	 6	12	 57375460	 57533489	 57454474
RP11-276L24	16	17	 6	12	 59175649	 59175955	 59175802
RP11-61P1	16	18	 6	12	 61398509	 61528509	 61463509
RP11-196H14	16	19	 6	12	 62738094	 62928731	 62833412
RP11-89D19	16	20	 6	14	 40596203	 40807716	 40701959
RP11-89B22	16	21	 6	14	 72852260	 72982260	 72917260
RP11-90H21	16	22	 6	14	 91057535	 91211987	 91134761
RP11-91H1	16	23	 6	14	 37473305	 37636084	 37554694
RP11-91J13	16	24	 6	14	 57486232	 57664119	 57575175
RP11-91C7	16	25	 6	14	 90549219	 90692115	 90620667
RP11-94G7	16	 1	 7		NA	NA	NA
RP11-115G22	16	 2	 7	15	 30179961	 30339503	 30259732
RP11-194H7	16	 3	 7	15	 32397742	 32527742	 32462742
RP11-35O8	16	 4	 7	15	 33909784	 34039784	 33974784
RP11-89O12_1	16	 5	 7	15	 45626014	 45768850	 45697432
RP11-58N19	16	 6	 7	15	 43682588	 43812588	 43747588
RP11-49K3	16	 7	 7	15	 48200957	 48330957	 48265957
RP11-221H24	16	 8	 7	15	 50881994	 50882419	 50882206
RP11-61K4	16	 9	 7	15	 53779680	 53968303	 53873991
RP11-30I7	16	10	 7	15	 54201403	 54362671	 54282037
RP11-213H12	16	11	 7	15	 56460802	 56461183	 56460992
RP11-99L18	16	12	 7	15	 57373165	 57523459	 57448312
RP11-54P3	16	13	 7	15	 64324122	 64483333	 64403727
RP11-221P9	16	14	 7	15	 66738510	 66738882	 66738696
RP11-28D6	16	15	 7	15	 67461044	 67591044	 67526044
RP11-2I17	16	16	 7	15	 70142500	 70313627	 70228063
RP11-33B6	16	17	 7	15	 70653302	 70783302	 70718302
RP11-10K12	16	18	 7	15	 76331274	 76517779	 76424526
RP11-79A24	16	19	 7	18	 64744976	 64886870	 64815923
RP11-79F3	16	20	 7	18	 19673025	 19826956	 19749990
RP11-80L18	16	21	 7	18	  3919884	  4092260	  4006072
RP11-88B2	16	22	 7	18	 61789719	 61970628	 61880173
RP11-88J12	16	23	 7	18	  3667422	  3822165	  3744793
RP11-89M10	16	24	 7	18	 37455957	 37620554	 37538255
RP11-90L15	16	25	 7	18	 68667333	 68809432	 68738382
RP11-91H13	16	 1	 8	18	 57105325	 57281638	 57193481
RP11-91H23	16	 2	 8	02	173608959	173738959	173673959
RP11-91K12	16	 3	 8	18	 42247743	 42414572	 42331157
RP11-20A13	16	 4	 8	18	 41645590	 41789206	 41717398
RP11-49M3	16	 5	 8	19	  2418856	  2548856	  2483856
RP11-46I12	16	 6	 8	19	 34301924	 34484482	 34393203
RP11-147D7	16	 7	 8	19	 37482371	 37612371	 37547371
RP11-92J4	16	 8	 8	19	 41164177	 41294177	 41229177
RP11-283B8	16	 9	 8	19	 43562945	 43563300	 43563122
RP11-118P21	16	10	 8	19	 43750848	 43880848	 43815848
RP11-208I3	16	11	 8	19	 47623831	 47753831	 47688831
RP11-510I16	16	12	 8	19	 55112145	 55291904	 55202024
CTD-2271H24	16	13	 8	19	 50668107	 50670276	 50669191
RP11-79M11	16	14	 8	19	 36958851	 37120074	 37039462
RP11-79A22	16	15	 8	19	 50091034	 50221034	 50156034
RP11-79K6	16	16	 8		NA	NA	NA
RP11-89H20	16	17	 8		NA	NA	NA
RP11-5A19_2	16	18	 8	16	 65622599	 65775720	 65699159
RP11-6J24	16	19	 8	09	  4551070	  4711082	  4631076
RP11-6L13	16	20	 8	04	 75100471	 75286151	 75193311
RP11-7G12	16	21	 8	01	162588511	162753015	162670763
RP11-8C21_2	16	22	 8	09	 88962453	 89168653	 89065553
RP11-8P13	16	23	 8	12	 32781790	 32936803	 32859296
RP11-18I14	16	24	 8	10	104104381	104271861	104188121
RP11-20J15_2	16	25	 8	10	 44024289	 44208763	 44116526
RP11-22O7	16	 1	 9	13	110117845	110281593	110199719
RP11-23K11	16	 2	 9	08	 59553434	 59700385	 59626909
RP11-24B10	16	 3	 9	01	207922099	208088901	208005500
RP11-24C3	16	 4	 9	03	 48357039	 48512503	 48434771
RP11-38F19	16	 5	 9	06	 46284897	 46413358	 46349127
RP11-44K16_2	16	 6	 9	14	 63974853	 64135779	 64055316
RP11-45I12	16	 7	 9	04	141648097	141794758	141721427
RP11-46C6	16	 8	 9	19	 48622384	 48834854	 48728619
RP11-47K11	16	 9	 9	01	 91591649	 91721649	 91656649
RP11-50I11	16	10	 9	19	 54367955	 54539337	 54453646
RP11-63G10	16	11	 9	01	 58891110	 59033774	 58962442
RP11-64J19	16	12	 9	17	 21014521	 21191548	 21103034
RP11-65B23_2	16	13	 9	09	 87484294	 87654534	 87569414
RP11-66B24	16	14	 9	15	 99149458	 99322865	 99236161
RP11-67A5	16	15	 9	19	 44449021	 44620150	 44534585
RP11-67L14	16	16	 9	02	113258398	113412612	113335505
RP11-361D15	16	17	 9	15	 57657461	 57844886	 57751173
RP11-361P13	16	18	 9	17	 59355639	 59584565	 59470102
RP11-364G22	16	19	 9	11	  5753679	  5927293	  5840486
RP11-365P13	16	20	 9	13	110332569	110487595	110410082
RP11-367E12	16	21	 9	08	 74911244	 75077232	 74994238
RP11-369K5	16	22	 9	17	 19626362	 19800213	 19713287
RP11-386D17	16	23	 9	03	185459319	185590700	185525009
RP11-386J22	16	24	 9	09	 70078699	 70261126	 70169912
RP11-387M24	16	25	 9	06	 43123645	 43253529	 43188587
RP11-388N6	16	 1	10	09	109258361	109266964	109262662
RP11-390K5	16	 2	10	11	 47087656	 47277673	 47182664
RP11-393M11	16	 3	10	04	 57104471	 57244315	 57174393
RP11-403E9	16	 4	10	17	 25520106	 25693302	 25606704
RP11-405A15	16	 5	10	15	 89134534	 89260211	 89197372
RP11-409K20	16	 6	10	09	129640780	129810743	129725761
RP11-413M20	16	 7	10	02	 27484705	 27680585	 27582645
RP11-415J8	16	 8	10	01	 33336864	 33525529	 33431196
RP11-416N2	16	 9	10	10	105276012	105479274	105377643
RP11-431O22	16	10	10	13	 52183617	 52356911	 52270264
RP11-432M24	16	11	10	13	 49029946	 49218245	 49124095
RP11-433M14	16	12	10	17	  1335633	  1530629	  1433131
RP11-434I13	16	13	10	02	113093410	113277267	113185338
RP11-437K17	16	14	10		NA	NA	NA
RP11-438O12	16	15	10	02	120629081	120846427	120737754
RP11-143F1	16	16	10	03	196361140	196559424	196460282
RP11-30B7	16	17	10		NA	NA	NA
RP11-90P13	16	18	10	07	   119395	   298664	   209029
RP11-86A14	16	19	10	08	   980565	  1165777	  1073171
RP11-1111J1	16	20	10	09	  3586471	  3722488	  3654479
RP11-413F20	16	21	10	10	135149730	135315306	135232518
RP11-433E24	16	22	10	21	 46717197	 46912065	 46814631
RP11-155F12	16	23	10	X	  2449592	  2605375	  2527483
RP11-414C23_2	16	24	10	Y	  2828833	  3000873	  2914853
RP11-1083I7	16	25	10	07	 45652590	 45849537	 45751063
RP11-1081A4	16	 1	11	15	 23128667	 23300013	 23214340
RP11-77H4	16	 2	11	X	100670327	100841153	100755740
RP11-1072J2	16	 3	11	16	  3715334	  3908518	  3811926
RP11-876L22	16	 4	11	17	 26575764	 26764746	 26670255
RP11-1007K14	16	 5	11	07	 18806956	 18989926	 18898441
RP11-299P16	16	 6	11	11	 32183840	 32376415	 32280127
RP11-930D21	16	 7	11	X	  9404667	  9620933	  9512800
RP11-26B12	16	 8	11	Y	 25241482	 25397173	 25319327
RP11-12N7_2	16	 9	11	02	175850411	176023129	175936770
RP11-14I17	16	10	11	08	 26206456	 26412170	 26309313
RP11-16G1	16	11	11	07	 32349237	 32518501	 32433869
RP11-18A3	16	12	11	09	109125382	109260361	109192871
RP11-19B4	16	13	11	04	 75144803	 75305544	 75225173
RP11-21M18	16	14	11	02	150982104	151157148	151069626
RP11-434B12	16	15	11	02	  8639083	  8821990	  8730536
RP11-437B10	16	16	11	15	 91203427	 91385746	 91294586
RP11-442O1	16	17	11	16	 83549706	 83749375	 83649540
RP11-444B4	16	18	11	02	 66674462	 66867765	 66771113
RP11-447E20	16	19	11	04	 74797879	 75012988	 74905433
RP11-453E3	16	20	11	01	204309333	204491819	204400576
RP11-472L10	16	21	11	11	 63363052	 63569828	 63466440
RP11-475E11	16	22	11	01	109045790	109228343	109137066
RP11-478C1	16	23	11	04	  2124125	  2318965	  2221545
RP11-478H11	16	24	11	X	 15198394	 15392886	 15295640
RP11-485O10	16	25	11	15	 46837057	 47011197	 46924127
RP11-491D2	16	 1	12	02	242138071	242221648	242179859
RP11-507E2	16	 2	12	05	150300398	150506311	150403354
RP11-513D5	16	 3	12	08	 38183042	 38358846	 38270944
RP11-518J6	16	 4	12	16	 69781966	 69959285	 69870625
RP11-520B23_2	16	 5	12	16	 11716267	 11875890	 11796078
RP11-520M5	16	 6	12	04	  2954854	  3111973	  3033413
RP11-525G13	16	 7	12	01	162534185	162634051	162584118
RP11-544A12	16	 8	12	09	130994804	131191826	131093315
RP11-552O4	16	 9	12	18	 22533011	 22703135	 22618073
RP11-560I21	16	10	12	06	132704221	132831924	132768072
RP11-562L3	16	11	12	08	 59380408	 59485155	 59432781
RP11-564G9	16	12	12	05	176797648	176987699	176892673
RP11-565O12	16	13	12	15	 82906978	 83102315	 83004646
RP11-944L7	16	14	12	03	 44459797	 44676832	 44568314
RP11-981P6	16	15	12	12	 88485308	 88591834	 88538571
RP11-1079K10	16	16	12	17	 44725271	 44908965	 44817118
RP11-1099M24	16	17	12	17	  7680806	  7868524	  7774665
RP11-1283H4	16	18	12	02	 86972667	 87159419	 87066043
RP11-188B21_1	16	13	13	02	233533279	233533666	233533472
RP11-176L22_1	16	14	13	02	233261162	233411463	233336312
RP11-21K1_1	16	15	13	02	235359842	235560352	235460097
RP11-155J6	16	16	13	02	236997077	237160381	237078729
RP11-44N6	16	17	13	02	154687037	154827502	154757269
RP11-171B14	16	18	13	02	137892718	138062646	137977682
RP11-79C2	16	19	13	02	224577925	224744460	224661192
RP11-79E20	16	20	13	02	 19899402	 20095951	 19997676
RP11-79D11	16	21	13	02	173327763	173457763	173392763
RP11-79L13	16	22	13	02	162827775	163000845	162914310
RP11-80H16	16	23	13	02	 23152390	 23333054	 23242722
RP11-81B17	16	24	13	02	117260763	117433905	117347334
RP11-88F14	16	25	13	02	105412085	105542085	105477085
RP11-88H14	16	 1	14	02	 31723668	 31888889	 31806278
RP11-88L24	16	 2	14	02	179362190	179554241	179458215
RP11-88P22	16	 3	14	02	177536856	177708149	177622502
RP11-89C12	16	 4	14	02	 81645069	 81844745	 81744907
RP11-89K8	16	 5	14	02	206103078	206264936	206184007
RP11-89L12	16	 6	14	02	117048343	117178343	117113343
RP11-90A1	16	 7	14	02	 59184118	 59384931	 59284524
RP11-90C7	16	 8	14	02	 86158822	 86327867	 86243344
RP11-90E11	16	 9	14	02	242080843	242258437	242169640
RP11-90D1	16	10	14	02	 59184123	 59384904	 59284513
RP11-90H11	16	11	14	02	  2292890	  2434127	  2363508
RP11-24G16	16	12	14	04	 37927768	 38103870	 38015819
RP11-113F10	16	13	14	04	 42263408	 42427822	 42345615
RP11-38M16	16	14	14	04	 40138962	 40214695	 40176828
RP11-253O5	16	15	14	04	 44399298	 44400116	 44399707
RP11-42A17	16	16	14	04	 45744550	 45940192	 45842371
RP11-232D21	16	17	14	04	 48027639	 48028065	 48027852
RP11-63E13	16	18	14	04	 66429318	 66573257	 66501287
RP11-111K19	16	19	14	04	 68281385	 68475605	 68378495
RP11-117B11	16	20	14	04	 73387091	 73517091	 73452091
RP11-69P19	16	21	14	04	 75102490	 75258584	 75180537
RP11-78K8	16	22	14	04	 75218717	 75269440	 75244078
RP11-115K14	16	23	14	04	 75956684	 76129869	 76043276
RP11-120B2	16	24	14	04	 87267933	 87441327	 87354630
RP11-203P12	16	25	14	04	 88420522	 88550522	 88485522
RP11-36K8	16	 1	15	04	 90332193	 90486858	 90409525
RP11-49M7	16	 2	15	04	 91372661	 91514419	 91443540
RP11-115O16	16	 3	15	04	 94057008	 94187008	 94122008
RP11-21O14	16	 4	15	04	 97033562	 97188971	 97111266
RP11-26M17	16	 5	15	04	121097199	121097535	121097367
RP11-100E15	16	 6	15	04	123956718	124124639	124040678
RP11-27C19	16	 7	15	04	124646605	124779864	124713234
RP11-15O17	16	 8	15	04	126492866	126657913	126575389
RP11-52O3	16	 9	15	04	128490418	128646191	128568304
RP11-46O15	16	10	15	04	129091486	129223693	129157589
RP11-88H16	16	11	15	05	 23270416	 23444477	 23357446
RP11-88L12_2	16	12	15	05	172525555	172659287	172592421
RP11-88L16	16	13	15	05	109732028	109913406	109822717
RP11-89C2	16	14	15	05	100535664	100711341	100623502
RP11-89F1	16	15	15	05	147438124	147609841	147523982
RP11-89N5	16	16	15	05	 62743588	 62907449	 62825518
RP11-90P7	16	17	15	05	 37971494	 38143787	 38057640
RP11-91I17	16	18	15	05	 77688731	 77862316	 77775523
RP11-91M19	16	19	15	05	  8165044	  8321512	  8243278
RP11-91M6	16	20	15	05	 40952566	 41122371	 41037468
RP11-91A5	16	21	15	05	 19485529	 19656108	 19570818
RP11-91G9	16	22	15	05	112365146	112540350	112452748
RP11-1J24	16	23	15	06	  7898180	  8041794	  7969987
RP11-126J14	16	24	15	06	 13498387	 13658678	 13578532
RP11-113K20	16	25	15	06	 15945330	 16075330	 16010330
RP11-163E21	16	 1	16	06	 16761167	 16923748	 16842457
RP11-43B4	16	 2	16	06	 20054590	 20184590	 20119590
RP11-288M24	16	 3	16	06	 20478015	 20495417	 20486716
RP11-133J6	16	 4	16	06	 39247684	 39433103	 39340393
RP11-105P7	16	 5	16	06	 40383155	 40383521	 40383338
RP11-10M23	16	 6	16	06	 43206594	 43206939	 43206766
RP11-121G20	16	 7	16	06	 44229174	 44385866	 44307520
RP11-39C2	16	 8	16	06	 47011433	 47165877	 47088655
RP11-40P17	16	 9	16	06	 51096440	 51096752	 51096596
RP11-218N24	16	10	16	08	 11733527	 11733927	 11733727
RP11-241I4	16	11	16	08	 10208528	 10365071	 10286799
RP11-262B15	16	12	16	08	  9852835	  9989112	  9920973
RP11-235O5	16	13	16	08	 10512582	 10642582	 10577582
RP11-287P18	16	14	16	08	  7156823	  7328299	  7242561
RP11-92C1	16	15	16	08	 12880229	 13024002	 12952115
RP11-158F9	16	16	16	08	 24892794	 25022794	 24957794
RP11-70L1	16	17	16	08	 25332692	 25478056	 25405374
RP11-199N14	16	18	16	08	 26268358	 26398358	 26333358
RP11-138J2	16	19	16	08	 27277245	 27462612	 27369928
RP11-275K7	16	20	16	08	 28922992	 28923242	 28923117
RP11-277I21	16	21	16	08	 28997156	 28997369	 28997262
RP11-262I23	16	22	16	08	 39846706	 40045213	 39945959
RP11-284J3	16	23	16	08	 40762948	 40763242	 40763095
RP11-282J24	16	24	16	08	 41764757	 41765007	 41764882
RP11-64C22	16	25	16	08	 42469064	 42504177	 42486620
RP11-217N16	16	 1	17	08	 48143884	 48144225	 48144054
RP11-12L15_2	16	 2	17	08	 47924445	 48076131	 48000288
RP11-252M13	16	 3	17	08	 64446868	 64576868	 64511868
RP11-92M10	16	 4	17	08	 65806972	 65968093	 65887532
RP11-212P10	16	 5	17	08	 67505018	 67505512	 67505265
RP11-120N14	16	 6	17	08	 70476167	 70643235	 70559701
RP11-24L2	16	 7	17	08	 53518729	 53665974	 53592351
RP11-225J6	16	 8	17	08	 75821162	 75821465	 75821313
RP11-14A8	16	 9	17	10	 22173943	 22174301	 22174122
RP11-200C22	16	10	17	10	 22658477	 22658879	 22658678
RP11-75N18	16	11	17	10	 24876224	 24876393	 24876308
RP11-29I13	16	12	17	10	 25629404	 25795512	 25712458
RP11-80C16	16	13	17		NA	NA	NA
RP11-15H10	16	14	17	10	 29617393	 29797223	 29707308
RP11-27P22	16	15	17		NA	NA	NA
RP11-133C15	16	16	17	10	 53584261	 53714261	 53649261
RP11-50A5	16	17	17	10	 60458334	 60588334	 60523334
RP11-8E20	16	18	17	10	 64236667	 64237086	 64236876
RP11-14I14	16	19	17	10	 64866984	 64996984	 64931984
RP11-48P18	16	20	17	10	 67324796	 67325187	 67324991
RP11-152N13	16	21	17	10	 74547474	 74697200	 74622337
RP11-282N18	16	22	17	10	 74329218	 74329597	 74329407
RP11-112F5	16	23	17	10	 77226915	 77356915	 77291915
RP11-17O5	16	24	17	10	 78921398	 79059744	 78990571
RP11-21B16	16	25	17	10	 79027041	 79157041	 79092041
RP11-31L4	16	 1	18	10	 80780241	 80947353	 80863797
RP11-80H11	16	 2	18	10	101392986	101533581	101463283
RP11-89G15	16	 3	18	10	103867137	103997137	103932137
RP11-37L21	16	 4	18	10	102716525	102846525	102781525
RP11-105N15	16	 5	18	10	103286013	103438878	103362445
RP11-21N23	16	 6	18	10	103910376	104040376	103975376
RP11-16H23_1	16	 7	18	10	105726308	105868279	105797293
RP11-91O4	16	 8	18	11	 93214215	 93381011	 93297613
RP11-91E22	16	 9	18	11	 87924468	 88085525	 88004996
RP11-164A10	16	10	18	11	123678353	123844655	123761504
RP11-290F24	16	11	18	11	  6061554	  6248175	  6154864
RP11-585L11	16	12	18	11	  7737156	  7906746	  7821951
RP11-614C4	16	13	18	11	 14879390	 15009390	 14944390
RP11-215H22	16	14	18	11	 29826288	 29985929	 29906108
RP11-113M18	16	15	18	11	 29790258	 29956382	 29873320
RP11-632F3	16	16	18	11	  6786642	  6932850	  6859746
RP11-583C8	16	17	18	11	 14901488	 15031488	 14966488
RP11-33H21	16	18	18	11	  9086485	  9086878	  9086681
RP11-5F17	16	19	18	11	 61087210	 61296602	 61191906
RP11-110K11	16	20	18	12	   174175	   329903	   252039
RP11-74M9	16	21	18	12	  4177492	  4307492	  4242492
RP11-59H1_1	16	22	18	12	 12766218	 12961341	 12863779
RP11-174L5	16	23	18	12	 14735668	 14736047	 14735857
RP11-206D16	16	24	18	12	 18416939	 18599946	 18508442
RP11-64J22	16	25	18	12	 25753554	 25883554	 25818554
RP11-74I8	16	 1	19	12	 51016426	 51149115	 51082770
RP11-101H10	16	 2	19	12	 52180087	 52327387	 52253737
RP11-39G24	16	 3	19	12	 57375460	 57533489	 57454474
RP11-276L24	16	 4	19	12	 59175649	 59175955	 59175802
RP11-61P1	16	 5	19	12	 61398509	 61528509	 61463509
RP11-196H14	16	 6	19	12	 62738094	 62928731	 62833412
RP11-89D19	16	 7	19	14	 40596203	 40807716	 40701959
RP11-89B22	16	 8	19	14	 72852260	 72982260	 72917260
RP11-90H21	16	 9	19	14	 91057535	 91211987	 91134761
RP11-91H1	16	10	19	14	 37473305	 37636084	 37554694
RP11-91J13	16	11	19	14	 57486232	 57664119	 57575175
RP11-91C7	16	12	19	14	 90549219	 90692115	 90620667
RP11-94G7	16	13	19		NA	NA	NA
RP11-115G22	16	14	19	15	 30179961	 30339503	 30259732
RP11-194H7	16	15	19	15	 32397742	 32527742	 32462742
RP11-35O8	16	16	19	15	 33909784	 34039784	 33974784
RP11-89O12_1	16	17	19	15	 45626014	 45768850	 45697432
RP11-58N19	16	18	19	15	 43682588	 43812588	 43747588
RP11-49K3	16	19	19	15	 48200957	 48330957	 48265957
RP11-221H24	16	20	19	15	 50881994	 50882419	 50882206
RP11-61K4	16	21	19	15	 53779680	 53968303	 53873991
RP11-30I7	16	22	19	15	 54201403	 54362671	 54282037
RP11-213H12	16	23	19	15	 56460802	 56461183	 56460992
RP11-99L18	16	24	19	15	 57373165	 57523459	 57448312
RP11-54P3	16	25	19	15	 64324122	 64483333	 64403727
RP11-221P9	16	 1	20	15	 66738510	 66738882	 66738696
RP11-28D6	16	 2	20	15	 67461044	 67591044	 67526044
RP11-2I17	16	 3	20	15	 70142500	 70313627	 70228063
RP11-33B6	16	 4	20	15	 70653302	 70783302	 70718302
RP11-10K12	16	 5	20	15	 76331274	 76517779	 76424526
RP11-79A24	16	 6	20	18	 64744976	 64886870	 64815923
RP11-79F3	16	 7	20	18	 19673025	 19826956	 19749990
RP11-80L18	16	 8	20	18	  3919884	  4092260	  4006072
RP11-88B2	16	 9	20	18	 61789719	 61970628	 61880173
RP11-88J12	16	10	20	18	  3667422	  3822165	  3744793
RP11-89M10	16	11	20	18	 37455957	 37620554	 37538255
RP11-90L15	16	12	20	18	 68667333	 68809432	 68738382
RP11-91H13	16	13	20	18	 57105325	 57281638	 57193481
RP11-91H23	16	14	20	02	173608959	173738959	173673959
RP11-91K12	16	15	20	18	 42247743	 42414572	 42331157
RP11-20A13	16	16	20	18	 41645590	 41789206	 41717398
RP11-49M3	16	17	20	19	  2418856	  2548856	  2483856
RP11-46I12	16	18	20	19	 34301924	 34484482	 34393203
RP11-147D7	16	19	20	19	 37482371	 37612371	 37547371
RP11-92J4	16	20	20	19	 41164177	 41294177	 41229177
RP11-283B8	16	21	20	19	 43562945	 43563300	 43563122
RP11-118P21	16	22	20	19	 43750848	 43880848	 43815848
RP11-208I3	16	23	20	19	 47623831	 47753831	 47688831
RP11-510I16	16	24	20	19	 55112145	 55291904	 55202024
CTD-2271H24	16	25	20	19	 50668107	 50670276	 50669191
RP11-79M11	16	 1	21	19	 36958851	 37120074	 37039462
RP11-79A22	16	 2	21	19	 50091034	 50221034	 50156034
RP11-79K6	16	 3	21		NA	NA	NA
RP11-89H20	16	 4	21		NA	NA	NA
RP11-5A19_2	16	 5	21	16	 65622599	 65775720	 65699159
RP11-6J24	16	 6	21	09	  4551070	  4711082	  4631076
RP11-6L13	16	 7	21	04	 75100471	 75286151	 75193311
RP11-7G12	16	 8	21	01	162588511	162753015	162670763
RP11-8C21_2	16	 9	21	09	 88962453	 89168653	 89065553
RP11-8P13	16	10	21	12	 32781790	 32936803	 32859296
RP11-18I14	16	11	21	10	104104381	104271861	104188121
RP11-20J15_2	16	12	21	10	 44024289	 44208763	 44116526
RP11-22O7	16	13	21	13	110117845	110281593	110199719
RP11-23K11	16	14	21	08	 59553434	 59700385	 59626909
RP11-24B10	16	15	21	01	207922099	208088901	208005500
RP11-24C3	16	16	21	03	 48357039	 48512503	 48434771
RP11-38F19	16	17	21	06	 46284897	 46413358	 46349127
RP11-44K16_2	16	18	21	14	 63974853	 64135779	 64055316
RP11-45I12	16	19	21	04	141648097	141794758	141721427
RP11-46C6	16	20	21	19	 48622384	 48834854	 48728619
RP11-47K11	16	21	21	01	 91591649	 91721649	 91656649
RP11-50I11	16	22	21	19	 54367955	 54539337	 54453646
RP11-63G10	16	23	21	01	 58891110	 59033774	 58962442
RP11-64J19	16	24	21	17	 21014521	 21191548	 21103034
RP11-65B23_2	16	25	21	09	 87484294	 87654534	 87569414
RP11-66B24	16	 1	22	15	 99149458	 99322865	 99236161
RP11-67A5	16	 2	22	19	 44449021	 44620150	 44534585
RP11-67L14	16	 3	22	02	113258398	113412612	113335505
RP11-361D15	16	 4	22	15	 57657461	 57844886	 57751173
RP11-361P13	16	 5	22	17	 59355639	 59584565	 59470102
RP11-364G22	16	 6	22	11	  5753679	  5927293	  5840486
RP11-365P13	16	 7	22	13	110332569	110487595	110410082
RP11-367E12	16	 8	22	08	 74911244	 75077232	 74994238
RP11-369K5	16	 9	22	17	 19626362	 19800213	 19713287
RP11-386D17	16	10	22	03	185459319	185590700	185525009
RP11-386J22	16	11	22	09	 70078699	 70261126	 70169912
RP11-387M24	16	12	22	06	 43123645	 43253529	 43188587
RP11-388N6	16	13	22	09	109258361	109266964	109262662
RP11-390K5	16	14	22	11	 47087656	 47277673	 47182664
RP11-393M11	16	15	22	04	 57104471	 57244315	 57174393
RP11-403E9	16	16	22	17	 25520106	 25693302	 25606704
RP11-405A15	16	17	22	15	 89134534	 89260211	 89197372
RP11-409K20	16	18	22	09	129640780	129810743	129725761
RP11-413M20	16	19	22	02	 27484705	 27680585	 27582645
RP11-415J8	16	20	22	01	 33336864	 33525529	 33431196
RP11-416N2	16	21	22	10	105276012	105479274	105377643
RP11-431O22	16	22	22	13	 52183617	 52356911	 52270264
RP11-432M24	16	23	22	13	 49029946	 49218245	 49124095
RP11-433M14	16	24	22	17	  1335633	  1530629	  1433131
RP11-434I13	16	25	22	02	113093410	113277267	113185338
RP11-437K17	16	 1	23		NA	NA	NA
RP11-438O12	16	 2	23	02	120629081	120846427	120737754
RP11-143F1	16	 3	23	03	196361140	196559424	196460282
RP11-30B7	16	 4	23		NA	NA	NA
RP11-90P13	16	 5	23	07	   119395	   298664	   209029
RP11-86A14	16	 6	23	08	   980565	  1165777	  1073171
RP11-1111J1	16	 7	23	09	  3586471	  3722488	  3654479
RP11-413F20	16	 8	23	10	135149730	135315306	135232518
RP11-433E24	16	 9	23	21	 46717197	 46912065	 46814631
RP11-155F12	16	10	23	X	  2449592	  2605375	  2527483
RP11-414C23_2	16	11	23	Y	  2828833	  3000873	  2914853
RP11-1083I7	16	12	23	07	 45652590	 45849537	 45751063
RP11-1081A4	16	13	23	15	 23128667	 23300013	 23214340
RP11-77H4	16	14	23	X	100670327	100841153	100755740
RP11-1072J2	16	15	23	16	  3715334	  3908518	  3811926
RP11-876L22	16	16	23	17	 26575764	 26764746	 26670255
RP11-1007K14	16	17	23	07	 18806956	 18989926	 18898441
RP11-299P16	16	18	23	11	 32183840	 32376415	 32280127
RP11-930D21	16	19	23	X	  9404667	  9620933	  9512800
RP11-26B12	16	20	23	Y	 25241482	 25397173	 25319327
RP11-12N7_2	16	21	23	02	175850411	176023129	175936770
RP11-14I17	16	22	23	08	 26206456	 26412170	 26309313
RP11-16G1	16	23	23	07	 32349237	 32518501	 32433869
RP11-18A3	16	24	23	09	109125382	109260361	109192871
RP11-19B4	16	25	23	04	 75144803	 75305544	 75225173
RP11-21M18	16	 1	24	02	150982104	151157148	151069626
RP11-434B12	16	 2	24	02	  8639083	  8821990	  8730536
RP11-437B10	16	 3	24	15	 91203427	 91385746	 91294586
RP11-442O1	16	 4	24	16	 83549706	 83749375	 83649540
RP11-444B4	16	 5	24	02	 66674462	 66867765	 66771113
RP11-447E20	16	 6	24	04	 74797879	 75012988	 74905433
RP11-453E3	16	 7	24	01	204309333	204491819	204400576
RP11-472L10	16	 8	24	11	 63363052	 63569828	 63466440
RP11-475E11	16	 9	24	01	109045790	109228343	109137066
RP11-478C1	16	10	24	04	  2124125	  2318965	  2221545
RP11-478H11	16	11	24	X	 15198394	 15392886	 15295640
RP11-485O10	16	12	24	15	 46837057	 47011197	 46924127
RP11-491D2	16	13	24	02	242138071	242221648	242179859
RP11-507E2	16	14	24	05	150300398	150506311	150403354
RP11-513D5	16	15	24	08	 38183042	 38358846	 38270944
RP11-518J6	16	16	24	16	 69781966	 69959285	 69870625
RP11-520B23_2	16	17	24	16	 11716267	 11875890	 11796078
RP11-520M5	16	18	24	04	  2954854	  3111973	  3033413
RP11-525G13	16	19	24	01	162534185	162634051	162584118
RP11-544A12	16	20	24	09	130994804	131191826	131093315
RP11-552O4	16	21	24	18	 22533011	 22703135	 22618073
RP11-560I21	16	22	24	06	132704221	132831924	132768072
RP11-562L3	16	23	24	08	 59380408	 59485155	 59432781
RP11-564G9	16	24	24	05	176797648	176987699	176892673
RP11-565O12	16	25	24	15	 82906978	 83102315	 83004646
RP11-944L7	16	 1	25	03	 44459797	 44676832	 44568314
RP11-981P6	16	 2	25	12	 88485308	 88591834	 88538571
RP11-1079K10	16	 3	25	17	 44725271	 44908965	 44817118
RP11-1099M24	16	 4	25	17	  7680806	  7868524	  7774665
RP11-1283H4	16	 5	25	02	 86972667	 87159419	 87066043
-------------- next part --------------
#bin	chrom	chromStart	chromEnd	  name	     score strand	thickStart	thickEnd	type
593	chr1	1142406	1142501     hsa-mir-200b	960	+	1142459	1142483	miRna
593	chr1	1143165	1143255     hsa-mir-200a	960	+	1143180	1143202	miRna
593	chr1	1144307	1144390     hsa-mir-429	      960	+	1144357	1144379	miRna
654	chr1	9145992	9146102     hsa-mir-34a	      480	-	9146059	9146081	miRna
896	chr1	40889134	40889198    hsa-mir-30e	      960	+	40889135	40889155	miRna
896	chr1	40892048	40892137    hsa-mir-30c-1     960	+	40892064	40892087	miRna
1082	chr1	65236137	65236212    hsa-mir-101-1     480	-	65236144	65236166	miRna
1128	chr1	71245334	71245420    hsa-mir-186	      480	-	71245383	71245406	miRna
1334	chr1	98223646	98223748    hsa-mir-137	      480	-	98223667	98223689	miRna
1423	chr1	109853556	109853631   hsa-mir-197	      960	+	109853603	109853625	miRna
1753	chr1	153203205	153203294   hsa-mir-9-1	      480	-	153203256	153203279	miRna
1873	chr1	168839594	168839704   hsa-mir-214	      480	-	168839613	168839634	miRna
1873	chr1	168845331	168845441   hsa-mir-199a-2    480	-	168845388	168845411	miRna
1873	chr1	168845331	168845441   hsa-mir-199a-2    480	-	168845351	168845373	miRna
1910	chr1	173730155	173730238   hsa-mir-488	      480	-	173730204	173730225	miRna
2077	chr1	195559658	195559768   hsa-mir-181b-1    480	-	195559709	195559733	miRna
2077	chr1	195559829	195559939   hsa-mir-213	      480	-	195559893	195559916	miRna
2127	chr1	202149086	202149183   hsa-mir-135b	480	-	202149146	202149168	miRna
2144	chr1	204363591	204363679   hsa-mir-29c	      480	-	204363604	204363626	miRna
2144	chr1	204364182	204364263   hsa-mir-29b-2     480	-	204364192	204364212	miRna
2156	chr1	205993872	205993982   hsa-mir-205	      960	+	205993905	205993927	miRna
2238	chr1	216679589	216679699   hsa-mir-215	      480	-	216679652	216679673	miRna
2238	chr1	216679893	216679978   hsa-mir-194-1     480	-	216679942	216679964	miRna
1013	chr2	56121752	56121862    hsa-mir-217	      480	-	56121804	56121828	miRna
1013	chr2	56127735	56127845    hsa-mir-216	      480	-	56127806	56127827	miRna
1624	chr2	136256698	136256780   hsa-mir-128a      960	+	136256747	136256769	miRna
1934	chr2	176840537	176840647   hsa-mir-10b	      960	+	176840563	176840585	miRna
2256	chr2	219092873	219092950   hsa-mir-26b	      960	+	219092884	219092905	miRna
2261	chr2	219691871	219691935   hsa-mir-375	      480	-	219691874	219691896	miRna
2263	chr2	219984337	219984427   hsa-mir-153-1	480	-	219984354	219984374	miRna
2424	chr2	241115407	241115496	hsa-mir-149	      960	+	241115421	241115443	miRna
857	chr3	35760971	35761055	hsa-mir-128b	960	+	35761022	35761044	miRna
874	chr3	37985898	37985975	hsa-mir-26a-1	960	+	37985907	37985929	miRna
921	chr3	44130707	44130806	hsa-mir-138-1	960	+	44130729	44130746	miRna
959	chr3	49032584	49032671	hsa-mir-425	      480	-	49032596	49032617	miRna
959	chr3	49033054	49033146	hsa-mir-191	      480	-	49033067	49033089	miRna
983	chr3	52277333	52277417	hsa-let-7g	      480	-	52277392	52277413	miRna
984	chr3	52303274	52303364	hsa-mir-135a-1	480	-	52303325	52303348	miRna
1512	chr3	121597204	121597266	hsa-mir-198	      480	-	121597242	121597261	miRna
1817	chr3	161605077	161605175	hsa-mir-15b	      960	+	161605096	161605118	miRna
1817	chr3	161605234	161605315	hsa-mir-16-2	960	+	161605243	161605265	miRna
2033	chr3	189889270	189889356	hsa-mir-28	      960	+	189889283	189889305	miRna
646	chr4	8125098	8125179	hsa-mir-95	      480	-	8125109	8125131	miRna
739	chr4	20206166	20206276	hsa-mir-218-1	960	+	20206190	20206211	miRna
1454	chr4	113926633	113926701	hsa-mir-367	      480	-	113926636	113926658	miRna
1454	chr4	113926763	113926831	hsa-mir-302d	480	-	113926765	113926788	miRna
1454	chr4	113926942	113927011	hsa-mir-302a	480	-	113926981	113927003	miRna
1454	chr4	113927122	113927190	hsa-mir-302c	480	-	113927125	113927148	miRna
1454	chr4	113927244	113927317	hsa-mir-302b	480	-	113927248	113927271	miRna
1000	chr5	54502116	54502207	hsa-mir-449	      480	-	54502170	54502192	miRna
1256	chr5	87998426	87998513	hsa-mir-9-2	      480	-	87998439	87998460	miRna
1720	chr5	148788673	148788779	hsa-mir-143	      960	+	148788733	148788755	miRna
1720	chr5	148790401	148790489	hsa-mir-145	      960	+	148790416	148790440	miRna
1722	chr5	149092580	149092646	hsa-mir-378	      960	+	149092584	149092606	miRna
1804	chr5	159844936	159845035	hsa-mir-146a	960	+	159844956	159844978	miRna
1866	chr5	167920478	167920556	hsa-mir-103-1	480	-	167920486	167920509	miRna
1867	chr5	168127728	168127838	hsa-mir-218-2	480	-	168127793	168127814	miRna
1953	chr5	179374908	179375003	hsa-mir-340	      480	-	179374923	179374946	miRna
838	chr6	33283589	33283699	hsa-mir-219-1	960	+	33283609	33283630	miRna
982	chr6	52117105	52117191	hsa-mir-206	      960	+	52117157	52117179	miRna
982	chr6	52121679	52121798	hsa-mir-133b	960	+	52121745	52121766	miRna
1135	chr6	72143383	72143455	hsa-mir-30c-2	480	-	72143426	72143449	miRna
1135	chr6	72169974	72170045	hsa-mir-30a	      480	-	72170017	72170040	miRna
591	chr7	835809	835903	hsa-mir-339	      480	-	835868	835889	miRna
781	chr7	25762778	25762846	hsa-mir-148a	480	-	25762781	25762803	miRna
790	chr7	26982338	26982422	hsa-mir-196b	480	-	26982387	26982408	miRna
1292	chr7	92757898	92757982	hsa-mir-489	      480	-	92757909	92757932	miRna
1342	chr7	99335833	99335917	hsa-mir-25	      480	-	99335844	99335866	miRna
1342	chr7	99336041	99336121	hsa-mir-93	      480	-	99336088	99336110	miRna
1342	chr7	99336266	99336348	hsa-mir-106b	480	-	99336316	99336337	miRna
1557	chr7	127441875	127441947	hsa-mir-129-1	960	+	127441879	127441900	miRna
1569	chr7	129004173	129004283	hsa-mir-182	      480	-	129004196	129004217	miRna
1569	chr7	129008482	129008560	hsa-mir-96	      480	-	129008530	129008552	miRna
1569	chr7	129008695	129008805	hsa-mir-183	      480	-	129008756	129008779	miRna
1574	chr7	129729902	129729996	hsa-mir-335	      960	+	129729917	129729940	miRna
1576	chr7	130018760	130018824	hsa-mir-29a	      480	-	130018762	130018784	miRna
1576	chr7	130019472	130019553	hsa-mir-29b-1	480	-	130019483	130019503	miRna
1622	chr7	136045168	136045296	hsa-mir-490	      960	+	136045243	136045265	miRna
1781	chr7	156866503	156866590	hsa-mir-153-2	480	-	156866518	156866538	miRna
659	chr8	9798307	9798392	hsa-mir-124a-1	480	-	9798319	9798341	miRna
697	chr8	14755317	14755390	hsa-mir-383	      480	-	14755362	14755384	miRna
754	chr8	22158419	22158501	hsa-mir-320	      480	-	22158431	22158454	miRna
1084	chr8	65454259	65454368	hsa-mir-124a-2	960	+	65454319	65454341	miRna
1621	chr8	135881944	135882032	hsa-mir-30b	      480	-	135881995	135882016	miRna
1621	chr8	135886300	135886370	hsa-mir-30d	      480	-	135886343	135886365	miRna
1666	chr8	141811844	141811934	hsa-mir-151	      480	-	141811867	141811889	miRna
621	chr9	4840296	4840375	hsa-mir-101-2	960	+	4840344	4840366	miRna
742	chr9	20706103	20706187	hsa-mir-491	      960	+	20706118	20706141	miRna
749	chr9	21502113	21502184	hsa-mir-31	      480	-	21502155	21502175	miRna
1124	chr9	70654444	70654554	hsa-mir-204	      480	-	70654500	70654522	miRna
1224	chr9	83814216	83814326	hsa-mir-7-1	      480	-	83814282	83814303	miRna
1302	chr9	94017793	94017873	hsa-let-7a-1	960	+	94017798	94017820	miRna
1302	chr9	94018183	94018270	hsa-let-7f-1	960	+	94018189	94018211	miRna
1302	chr9	94020670	94020757	hsa-let-7d	      960	+	94020677	94020698	miRna
1309	chr9	94927044	94927141	hsa-mir-23b	      960	+	94927101	94927124	miRna
1309	chr9	94927281	94927378	hsa-mir-27b	      960	+	94927341	94927361	miRna
1309	chr9	94927857	94927925	hsa-mir-24-1	960	+	94927862	94927885	miRna
1415	chr9	108888063	108888133	hsa-mir-32	      480	-	108888107	108888128	miRna
1501	chr9	120086810	120086882	hsa-mir-147	      480	-	120086816	120086836	miRna
1535	chr9	124534274	124534384	hsa-mir-181a	960	+	124534312	124534335	miRna
1535	chr9	124535542	124535631	hsa-mir-181b-2	960	+	124535557	124535581	miRna
1562	chr9	128086553	128086663	hsa-mir-199b	480	-	128086578	128086600	miRna
1563	chr9	128234450	128234547	hsa-mir-219-2	480	-	128234508	128234529	miRna
1629	chr9	136840890	136840975	hsa-mir-126	      960	+	136840941	136840962	miRna
1629	chr9	136840890	136840975	hsa-mir-126	      960	+	136840904	136840925	miRna
721	chr10	17927112	17927199	hsa-mir-511-1	960	+	17927127	17927148	miRna
723	chr10	18174041	18174128	hsa-mir-511-2	960	+	18174056	18174077	miRna
1256	chr10	88014423	88014509	hsa-mir-346	      480	-	88014483	88014506	miRna
1281	chr10	91342483	91342564	hsa-mir-107	      480	-	91342492	91342515	miRna
1379	chr10	104186258	104186331	hsa-mir-146b	960	+	104186266	104186288	miRna
1614	chr10	134949896	134950006	hsa-mir-202	      480	-	134949921	134949943	miRna
589	chr11	558088	558198	hsa-mir-210	      480	-	558112	558133	miRna
917	chr11	43559519	43559609	hsa-mir-129-2	960	+	43559533	43559554	miRna
1021	chr11	57165246	57165335	hsa-mir-130a	960	+	57165300	57165320	miRna
1076	chr11	64415184	64415294	hsa-mir-192	      480	-	64415250	64415271	miRna
1076	chr11	64415402	64415487	hsa-mir-194-2	480	-	64415451	64415473	miRna
1134	chr11	72003754	72003822	hsa-mir-139	      480	-	72003798	72003816	miRna
1155	chr11	74723783	74723878	hsa-mir-326	      480	-	74723799	74723819	miRna
1431	chr11	110888872	110888956	hsa-mir-34b	      960	+	110888885	110888907	miRna
1431	chr11	110889373	110889450	hsa-mir-34c	      960	+	110889385	110889407	miRna
1511	chr11	121475674	121475762	hsa-mir-125b-1	480	-	121475726	121475748	miRna
1512	chr11	121522439	121522511	hsa-let-7a-2	480	-	121522485	121522507	miRna
1512	chr11	121528146	121528226	hsa-mir-100	      480	-	121528192	121528214	miRna
637	chr12	6943122	6943190	hsa-mir-200c	960	+	6943166	6943188	miRna
637	chr12	6943520	6943615	hsa-mir-141	      960	+	6943579	6943600	miRna
986	chr12	52671788	52671898	hsa-mir-196a-2	960	+	52671812	52671833	miRna
989	chr12	53017266	53017365	hsa-mir-148b	960	+	53017328	53017350	miRna
1016	chr12	56504658	56504742	hsa-mir-26a-2	480	-	56504707	56504729	miRna
1052	chr12	61283732	61283816	hsa-let-7i	      960	+	61283737	61283756	miRna
1300	chr12	93730641	93730757	hsa-mir-492	      960	+	93730670	93730693	miRna
1303	chr12	94204663	94204757	hsa-mir-331	      960	+	94204723	94204744	miRna
1320	chr12	96460057	96460157	hsa-mir-135a-2	960	+	96460079	96460102	miRna
962	chr13	49521109	49521198	hsa-mir-16-1	480	-	49521163	49521185	miRna
962	chr13	49521255	49521338	hsa-mir-15a	      480	-	49521303	49521325	miRna
1277	chr13	90800859	90800943	hsa-mir-17	      960	+	90800909	90800929	miRna
1277	chr13	90800859	90800943	hsa-mir-17	      960	+	90800872	90800896	miRna
1277	chr13	90801005	90801076	hsa-mir-18a	      960	+	90801010	90801032	miRna
1277	chr13	90801145	90801227	hsa-mir-19a	      960	+	90801193	90801216	miRna
1277	chr13	90801319	90801390	hsa-mir-20a	      960	+	90801326	90801348	miRna
1277	chr13	90801446	90801533	hsa-mir-19b-1	960	+	90801499	90801522	miRna
1277	chr13	90801568	90801646	hsa-mir-92-1	960	+	90801615	90801637	miRna
759	chr14	22927644	22927715	hsa-mir-208	      480	-	22927650	22927672	miRna
1345	chr14	99645744	99645843	hsa-mir-342	      960	+	99645804	99645828	miRna
1346	chr14	99843948	99844046	hsa-mir-345	      960	+	99843964	99843985	miRna
1351	chr14	100405149	100405238	hsa-mir-493	      960	+	100405164	100405186	miRna
1351	chr14	100410582	100410675	hsa-mir-337	      960	+	100410637	100410660	miRna
1351	chr14	100417096	100417210	hsa-mir-431	      960	+	100417115	100417136	miRna
1351	chr14	100417975	100418068	hsa-mir-433	      960	+	100418038	100418060	miRna
1351	chr14	100419068	100419165	hsa-mir-127	      960	+	100419124	100419146	miRna
1351	chr14	100420572	100420666	hsa-mir-432	      960	+	100420585	100420608	miRna
1351	chr14	100420791	100420873	hsa-mir-136	      960	+	100420805	100420828	miRna
1351	chr14	100447228	100447303	hsa-mir-370	      960	+	100447275	100447298	miRna
1352	chr14	100558155	100558222	hsa-mir-379	      960	+	100558160	100558177	miRna
1352	chr14	100559883	100559946	hsa-mir-299	      960	+	100559889	100559911	miRna
1352	chr14	100561106	100561167	hsa-mir-380	      960	+	100561110	100561132	miRna
1352	chr14	100561821	100561907	hsa-mir-323	      960	+	100561870	100561892	miRna
1352	chr14	100562874	100562954	hsa-mir-329-1	960	+	100562923	100562945	miRna
1352	chr14	100563189	100563273	hsa-mir-329-2	960	+	100563240	100563262	miRna
1352	chr14	100565723	100565804	hsa-mir-494	      960	+	100565770	100565794	miRna
1352	chr14	100569844	100569926	hsa-mir-495	      960	+	100569893	100569916	miRna
1352	chr14	100575779	100575845	hsa-mir-368	      960	+	100575822	100575844	miRna
1352	chr14	100576525	100576625	hsa-mir-376b	960	+	100576586	100576608	miRna
1352	chr14	100576871	100576939	hsa-mir-376a	960	+	100576914	100576935	miRna
1352	chr14	100582009	100582084	hsa-mir-381	      960	+	100582057	100582079	miRna
1352	chr14	100590395	100590471	hsa-mir-382	      960	+	100590405	100590427	miRna
1352	chr14	100590776	100590849	hsa-mir-134	      960	+	100590783	100590804	miRna
1352	chr14	100591508	100591581	hsa-mir-485	      960	+	100591516	100591538	miRna
1352	chr14	100592279	100592359	hsa-mir-453	      960	+	100592321	100592343	miRna
1352	chr14	100595844	100595928	hsa-mir-154	      960	+	100595858	100595880	miRna
1352	chr14	100596662	100596764	hsa-mir-496	      960	+	100596722	100596739	miRna
1352	chr14	100598139	100598208	hsa-mir-377	      960	+	100598183	100598205	miRna
1352	chr14	100601389	100601468	hsa-mir-409	      960	+	100601403	100601425	miRna
1352	chr14	100601536	100601627	hsa-mir-412	      960	+	100601589	100601612	miRna
1352	chr14	100601687	100601757	hsa-mir-369	      960	+	100601695	100601717	miRna
1352	chr14	100602001	100602081	hsa-mir-410	      960	+	100602050	100602072	miRna
1375	chr14	103653494	103653604	hsa-mir-203	      960	+	103653558	103653580	miRna
807	chr15	29144526	29144636	hsa-mir-211	      480	-	29144589	29144611	miRna
1049	chr15	60903208	60903293	hsa-mir-190	      960	+	60903222	60903244	miRna
1057	chr15	61950181	61950271	hsa-mir-422a	480	-	61950239	61950261	miRna
1174	chr15	77289184	77289268	hsa-mir-184	      960	+	77289236	77289258	miRna
1248	chr15	86956059	86956169	hsa-mir-7-2	      960	+	86956090	86956111	miRna
1254	chr15	87712251	87712341	hsa-mir-9-3	      960	+	87712266	87712289	miRna
694	chr16	14305324	14305407	hsa-mir-193b	960	+	14305374	14305398	miRna
694	chr16	14310642	14310729	hsa-mir-365-1	960	+	14310697	14310719	miRna
1008	chr16	55449930	55450014	hsa-mir-138-2	960	+	55449939	55449956	miRna
1086	chr16	65793724	65793799	hsa-mir-328	      480	-	65793730	65793752	miRna
1107	chr16	68524484	68524584	hsa-mir-140	      960	+	68524507	68524528	miRna
596	chr17	1563946	1564031	hsa-mir-22	      480	-	1563957	1563979	miRna
599	chr17	1899951	1900052	hsa-mir-132	      480	-	1899972	1899994	miRna
599	chr17	1900314	1900424	hsa-mir-212	      480	-	1900333	1900354	miRna
637	chr17	6861657	6861744	hsa-mir-195	      480	-	6861709	6861730	miRna
637	chr17	6861953	6862065	hsa-mir-497	      480	-	6862021	6862042	miRna
638	chr17	7067339	7067422	hsa-mir-324	      480	-	7067350	7067372	miRna
769	chr17	24212512	24212584	hsa-mir-451	      480	-	24212545	24212568	miRna
769	chr17	24212676	24212762	hsa-mir-144	      480	-	24212689	24212711	miRna
779	chr17	25468222	25468316	hsa-mir-423	      960	+	25468274	25468296	miRna
790	chr17	26911127	26911215	hsa-mir-193a	960	+	26911181	26911202	miRna
790	chr17	26926542	26926653	hsa-mir-365-2	960	+	26926609	26926631	miRna
916	chr17	43469525	43469612	hsa-mir-152	      480	-	43469538	43469559	miRna
920	chr17	44012198	44012308	hsa-mir-10a	      480	-	44012264	44012287	miRna
921	chr17	44064850	44064920	hsa-mir-196a-1	480	-	44064893	44064914	miRna
995	chr17	53763591	53763678	hsa-mir-142	      480	-	53763604	53763627	miRna
1001	chr17	54583278	54583364	hsa-mir-301	      480	-	54583291	54583314	miRna
1006	chr17	55273408	55273480	hsa-mir-21	      960	+	55273415	55273437	miRna
1170	chr17	76714277	76714344	hsa-mir-338	      480	-	76714280	76714303	miRna
719	chr18	17659656	17659744	hsa-mir-133a-1	480	-	17659669	17659691	miRna
719	chr18	17662962	17663047	hsa-mir-1-2	      480	-	17662974	17662995	miRna
827	chr18	31738778	31738887	hsa-mir-187	      480	-	31738796	31738817	miRna
999	chr18	54269285	54269370	hsa-mir-122a	960	+	54269299	54269322	miRna
621	chr19	4721681	4721791	hsa-mir-7-3	      960	+	4721711	4721732	miRna
667	chr19	10789101	10789172	hsa-mir-199a-1	480	-	10789105	10789127	miRna
690	chr19	13808100	13808173	hsa-mir-24-2	480	-	13808102	13808124	miRna
690	chr19	13808253	13808331	hsa-mir-27a	      480	-	13808259	13808281	miRna
690	chr19	13808400	13808473	hsa-mir-23a	      480	-	13808408	13808429	miRna
690	chr19	13846512	13846622	hsa-mir-181c	960	+	13846538	13846560	miRna
690	chr19	13846688	13846825	hsa-mir-181d	960	+	13846723	13846747	miRna
972	chr19	50834091	50834185	hsa-mir-330	      480	-	50834106	50834129	miRna
1002	chr19	54695853	54695937	hsa-mir-150	      480	-	54695900	54695922	miRna
1019	chr19	56887676	56887746	hsa-mir-99b	      960	+	56887682	56887704	miRna
1019	chr19	56887850	56887929	hsa-let-7e	      960	+	56887857	56887878	miRna
1019	chr19	56888318	56888404	hsa-mir-125a	960	+	56888332	56888355	miRna
1034	chr19	58861744	58861828	hsa-mir-512-1	960	+	58861757	58861780	miRna
1034	chr19	58864222	58864320	hsa-mir-512-2	960	+	58864241	58864264	miRna
1034	chr19	58869262	58869386	hsa-mir-498	      960	+	58869295	58869318	miRna
1034	chr19	58870776	58870863	hsa-mir-520e	960	+	58870829	58870850	miRna
1034	chr19	58874068	58874151	hsa-mir-515-1	960	+	58874081	58874105	miRna
1034	chr19	58875005	58875089	hsa-mir-519e	960	+	58875018	58875040	miRna
1034	chr19	58877224	58877311	hsa-mir-520f	960	+	58877278	58877300	miRna
1034	chr19	58880074	58880157	hsa-mir-515-2	960	+	58880087	58880111	miRna
1034	chr19	58881534	58881621	hsa-mir-519c	960	+	58881549	58881573	miRna
1034	chr19	58885946	58886031	hsa-mir-520a	960	+	58885960	58885981	miRna
1034	chr19	58889458	58889541	hsa-mir-526b	960	+	58889471	58889495	miRna
1034	chr19	58890278	58890359	hsa-mir-519b	960	+	58890290	58890314	miRna
1034	chr19	58892598	58892683	hsa-mir-525	      960	+	58892612	58892633	miRna
1034	chr19	58893450	58893537	hsa-mir-523	      960	+	58893465	58893489	miRna
1034	chr19	58895080	58895167	hsa-mir-518f	960	+	58895095	58895118	miRna
1034	chr19	58896292	58896353	hsa-mir-520b	960	+	58896332	58896353	miRna
1034	chr19	58897802	58897885	hsa-mir-518b	960	+	58897852	58897874	miRna
1034	chr19	58901317	58901402	hsa-mir-526a-1	960	+	58901331	58901352	miRna
1034	chr19	58902518	58902605	hsa-mir-520c	960	+	58902533	58902554	miRna
1034	chr19	58903800	58903901	hsa-mir-518c	960	+	58903823	58903846	miRna
1034	chr19	58906067	58906154	hsa-mir-524	      960	+	58906082	58906104	miRna
1034	chr19	58907333	58907420	hsa-mir-517a	960	+	58907347	58907369	miRna
1034	chr19	58908412	58908500	hsa-mir-519d	960	+	58908465	58908488	miRna
1034	chr19	58911659	58911746	hsa-mir-521-2	960	+	58911712	58911734	miRna
1034	chr19	58915161	58915248	hsa-mir-520d	960	+	58915175	58915198	miRna
1034	chr19	58916141	58916208	hsa-mir-517b	960	+	58916146	58916168	miRna
1034	chr19	58917231	58917321	hsa-mir-520g	960	+	58917285	58917309	miRna
1034	chr19	58920507	58920592	hsa-mir-516-3	960	+	58920522	58920544	miRna
1034	chr19	58921987	58922052	hsa-mir-526a-2	960	+	58921993	58922014	miRna
1034	chr19	58924903	58924991	hsa-mir-518e	960	+	58924918	58924942	miRna
1034	chr19	58926071	58926156	hsa-mir-518a-1	960	+	58926084	58926105	miRna
1034	chr19	58929942	58930029	hsa-mir-518d	960	+	58929957	58929978	miRna
1034	chr19	58931910	58932000	hsa-mir-516-4	960	+	58931925	58931947	miRna
1034	chr19	58934398	58934485	hsa-mir-518a-2	960	+	58934412	58934432	miRna
1034	chr19	58936378	58936473	hsa-mir-517c	960	+	58936397	58936419	miRna
1034	chr19	58937577	58937665	hsa-mir-520h	960	+	58937631	58937653	miRna
1034	chr19	58943701	58943788	hsa-mir-521-1	960	+	58943754	58943776	miRna
1034	chr19	58946276	58946363	hsa-mir-522	      960	+	58946291	58946315	miRna
1034	chr19	58947462	58947547	hsa-mir-519a-1	960	+	58947476	58947500	miRna
1034	chr19	58949083	58949168	hsa-mir-527	      960	+	58949096	58949117	miRna
1034	chr19	58951806	58951896	hsa-mir-516-1	960	+	58951866	58951884	miRna
1034	chr19	58956198	58956288	hsa-mir-516-2	960	+	58956258	58956276	miRna
1034	chr19	58957409	58957496	hsa-mir-519a-2	960	+	58957462	58957487	miRna
1035	chr19	58982740	58982807	hsa-mir-371	      960	+	58982783	58982804	miRna
1035	chr19	58982955	58983022	hsa-mir-372	      960	+	58982996	58983019	miRna
1035	chr19	58983770	58983839	hsa-mir-373	      960	+	58983775	58983797	miRna
614	chr20	3846140	3846218	hsa-mir-103-2	960	+	3846187	3846210	miRna
837	chr20	33041839	33041961	hsa-mir-499	      960	+	33041871	33041894	miRna
1018	chr20	56826064	56826144	hsa-mir-296	      480	-	56826110	56826131	miRna
1047	chr20	60561957	60562028	hsa-mir-1-1	      960	+	60562002	60562023	miRna
1047	chr20	60572563	60572665	hsa-mir-133a-2	960	+	60572622	60572644	miRna
1052	chr20	61280296	61280383	hsa-mir-124a-3	960	+	61280347	61280369	miRna
713	chr21	16833279	16833360	hsa-mir-99a	      960	+	16833291	16833313	miRna
713	chr21	16834018	16834102	hsa-let-7c	      960	+	16834028	16834050	miRna
713	chr21	16884427	16884516	hsa-mir-125b-2	960	+	16884443	16884465	miRna
782	chr21	25868162	25868227	hsa-mir-155	      960	+	25868165	25868187	miRna
725	chr22	18395215	18395297	hsa-mir-185	      960	+	18395229	18395247	miRna
740	chr22	20332146	20332228	hsa-mir-130b	960	+	20332196	20332218	miRna
894	chr22	40621447	40621516	hsa-mir-33	      960	+	40621452	40621471	miRna
927	chr22	44829147	44829221	hsa-let-7a-3	960	+	44829150	44829172	miRna
927	chr22	44830084	44830167	hsa-let-7b	      960	+	44830089	44830111	miRna
931	chrX	45361838	45361948	hsa-mir-221	      480	-	45361861	45361884	miRna
931	chrX	45362674	45362784	hsa-mir-222	      480	-	45362692	45362716	miRna
962	chrX	49471144	49471230	hsa-mir-188	      960	+	49471158	49471180	miRna
962	chrX	49476074	49476158	hsa-mir-500	      960	+	49476125	49476147	miRna
962	chrX	49476607	49476672	hsa-mir-362	      960	+	49476611	49476634	miRna
962	chrX	49477365	49477449	hsa-mir-501	      960	+	49477378	49477400	miRna
962	chrX	49482256	49482311	hsa-mir-502	      960	+	49482256	49482277	miRna
992	chrX	53466223	53466303	hsa-mir-98	      480	-	53466280	53466302	miRna
992	chrX	53467173	53467256	hsa-let-7f-2	480	-	53467227	53467249	miRna
1081	chrX	65021732	65021842	hsa-mir-223	      960	+	65021799	65021820	miRna
1144	chrX	73290141	73290213	hsa-mir-374	      480	-	73290180	73290202	miRna
1164	chrX	75922387	75922475	hsa-mir-384	      480	-	75922399	75922419	miRna
1164	chrX	76008515	76008613	hsa-mir-325	      480	-	76008577	76008598	miRna
1233	chrX	84964785	84964857	hsa-mir-361	      480	-	84964830	84964852	miRna
1453	chrX	113880996	113881107	hsa-mir-448	      960	+	113881066	113881088	miRna
1519	chrX	122421480	122421590	hsa-mir-220	      480	-	122421547	122421568	miRna
1599	chrX	133028927	133029002	hsa-mir-363	      480	-	133028930	133028952	miRna
1599	chrX	133029087	133029162	hsa-mir-92-2	480	-	133029093	133029115	miRna
1599	chrX	133029220	133029316	hsa-mir-19b-2	480	-	133029232	133029255	miRna
1599	chrX	133029358	133029427	hsa-mir-20b	      480	-	133029399	133029422	miRna
1599	chrX	133029590	133029661	hsa-mir-18b	      480	-	133029634	133029656	miRna
1599	chrX	133029747	133029828	hsa-mir-106a	480	-	133029792	133029816	miRna
1602	chrX	133399890	133399981	hsa-mir-450-1	480	-	133399943	133399965	miRna
1602	chrX	133400057	133400157	hsa-mir-450-2	480	-	133400115	133400135	miRna
1602	chrX	133405877	133405948	hsa-mir-503	      480	-	133405920	133405943	miRna
1602	chrX	133406163	133406261	hsa-mir-424	      480	-	133406229	133406251	miRna
1633	chrX	137475391	137475474	hsa-mir-504	      480	-	137475441	137475462	miRna
1643	chrX	138731826	138731910	hsa-mir-505	      480	-	138731837	138731859	miRna
1698	chrX	146000526	146000655	hsa-mir-513-1	480	-	146000597	146000619	miRna
1698	chrX	146012889	146013016	hsa-mir-513-2	480	-	146012959	146012981	miRna
1699	chrX	146017783	146017907	hsa-mir-506	      480	-	146017816	146017837	miRna
1699	chrX	146018047	146018141	hsa-mir-507	      480	-	146018065	146018086	miRna
1699	chrX	146023976	146024091	hsa-mir-508	      480	-	146024008	146024031	miRna
1699	chrX	146047595	146047689	hsa-mir-509	      480	-	146047612	146047635	miRna
1699	chrX	146059398	146059472	hsa-mir-510	      480	-	146059440	146059463	miRna
1699	chrX	146066330	146066388	hsa-mir-514-1	480	-	146066330	146066350	miRna
1699	chrX	146069021	146069079	hsa-mir-514-2	480	-	146069021	146069041	miRna
1699	chrX	146071719	146071777	hsa-mir-514-3	480	-	146071719	146071739	miRna
1735	chrX	150797617	150797698	hsa-mir-224	      480	-	150797668	150797691	miRna
1735	chrX	150798667	150798752	hsa-mir-452	      480	-	150798679	150798700	miRna
1738	chrX	151231258	151231339	hsa-mir-105-1	480	-	151231307	151231327	miRna
1738	chrX	151233451	151233532	hsa-mir-105-2	480	-	151233500	151233520	miRna


From brian_osborne at cognia.com  Fri Sep 23 14:21:08 2005
From: brian_osborne at cognia.com (Brian Osborne)
Date: Fri Sep 23 14:37:03 2005
Subject: [Bioperl-l] dead link on bioperl.org
In-Reply-To: <000601c5bf92$6fd52fe0$611010ac@intern>
Message-ID: 

Daniel,

Fixed. Thanks.

Brian O.


On 9/22/05 12:26 PM, "Daniel Hansen"  wrote:

> Hi
> 
> There's a dead link on the HOWTO page on bioperl.org:
> http://bioperl.org/HOWTOs/
> 
> The link to the PDF of the Beginners HOWTO is dead:
> http://bioperl.org/HOWTOs/pdf/Beginners.pdf
> 
> Best regards,
> 
> Daniel
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l


From brian_osborne at cognia.com  Fri Sep 23 16:38:31 2005
From: brian_osborne at cognia.com (Brian Osborne)
Date: Fri Sep 23 16:56:23 2005
Subject: [Bioperl-l] bioperl 1.5.1 RC1 up
In-Reply-To: <73AFAD77-4C69-4D1A-AD0A-5D598A19A241@duke.edu>
Message-ID: 

Jason,

OS X 10.4 (perl 5.8.6), all accessory modules installed:

All tests successful, 123 subtests skipped.
Files=220, Tests=9916, 404 wallclock secs (164.46 cusr + 30.23 csys = 194.69
CPU)

Brian O.


On 9/21/05 11:44 PM, "Jason Stajich"  wrote:

> Release candidates for Bioperl 1.5.1 is up -I've not tagged anything
> in CVS so commits should continue to be made to the repository HEAD:
> 
> http://bioperl.org/DIST/bioperl-1.5.1-rc1.tar.gz
> http://bioperl.org/DIST/bioperl-1.5.1-rc1.zip
> 
> Tests pass for me on OSX with some, but not all dependancies installed.
> 
> I do see this for t/OntologyStore.t and a failed test --
> MSG: [5/5] tried to fetch http://cvs.sourceforge.net/viewcvs.py/
> *checkout*/song/ontology/so.definition?rev=HEAD, but server threw
> 500.  re
> 
> ------------------------------------------------------------------------
> -------
> t/OntologyStore.t                6    4  66.67%  3-6
> 125 subtests skipped.
> Failed 1/220 test scripts, 99.55% okay. 4/9916 subtests failed,
> 99.96% okay.
> 
> I believe aspects of this test should be disabled without
> BIOPERLDEBUG=1.
> 
> I think the Changes file and README will need to be checked over and
> corrected for this release.
> 
> Can folks check over for any test failures.  I believe RestrictionIO
> is going to fail on perl 5.6.x but I don't know exactly what the
> workaround is - other than detect perl version and skip tests where
> appropriate.
> 
> Can anyone speak up for bioperl-run and bioperl-ext as to whether or
> not we can tag and put these out as developer release as well?  I
> need someone to help out with testing these packages and getting them
> ship-shape for a release too.
> 
> -jason
> --
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
> 
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l


From hartzell at kestrel.alerce.com  Fri Sep 23 17:50:37 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Fri Sep 23 18:23:20 2005
Subject: [Bioperl-l] get_nof_contigs returns undef
In-Reply-To: <43338FC9.3030208@csiro.au>
References: <433379F6.4000306@csiro.au>
	<43338FC9.3030208@csiro.au>
Message-ID: <17204.30893.656357.407318@satchel.alerce.com>

Wes Barris writes:
 > [...]
 > I don't know enough about scalars and array refs to explain this, but
 > a fix for the above problem is:
 > 
 > Old Bio/Assembly/Scaffold.pm code:
 > 
 > sub get_nof_contigs {
 >      my $self = shift;
 >      return scalar( $self->get_contig_ids() );
 > }
 > 
 > New Bio/Assembly/Scaffold.pm code:
 > 
 > sub get_nof_contigs {
 >      my $self = shift;
 >      my @junk = $self->get_contig_ids;
 >      return scalar( @junk );
 > #   return scalar( $self->get_contig_ids() );
 > }

Ouch.  That makes my head hurt.

I think that the answer's not about "scalars and array ref", but
what happens when you evaluate things _in a scalar context_, and just
when that occurs.

Consider the following ridiculous piece of code.

   #!/usr/local/bin/perl -w
   
   use strict;
   use warnings;
   
   print "Without junk: ", one(), "\n";
   print "With junk: ", two(), "\n";
   
   sub one {
   	return scalar( moose() );
   }
   
   sub two {
   	my @junk = moose();
   	return scalar( @junk);
   }
   
   sub moose {
   	my $hash_ref = {};
   
   	$hash_ref->{a} = 'a';
   	$hash_ref->{b} = 'b';
   	$hash_ref->{c} = 'c';
   
   	return sort keys %{$hash_ref};
   }
   
   sub poodle {
   	my $hash_ref = {};
   
   	$hash_ref->{a} = 'a';
   	$hash_ref->{b} = 'b';
   	$hash_ref->{c} = 'c';
   
   	if (wantarray()) {
   		return sort keys %{$hash_ref};
   	}
   	else {
   		return scalar(sort keys %{$hash_ref});
   	}
   }
   
   sub ape {
   	my $hash_ref = {};
   
   	$hash_ref->{a} = 'a';
   	$hash_ref->{b} = 'b';
   	$hash_ref->{c} = 'c';
   
   	if (wantarray()) {
   		return sort keys %{$hash_ref};
   	}
   	else {
   		return scalar(keys %{$hash_ref});
   	}
   }

Fire it up in the perl debugger and set a breakpoint in ape (in other
words, 'b ape').

Now call ape (in other words 'x ape');

Now you should be sitting at the beginning of ape.  Call wantarray by
hand (in other words 'x wantarray').  **Lesson learned, the perl
debugger evaluates function calls in a list context** (yeah, it does
actually say that in the perldebug man page, but who reads *that*?).
Now step the rest of the way through ape (or just continue, aka 'c')
and you should see that it prints out the three items in the list
(a,b,c).

Quit the debugger and restart it on the same file (let's start fresh,
or just delete the breakpoint you set above).

This time do an 'x $a = ape' (since you're assigning the result of
calling ape to a scalar variable, it forces it to be evaluated in a
scalar context et voila, it returns 3.

Now repeat the exercise with sub poodle{} and you'll see that it
returns the list that you'd expect when you call it in an array
context, but returns undef when you call it in a scalar context.

Why?

Here's where I'd love a comment from a Perl Language Lawyer, but my
understanding of what's going on is that you're evaluating the sort()
function in a scalar context, which Just Doesn't Work.  sort's not set
up to handle being called in a scalar context and you end up with
undef.

A less wind-baggy experiment would be to hop into the debugger and
repeat this it makes sense:

     DB<20> x sort (1, 2, 3)
   0  1
   1  2
   2  3
     DB<21> x scalar sort (1, 2, 3)
   0  undef
     DB<22> 
   

Or, to be really brief about it, go look at "perldoc -f sort", where
the first thing it says is:

    In list context, this sorts the LIST and returns the sorted
    list value.  In scalar context, the behaviour of "sort()" is
    undefined.

Then look at the output of "perldoc -f scalar" which starts off with:

    scalar EXPR
            Forces EXPR to be interpreted in scalar context and returns the
            value of EXPR.

Probably should-a done that before....

I'll happily buy a beer for the first person who I see *in person* who
says: "You owe me a beer for making read all of that...".

g.
From heikki.lehvaslaiho at gmail.com  Sat Sep 24 05:11:45 2005
From: heikki.lehvaslaiho at gmail.com (Heikki Lehvaslaiho)
Date: Sat Sep 24 05:20:00 2005
Subject: [Bioperl-l] get_nof_contigs returns undef
In-Reply-To: <17204.30893.656357.407318@satchel.alerce.com>
References: <433379F6.4000306@csiro.au> <43338FC9.3030208@csiro.au>
	<17204.30893.656357.407318@satchel.alerce.com>
Message-ID: <200509241011.45932.heikki.lehvaslaiho@gmail.com>



So the question is how to force list context for a subroutine. This is 
something I've often wondered and have not found a clean solution.


See optional ways to do this within George's function one():

sub one {

    # option 0
    # does not work, because sort() in moose() is defined in scalar context
    return scalar( moose() );

    # option 1
    # does not work, shame because it would be most terse!
    # is there a way to do this?
    #return scalar( @{moose()} );

    # option 2
    # most common, but sort of stupid because it involves a variable
    my @junk = moose();
    return scalar( @junk);

    #option 3
    # performance issues?
    return scalar( map {$_} moose() );

    #option 4
    # we are quickly running out of perl functions 
    # that work in list context...
    return scalar( grep {/./} moose() );

}


 -Heikki


On Friday 23 September 2005 22:50, George Hartzell wrote:
> Wes Barris writes:
>  > [...]
>  > I don't know enough about scalars and array refs to explain this, but
>  > a fix for the above problem is:
>  >
>  > Old Bio/Assembly/Scaffold.pm code:
>  >
>  > sub get_nof_contigs {
>  >      my $self = shift;
>  >      return scalar( $self->get_contig_ids() );
>  > }
>  >
>  > New Bio/Assembly/Scaffold.pm code:
>  >
>  > sub get_nof_contigs {
>  >      my $self = shift;
>  >      my @junk = $self->get_contig_ids;
>  >      return scalar( @junk );
>  > #   return scalar( $self->get_contig_ids() );
>  > }
>
> Ouch.  That makes my head hurt.
>
> I think that the answer's not about "scalars and array ref", but
> what happens when you evaluate things _in a scalar context_, and just
> when that occurs.
>
> Consider the following ridiculous piece of code.
>
>    #!/usr/local/bin/perl -w
>
>    use strict;
>    use warnings;
>
>    print "Without junk: ", one(), "\n";
>    print "With junk: ", two(), "\n";
>
>    sub one {
>     return scalar( moose() );
>    }
>
>    sub two {
>    	my @junk = moose();
>    	return scalar( @junk);
>    }
>
>    sub moose {
>    	my $hash_ref = {};
>
>    	$hash_ref->{a} = 'a';
>    	$hash_ref->{b} = 'b';
>    	$hash_ref->{c} = 'c';
>
>    	return sort keys %{$hash_ref};
>    }
>
>    sub poodle {
>    	my $hash_ref = {};
>
>    	$hash_ref->{a} = 'a';
>    	$hash_ref->{b} = 'b';
>    	$hash_ref->{c} = 'c';
>
>    	if (wantarray()) {
>    		return sort keys %{$hash_ref};
>    	}
>    	else {
>    		return scalar(sort keys %{$hash_ref});
>    	}
>    }
>
>    sub ape {
>    	my $hash_ref = {};
>
>    	$hash_ref->{a} = 'a';
>    	$hash_ref->{b} = 'b';
>    	$hash_ref->{c} = 'c';
>
>    	if (wantarray()) {
>    		return sort keys %{$hash_ref};
>    	}
>    	else {
>    		return scalar(keys %{$hash_ref});
>    	}
>    }
>
> Fire it up in the perl debugger and set a breakpoint in ape (in other
> words, 'b ape').
>
> Now call ape (in other words 'x ape');
>
> Now you should be sitting at the beginning of ape.  Call wantarray by
> hand (in other words 'x wantarray').  **Lesson learned, the perl
> debugger evaluates function calls in a list context** (yeah, it does
> actually say that in the perldebug man page, but who reads *that*?).
> Now step the rest of the way through ape (or just continue, aka 'c')
> and you should see that it prints out the three items in the list
> (a,b,c).
>
> Quit the debugger and restart it on the same file (let's start fresh,
> or just delete the breakpoint you set above).
>
> This time do an 'x $a = ape' (since you're assigning the result of
> calling ape to a scalar variable, it forces it to be evaluated in a
> scalar context et voila, it returns 3.
>
> Now repeat the exercise with sub poodle{} and you'll see that it
> returns the list that you'd expect when you call it in an array
> context, but returns undef when you call it in a scalar context.
>
> Why?
>
> Here's where I'd love a comment from a Perl Language Lawyer, but my
> understanding of what's going on is that you're evaluating the sort()
> function in a scalar context, which Just Doesn't Work.  sort's not set
> up to handle being called in a scalar context and you end up with
> undef.
>
> A less wind-baggy experiment would be to hop into the debugger and
> repeat this it makes sense:
>
>      DB<20> x sort (1, 2, 3)
>    0  1
>    1  2
>    2  3
>      DB<21> x scalar sort (1, 2, 3)
>    0  undef
>      DB<22>
>
>
> Or, to be really brief about it, go look at "perldoc -f sort", where
> the first thing it says is:
>
>     In list context, this sorts the LIST and returns the sorted
>     list value.  In scalar context, the behaviour of "sort()" is
>     undefined.
>
> Then look at the output of "perldoc -f scalar" which starts off with:
>
>     scalar EXPR
>             Forces EXPR to be interpreted in scalar context and returns the
>             value of EXPR.
>
> Probably should-a done that before....
>
> I'll happily buy a beer for the first person who I see *in person* who
> says: "You owe me a beer for making read all of that...".
>
> g.
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l

-- 
______ _/      _/_____________________________________________________
      _/      _/                      http://www.ebi.ac.uk/mutations/
     _/  _/  _/  Heikki Lehvaslaiho    heikki at_ebi _ac _uk
    _/_/_/_/_/  EMBL Outstation, European Bioinformatics Institute
   _/  _/  _/  Wellcome Trust Genome Campus, Hinxton
  _/  _/  _/  Cambridge, CB10 1SD, United Kingdom
     _/      Phone: +44 (0)1223 494 644   FAX: +44 (0)1223 494 468
___ _/_/_/_/_/________________________________________________________
From heikki.lehvaslaiho at gmail.com  Sat Sep 24 05:11:45 2005
From: heikki.lehvaslaiho at gmail.com (Heikki Lehvaslaiho)
Date: Sat Sep 24 08:03:19 2005
Subject: [Bioperl-l] get_nof_contigs returns undef
In-Reply-To: <17204.30893.656357.407318@satchel.alerce.com>
References: <433379F6.4000306@csiro.au> <43338FC9.3030208@csiro.au>
	<17204.30893.656357.407318@satchel.alerce.com>
Message-ID: <200509241011.45932.heikki.lehvaslaiho@gmail.com>



So the question is how to force list context for a subroutine. This is 
something I've often wondered and have not found a clean solution.


See optional ways to do this within George's function one():

sub one {

    # option 0
    # does not work, because sort() in moose() is defined in scalar context
    return scalar( moose() );

    # option 1
    # does not work, shame because it would be most terse!
    # is there a way to do this?
    #return scalar( @{moose()} );

    # option 2
    # most common, but sort of stupid because it involves a variable
    my @junk = moose();
    return scalar( @junk);

    #option 3
    # performance issues?
    return scalar( map {$_} moose() );

    #option 4
    # we are quickly running out of perl functions 
    # that work in list context...
    return scalar( grep {/./} moose() );

}


 -Heikki


On Friday 23 September 2005 22:50, George Hartzell wrote:
> Wes Barris writes:
>  > [...]
>  > I don't know enough about scalars and array refs to explain this, but
>  > a fix for the above problem is:
>  >
>  > Old Bio/Assembly/Scaffold.pm code:
>  >
>  > sub get_nof_contigs {
>  >      my $self = shift;
>  >      return scalar( $self->get_contig_ids() );
>  > }
>  >
>  > New Bio/Assembly/Scaffold.pm code:
>  >
>  > sub get_nof_contigs {
>  >      my $self = shift;
>  >      my @junk = $self->get_contig_ids;
>  >      return scalar( @junk );
>  > #   return scalar( $self->get_contig_ids() );
>  > }
>
> Ouch.  That makes my head hurt.
>
> I think that the answer's not about "scalars and array ref", but
> what happens when you evaluate things _in a scalar context_, and just
> when that occurs.
>
> Consider the following ridiculous piece of code.
>
>    #!/usr/local/bin/perl -w
>
>    use strict;
>    use warnings;
>
>    print "Without junk: ", one(), "\n";
>    print "With junk: ", two(), "\n";
>
>    sub one {
>     return scalar( moose() );
>    }
>
>    sub two {
>    	my @junk = moose();
>    	return scalar( @junk);
>    }
>
>    sub moose {
>    	my $hash_ref = {};
>
>    	$hash_ref->{a} = 'a';
>    	$hash_ref->{b} = 'b';
>    	$hash_ref->{c} = 'c';
>
>    	return sort keys %{$hash_ref};
>    }
>
>    sub poodle {
>    	my $hash_ref = {};
>
>    	$hash_ref->{a} = 'a';
>    	$hash_ref->{b} = 'b';
>    	$hash_ref->{c} = 'c';
>
>    	if (wantarray()) {
>    		return sort keys %{$hash_ref};
>    	}
>    	else {
>    		return scalar(sort keys %{$hash_ref});
>    	}
>    }
>
>    sub ape {
>    	my $hash_ref = {};
>
>    	$hash_ref->{a} = 'a';
>    	$hash_ref->{b} = 'b';
>    	$hash_ref->{c} = 'c';
>
>    	if (wantarray()) {
>    		return sort keys %{$hash_ref};
>    	}
>    	else {
>    		return scalar(keys %{$hash_ref});
>    	}
>    }
>
> Fire it up in the perl debugger and set a breakpoint in ape (in other
> words, 'b ape').
>
> Now call ape (in other words 'x ape');
>
> Now you should be sitting at the beginning of ape.  Call wantarray by
> hand (in other words 'x wantarray').  **Lesson learned, the perl
> debugger evaluates function calls in a list context** (yeah, it does
> actually say that in the perldebug man page, but who reads *that*?).
> Now step the rest of the way through ape (or just continue, aka 'c')
> and you should see that it prints out the three items in the list
> (a,b,c).
>
> Quit the debugger and restart it on the same file (let's start fresh,
> or just delete the breakpoint you set above).
>
> This time do an 'x $a = ape' (since you're assigning the result of
> calling ape to a scalar variable, it forces it to be evaluated in a
> scalar context et voila, it returns 3.
>
> Now repeat the exercise with sub poodle{} and you'll see that it
> returns the list that you'd expect when you call it in an array
> context, but returns undef when you call it in a scalar context.
>
> Why?
>
> Here's where I'd love a comment from a Perl Language Lawyer, but my
> understanding of what's going on is that you're evaluating the sort()
> function in a scalar context, which Just Doesn't Work.  sort's not set
> up to handle being called in a scalar context and you end up with
> undef.
>
> A less wind-baggy experiment would be to hop into the debugger and
> repeat this it makes sense:
>
>      DB<20> x sort (1, 2, 3)
>    0  1
>    1  2
>    2  3
>      DB<21> x scalar sort (1, 2, 3)
>    0  undef
>      DB<22>
>
>
> Or, to be really brief about it, go look at "perldoc -f sort", where
> the first thing it says is:
>
>     In list context, this sorts the LIST and returns the sorted
>     list value.  In scalar context, the behaviour of "sort()" is
>     undefined.
>
> Then look at the output of "perldoc -f scalar" which starts off with:
>
>     scalar EXPR
>             Forces EXPR to be interpreted in scalar context and returns the
>             value of EXPR.
>
> Probably should-a done that before....
>
> I'll happily buy a beer for the first person who I see *in person* who
> says: "You owe me a beer for making read all of that...".
>
> g.
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l

-- 
______ _/      _/_____________________________________________________
      _/      _/                      http://www.ebi.ac.uk/mutations/
     _/  _/  _/  Heikki Lehvaslaiho    heikki at_ebi _ac _uk
    _/_/_/_/_/  EMBL Outstation, European Bioinformatics Institute
   _/  _/  _/  Wellcome Trust Genome Campus, Hinxton
  _/  _/  _/  Cambridge, CB10 1SD, United Kingdom
     _/      Phone: +44 (0)1223 494 644   FAX: +44 (0)1223 494 468
___ _/_/_/_/_/________________________________________________________
From heikki.lehvaslaiho at gmail.com  Sat Sep 24 05:11:45 2005
From: heikki.lehvaslaiho at gmail.com (Heikki Lehvaslaiho)
Date: Sat Sep 24 09:17:11 2005
Subject: [Bioperl-l] get_nof_contigs returns undef
In-Reply-To: <17204.30893.656357.407318@satchel.alerce.com>
References: <433379F6.4000306@csiro.au> <43338FC9.3030208@csiro.au>
	<17204.30893.656357.407318@satchel.alerce.com>
Message-ID: <200509241011.45932.heikki.lehvaslaiho@gmail.com>



So the question is how to force list context for a subroutine. This is 
something I've often wondered and have not found a clean solution.


See optional ways to do this within George's function one():

sub one {

    # option 0
    # does not work, because sort() in moose() is defined in scalar context
    return scalar( moose() );

    # option 1
    # does not work, shame because it would be most terse!
    # is there a way to do this?
    #return scalar( @{moose()} );

    # option 2
    # most common, but sort of stupid because it involves a variable
    my @junk = moose();
    return scalar( @junk);

    #option 3
    # performance issues?
    return scalar( map {$_} moose() );

    #option 4
    # we are quickly running out of perl functions 
    # that work in list context...
    return scalar( grep {/./} moose() );

}


 -Heikki


On Friday 23 September 2005 22:50, George Hartzell wrote:
> Wes Barris writes:
>  > [...]
>  > I don't know enough about scalars and array refs to explain this, but
>  > a fix for the above problem is:
>  >
>  > Old Bio/Assembly/Scaffold.pm code:
>  >
>  > sub get_nof_contigs {
>  >      my $self = shift;
>  >      return scalar( $self->get_contig_ids() );
>  > }
>  >
>  > New Bio/Assembly/Scaffold.pm code:
>  >
>  > sub get_nof_contigs {
>  >      my $self = shift;
>  >      my @junk = $self->get_contig_ids;
>  >      return scalar( @junk );
>  > #   return scalar( $self->get_contig_ids() );
>  > }
>
> Ouch.  That makes my head hurt.
>
> I think that the answer's not about "scalars and array ref", but
> what happens when you evaluate things _in a scalar context_, and just
> when that occurs.
>
> Consider the following ridiculous piece of code.
>
>    #!/usr/local/bin/perl -w
>
>    use strict;
>    use warnings;
>
>    print "Without junk: ", one(), "\n";
>    print "With junk: ", two(), "\n";
>
>    sub one {
>     return scalar( moose() );
>    }
>
>    sub two {
>    	my @junk = moose();
>    	return scalar( @junk);
>    }
>
>    sub moose {
>    	my $hash_ref = {};
>
>    	$hash_ref->{a} = 'a';
>    	$hash_ref->{b} = 'b';
>    	$hash_ref->{c} = 'c';
>
>    	return sort keys %{$hash_ref};
>    }
>
>    sub poodle {
>    	my $hash_ref = {};
>
>    	$hash_ref->{a} = 'a';
>    	$hash_ref->{b} = 'b';
>    	$hash_ref->{c} = 'c';
>
>    	if (wantarray()) {
>    		return sort keys %{$hash_ref};
>    	}
>    	else {
>    		return scalar(sort keys %{$hash_ref});
>    	}
>    }
>
>    sub ape {
>    	my $hash_ref = {};
>
>    	$hash_ref->{a} = 'a';
>    	$hash_ref->{b} = 'b';
>    	$hash_ref->{c} = 'c';
>
>    	if (wantarray()) {
>    		return sort keys %{$hash_ref};
>    	}
>    	else {
>    		return scalar(keys %{$hash_ref});
>    	}
>    }
>
> Fire it up in the perl debugger and set a breakpoint in ape (in other
> words, 'b ape').
>
> Now call ape (in other words 'x ape');
>
> Now you should be sitting at the beginning of ape.  Call wantarray by
> hand (in other words 'x wantarray').  **Lesson learned, the perl
> debugger evaluates function calls in a list context** (yeah, it does
> actually say that in the perldebug man page, but who reads *that*?).
> Now step the rest of the way through ape (or just continue, aka 'c')
> and you should see that it prints out the three items in the list
> (a,b,c).
>
> Quit the debugger and restart it on the same file (let's start fresh,
> or just delete the breakpoint you set above).
>
> This time do an 'x $a = ape' (since you're assigning the result of
> calling ape to a scalar variable, it forces it to be evaluated in a
> scalar context et voila, it returns 3.
>
> Now repeat the exercise with sub poodle{} and you'll see that it
> returns the list that you'd expect when you call it in an array
> context, but returns undef when you call it in a scalar context.
>
> Why?
>
> Here's where I'd love a comment from a Perl Language Lawyer, but my
> understanding of what's going on is that you're evaluating the sort()
> function in a scalar context, which Just Doesn't Work.  sort's not set
> up to handle being called in a scalar context and you end up with
> undef.
>
> A less wind-baggy experiment would be to hop into the debugger and
> repeat this it makes sense:
>
>      DB<20> x sort (1, 2, 3)
>    0  1
>    1  2
>    2  3
>      DB<21> x scalar sort (1, 2, 3)
>    0  undef
>      DB<22>
>
>
> Or, to be really brief about it, go look at "perldoc -f sort", where
> the first thing it says is:
>
>     In list context, this sorts the LIST and returns the sorted
>     list value.  In scalar context, the behaviour of "sort()" is
>     undefined.
>
> Then look at the output of "perldoc -f scalar" which starts off with:
>
>     scalar EXPR
>             Forces EXPR to be interpreted in scalar context and returns the
>             value of EXPR.
>
> Probably should-a done that before....
>
> I'll happily buy a beer for the first person who I see *in person* who
> says: "You owe me a beer for making read all of that...".
>
> g.
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l

-- 
______ _/      _/_____________________________________________________
      _/      _/                      http://www.ebi.ac.uk/mutations/
     _/  _/  _/  Heikki Lehvaslaiho    heikki at_ebi _ac _uk
    _/_/_/_/_/  EMBL Outstation, European Bioinformatics Institute
   _/  _/  _/  Wellcome Trust Genome Campus, Hinxton
  _/  _/  _/  Cambridge, CB10 1SD, United Kingdom
     _/      Phone: +44 (0)1223 494 644   FAX: +44 (0)1223 494 468
___ _/_/_/_/_/________________________________________________________
From jason.stajich at duke.edu  Sat Sep 24 13:07:03 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Sat Sep 24 13:06:48 2005
Subject: [Bioperl-l] bioperl-run 1.5.1 RC1 up
Message-ID: <0115AFF8-D011-4E2A-8897-F3EE8E241687@duke.edu>

The bioperl-run RC1 package is up as well thanks to fixes from  
several people.  I think that this package will still need some more  
testing and fixes before it will be ready for release, but I  
encourage folks to take it out for a spin.

http://bioperl.org/DIST/bioperl-run-1.5.1-rc1.tar.gz
http://bioperl.org/DIST/bioperl-run-1.5.1-rc1.zip

There was at least one bug reported with tmhmm and the --noplot  
option - I had the code to fix it, but have not checked it in because  
I do not have copy of tmhmm on my system to test it against.  We'll  
need someone with that in house to do the fixing and re-test.   I can  
provide the patch file to the in-progress fix if someone wants to  
take that on.


Thanks,
-jason

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From bmoore at genetics.utah.edu  Sat Sep 24 14:13:52 2005
From: bmoore at genetics.utah.edu (Barry Moore)
Date: Sat Sep 24 14:23:50 2005
Subject: [Bioperl-l] dead link on bioperl.org
Message-ID: 

Works fine for me.

Barry

-----Original Message-----
From: bioperl-l-bounces@portal.open-bio.org
[mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Daniel
Hansen
Sent: Thursday, September 22, 2005 10:27 AM
To: bioperl-l@bioperl.org
Subject: [Bioperl-l] dead link on bioperl.org

Hi

There's a dead link on the HOWTO page on bioperl.org:
http://bioperl.org/HOWTOs/

The link to the PDF of the Beginners HOWTO is dead:
http://bioperl.org/HOWTOs/pdf/Beginners.pdf

Best regards,

Daniel

_______________________________________________
Bioperl-l mailing list
Bioperl-l@portal.open-bio.org
http://portal.open-bio.org/mailman/listinfo/bioperl-l

From jason.stajich at duke.edu  Sun Sep 25 10:39:57 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Sun Sep 25 10:38:59 2005
Subject: [Bioperl-l] RemoteBlast by Bio::Perl Through proxy
In-Reply-To: <932ed26e050921064073bc5936@mail.gmail.com>
References: <932ed26e050921064073bc5936@mail.gmail.com>
Message-ID: <778CAFE2-2112-4561-B1E8-465250ECDAD5@duke.edu>

If you look at the code for setting the proxy  in the module you see  
that we are just delegating to the LWP::UserAgent object, so read the  
documentation for LWP::UserAgent as that is where the proxy stuff is  
handled.  There should be a way to do all of this via environment  
variables as well - this is outlined in the LWP document, you may  
have to add $blast->ua->env_proxy call to your code, I'm not sure.


sub proxy {
     my ($self,$protocol,$proxy) = @_;
     return undef if ( !defined $self->ua || !defined $protocol
                       || !defined $proxy );
     return $self->ua->proxy($protocol,$proxy);
}


On Sep 21, 2005, at 9:40 AM, Sachin Pundhir wrote:

> Hi
>  I have a problem regarding performing remote blast through
> RemoteBlast.pmmodule if Bioperl. I am getting the error
>  500 Can't connect to www.ncbi.nlm.nih.gov:80
> (Bad hostname '
> www.ncbi.nlm.nih.gov ')
>  I am not able to set the proxy setting, which i have done  
> successfully to
> retrieve a sequence from the genbank.
>  It will be great help from your side.
>  waiting for ur timely help.
>  Sachin
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From hartzell at kestrel.alerce.com  Sun Sep 25 14:42:44 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Sun Sep 25 14:42:51 2005
Subject: [Bioperl-l] get_nof_contigs returns undef
In-Reply-To: <200509241011.45932.heikki.lehvaslaiho@gmail.com>
References: <433379F6.4000306@csiro.au> <43338FC9.3030208@csiro.au>
	<17204.30893.656357.407318@satchel.alerce.com>
	<200509241011.45932.heikki.lehvaslaiho@gmail.com>
Message-ID: <17206.61348.329628.13021@satchel.alerce.com>

Heikki Lehvaslaiho writes:
 > 
 > 
 > So the question is how to force list context for a subroutine. This is 
 > something I've often wondered and have not found a clean solution.
 > [...]

No, [I think] that's not the problem here.

The problem is that there's a call to sort() buried in the
get_nof_contigs return statement and sort is a Surprising function (it
returns undef when called in a scalar context).


The cleanest fix would be to petition the Perl community to change the
semantics of the sort() function so that it's not so Surprising.... ;)


In the meantime, I tend to avoid doing real work in a return
statement, I'd do the work w/in the body of the function, assign the
results to an array (e.g. @results), then return that.

It looks a bit wordy and people think I'm paranoid, but it's just so
much easier for me to be safe than to try to remember whether Perl's
going to Do The Right Thing or just bite me in the ass....

If you really want to force something into a list context, the second
paragraph of the documentation for scalar() says this:

   There is no equivalent operator to force an expression to be
   interpolated in list context because in practice, this is never
   needed.  If you really wanted to do so, however, you could use
   the construction "@{[ (some expression) ]}", but usually a sim-
   ple "(some expression)" suffices.


g

From jason.stajich at duke.edu  Sun Sep 25 16:38:05 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Sun Sep 25 16:37:05 2005
Subject: [Bioperl-l] bioperl-run 1.5.1 RC1 up
In-Reply-To: <0115AFF8-D011-4E2A-8897-F3EE8E241687@duke.edu>
References: <0115AFF8-D011-4E2A-8897-F3EE8E241687@duke.edu>
Message-ID: <179595AE-04E0-4B0E-A635-8FB77E9C9119@duke.edu>

okay - I made some fixes,
go ahead and try RC2 instead.

There are problems with the EMBOSS and PHYLIP wrappers because of  
course the parameters have changed.  I don't have time to track this  
down, we talked about adding switches  to handle different version  
and have a different parsing menu, but I don't have the time or  
energy to do it.  This seems like a pretty big showstopper for  
bioperl-run, I hope some other folks can help out.

t/Consense.t    9  2304     7    0   0.00%  ??
t/DrawGram.t    2   512     4    0   0.00%  ??
t/DrawTree.t    2   512     4    0   0.00%  ??
t/EMBOSS.t      2   512    30    1   3.33%  7
t/Neighbor.t    2   512    14    0   0.00%  ??
t/Phrap.t                   5    2  40.00%  4-5
t/Primer3.t                 7    1  14.29%  7
t/ProtDist.t               11    1   9.09%  9
t/ProtPars.t    2   512     7    0   0.00%  ??
t/SeqBoot.t     2   512     6    0   0.00%  ??


http://bioperl.org/DIST/bioperl-run-1.5.1-rc2.tar.gz
http://bioperl.org/DIST/bioperl-run-1.5.1-rc2.zip

can someone at least look at the Phrap and Primer3 stuff.

Thanks,
-jason
On Sep 24, 2005, at 1:07 PM, Jason Stajich wrote:

> The bioperl-run RC1 package is up as well thanks to fixes from  
> several people.  I think that this package will still need some  
> more testing and fixes before it will be ready for release, but I  
> encourage folks to take it out for a spin.
>
> http://bioperl.org/DIST/bioperl-run-1.5.1-rc1.tar.gz
> http://bioperl.org/DIST/bioperl-run-1.5.1-rc1.zip
>
> There was at least one bug reported with tmhmm and the --noplot  
> option - I had the code to fix it, but have not checked it in  
> because I do not have copy of tmhmm on my system to test it  
> against.  We'll need someone with that in house to do the fixing  
> and re-test.   I can provide the patch file to the in-progress fix  
> if someone wants to take that on.
>
>
> Thanks,
> -jason
>
> --
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
>
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From heikki.lehvaslaiho at gmail.com  Mon Sep 26 02:10:32 2005
From: heikki.lehvaslaiho at gmail.com (Heikki Lehvaslaiho)
Date: Mon Sep 26 03:14:46 2005
Subject: [Bioperl-l] get_nof_contigs returns undef
In-Reply-To: <17206.61348.329628.13021@satchel.alerce.com>
References: <433379F6.4000306@csiro.au>
	<200509241011.45932.heikki.lehvaslaiho@gmail.com>
	<17206.61348.329628.13021@satchel.alerce.com>
Message-ID: <200509260710.32624.heikki.lehvaslaiho@gmail.com>


Ah, thanks, the extra square brackets do the trick!

return scalar( @{[moose()]} );

sub get_nof_contigs {
 ? ? ?my $self = shift;
 ? ? ?return scalar( @{[$self->get_contig_ids()]} );
}

Talk about clean syntax! ;-)

Seriously, I do agree with you that it is better to be wordy and clear than 
terse and hard to read.

 -Heikki

On Sunday 25 September 2005 19:42, George Hartzell wrote:
> Heikki Lehvaslaiho writes:
>  > So the question is how to force list context for a subroutine. This is
>  > something I've often wondered and have not found a clean solution.
>  > [...]
>
> No, [I think] that's not the problem here.
>
> The problem is that there's a call to sort() buried in the
> get_nof_contigs return statement and sort is a Surprising function (it
> returns undef when called in a scalar context).
>
> 
> The cleanest fix would be to petition the Perl community to change the
> semantics of the sort() function so that it's not so Surprising.... ;)
> 
>
> In the meantime, I tend to avoid doing real work in a return
> statement, I'd do the work w/in the body of the function, assign the
> results to an array (e.g. @results), then return that.
>
> It looks a bit wordy and people think I'm paranoid, but it's just so
> much easier for me to be safe than to try to remember whether Perl's
> going to Do The Right Thing or just bite me in the ass....
>
> If you really want to force something into a list context, the second
> paragraph of the documentation for scalar() says this:
>
>    There is no equivalent operator to force an expression to be
>    interpolated in list context because in practice, this is never
>    needed.  If you really wanted to do so, however, you could use
>    the construction "@{[ (some expression) ]}", but usually a sim-
>    ple "(some expression)" suffices.
>
>
> g
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l

-- 
______ _/      _/_____________________________________________________
      _/      _/                      http://www.ebi.ac.uk/mutations/
     _/  _/  _/  Heikki Lehvaslaiho    heikki at_ebi _ac _uk
    _/_/_/_/_/  EMBL Outstation, European Bioinformatics Institute
   _/  _/  _/  Wellcome Trust Genome Campus, Hinxton
  _/  _/  _/  Cambridge, CB10 1SD, United Kingdom
     _/      Phone: +44 (0)1223 494 644   FAX: +44 (0)1223 494 468
___ _/_/_/_/_/________________________________________________________

From chandan.kr.singh at gmail.com  Mon Sep 26 19:40:14 2005
From: chandan.kr.singh at gmail.com (CHANDAN SINGH)
Date: Mon Sep 26 19:40:06 2005
Subject: [Bioperl-l] RemoteBlast by Bio::Perl Through proxy
In-Reply-To: <2d4f32050926162040f2d8d3@mail.gmail.com>
References: <932ed26e050921064073bc5936@mail.gmail.com>
	<778CAFE2-2112-4561-B1E8-465250ECDAD5@duke.edu>
	<2d4f32050926162040f2d8d3@mail.gmail.com>
Message-ID: <2d4f32050926164050602e86@mail.gmail.com>

Just now i found that their are environment variables as
proxy_user=login
proxy_passwd=pass

try using them
Chandan


On 9/27/05, CHANDAN SINGH  wrote:
>
> Hi Sachin
>
> if u have found the solution to ur prob , u can escape reading henceforth.
>
> It seems setting the env variable containig login and password does not
> work with LWP , still u can try setting it as
> http://login:pass@server:port 
> but i dont think it will work .
>
> I am going to ask u to try something similar to what i had done for the
> proxy
> earlier . I know messing up with the modules is not a good idea and even
> Jason
> had expressed his dislike to my previous solution because of it but i dont
> think
> using Bio::Perl leaves another option . If u can use Remoteblast.pmdirectly ,
> u can use objects to meet ur need .Anyway , if in the LWP::UserAgent
> module
> u add the line
>
> $request->proxy_authorization _basic("login" , "passwd" ) ;
>
> in the
> sub request {
> after its first line , it might work .
>
> I could not check it , as my proxy does not require authentication .
> I hope it works , though i did not try it .
> Do respond .
> Cheers
> Chandan
>
>
> On 9/25/05, Jason Stajich  wrote:
> >
> > If you look at the code for setting the proxy in the module you see
> > that we are just delegating to the LWP::UserAgent object, so read the
> > documentation for LWP::UserAgent as that is where the proxy stuff is
> > handled. There should be a way to do all of this via environment
> > variables as well - this is outlined in the LWP document, you may
> > have to add $blast->ua->env_proxy call to your code, I'm not sure.
> >
> >
> > sub proxy {
> > my ($self,$protocol,$proxy) = @_;
> > return undef if ( !defined $self->ua || !defined $protocol
> > || !defined $proxy );
> > return $self->ua->proxy($protocol,$proxy);
> > }
> >
> >
> > On Sep 21, 2005, at 9:40 AM, Sachin Pundhir wrote:
> >
> > > Hi
> > > I have a problem regarding performing remote blast through
> > > RemoteBlast.pmmodule if Bioperl. I am getting the error
> > > 500 Can't connect to www.ncbi.nlm.nih.gov:80
> > > (Bad hostname '
> > > www.ncbi.nlm.nih.gov  <
> > http://www.ncbi.nlm.nih.gov>')
> > > I am not able to set the proxy setting, which i have done
> > > successfully to
> > > retrieve a sequence from the genbank.
> > > It will be great help from your side.
> > > waiting for ur timely help.
> > > Sachin
> > >
> > > _______________________________________________
> > > Bioperl-l mailing list
> > > Bioperl-l@portal.open-bio.org
> > > http://portal.open-bio.org/mailman/listinfo/bioperl-l
> > >
> >
> > --
> > Jason Stajich
> > Duke University
> > http://www.duke.edu/~jes12 
> >
> >
> > _______________________________________________
> > Bioperl-l mailing list
> > Bioperl-l@portal.open-bio.org
> > http://portal.open-bio.org/mailman/listinfo/bioperl-l
> >
>
>

From hartzell at kestrel.alerce.com  Tue Sep 27 00:38:01 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Tue Sep 27 00:38:15 2005
Subject: [Bioperl-l] bioperl-run 1.5.1 RC1 up
In-Reply-To: <0115AFF8-D011-4E2A-8897-F3EE8E241687@duke.edu>
References: <0115AFF8-D011-4E2A-8897-F3EE8E241687@duke.edu>
Message-ID: <17208.52393.206273.153723@satchel.alerce.com>


Here's another patch for Primer3.pm.  Without the first section one
ends up with an entry in the hash who's key is the empty string and
who's value is the empty string.  Without the second section, one ends
up w/out an input_options section.

I've been running both against an older copy of -run in a real app for
a while, so I think that they're ok.

g.


*** Bio/Tools/Run/Primer3.pm.orig	Tue Mar  1 18:26:31 2005
--- Bio/Tools/Run/Primer3.pm	Sun Jun 12 18:17:55 2005
***************
*** 437,442 ****
--- 437,443 ----
  			print OUT $_;
  		}
  		chomp;
+ 		next if ($_ eq "="); # skip over the boulderio record terminator.
  		my ($return, $value) = split('=',$_);
  		$self->{'results'}->{$return} = $value;
  	}
***************
*** 452,457 ****
--- 453,462 ----
  	$self->{results_obj} = new Bio::Tools::Primer3;
  	$self->{results_obj}->_set_variable('results', $self->{results});
  	$self->{results_obj}->_set_variable('seqobject', $self->{seqobject});
+ 	# Bio::Tools::Primer3::_separate needs a hash of the primer3 arguments,
+ 	# with the arg as the key and the value as the value (surprise!).
+ 	my %input_hash = map {split '='} @{$self->{'primer3_input'}};
+ 	$self->{results_obj}->_set_variable('input_options', \%input_hash);
  	$self->{results_separated}= $self->{results_obj}->_separate();
  	return $self->{results_obj};
  }
From hartzell at kestrel.alerce.com  Tue Sep 27 00:19:57 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Tue Sep 27 00:41:13 2005
Subject: [Bioperl-l] bioperl-run 1.5.1 RC1 up
In-Reply-To: <179595AE-04E0-4B0E-A635-8FB77E9C9119@duke.edu>
References: <0115AFF8-D011-4E2A-8897-F3EE8E241687@duke.edu>
	<179595AE-04E0-4B0E-A635-8FB77E9C9119@duke.edu>
Message-ID: <17208.51309.145490.138411@satchel.alerce.com>

Jason Stajich writes:
 > okay - I made some fixes,
 > go ahead and try RC2 instead.
 > 
 > [...]
 > t/Primer3.t                 7    1  14.29%  7
 > [...]
 > can someone at least look at the Phrap and Primer3 stuff.

You can fix the Primer3.t test by changing the expected value from a 4
to a 5.  There was a bug in Bio::Tools::Primer3.pm involving counting
the results that's been patched, it seems that the test code in
Primer3.t didn't keep up:

*** t/Primer3.t.orig    Mon Sep 26 21:09:46 2005
--- t/Primer3.t Mon Sep 26 21:09:56 2005
***************
*** 49,51 ****
  ok $primer3->add_targets('PRIMER_SEQUENCE_ID'=>'test seq');
  ok $results = $primer3->run;
! ok( $num_results = $results->number_of_results,4);
--- 49,51 ----
  ok $primer3->add_targets('PRIMER_SEQUENCE_ID'=>'test seq');
  ok $results = $primer3->run;
! ok( $num_results = $results->number_of_results,5);

I have two other patches to my version of Primer3.pm and am trying to
remember what they fix....  I'll send them along if they're still
needed.

g.
From chandan.kr.singh at gmail.com  Mon Sep 26 19:20:22 2005
From: chandan.kr.singh at gmail.com (CHANDAN SINGH)
Date: Tue Sep 27 03:08:18 2005
Subject: [Bioperl-l] RemoteBlast by Bio::Perl Through proxy
In-Reply-To: <778CAFE2-2112-4561-B1E8-465250ECDAD5@duke.edu>
References: <932ed26e050921064073bc5936@mail.gmail.com>
	<778CAFE2-2112-4561-B1E8-465250ECDAD5@duke.edu>
Message-ID: <2d4f32050926162040f2d8d3@mail.gmail.com>

Hi Sachin

if u have found the solution to ur prob , u can escape reading henceforth.
It seems setting the env variable containig login and password does not
work with LWP , still u can try setting it as
http://login:pass@server:port 
but i dont think it will work .

I am going to ask u to try something similar to what i had done for the
proxy
earlier . I know messing up with the modules is not a good idea and even
Jason
had expressed his dislike to my previous solution because of it but i dont
think
using Bio::Perl leaves another option . If u can use
Remoteblast.pmdirectly ,
u can use objects to meet ur need .Anyway , if in the LWP::UserAgent module
u add the line

$request->proxy_authorization _basic("login" , "passwd" ) ;

in the
sub request {
after its first line , it might work .

I could not check it , as my proxy does not require authentication .
I hope it works , though i did not try it .
Do respond .
Cheers
Chandan


On 9/25/05, Jason Stajich  wrote:
>
> If you look at the code for setting the proxy in the module you see
> that we are just delegating to the LWP::UserAgent object, so read the
> documentation for LWP::UserAgent as that is where the proxy stuff is
> handled. There should be a way to do all of this via environment
> variables as well - this is outlined in the LWP document, you may
> have to add $blast->ua->env_proxy call to your code, I'm not sure.
>
>
> sub proxy {
> my ($self,$protocol,$proxy) = @_;
> return undef if ( !defined $self->ua || !defined $protocol
> || !defined $proxy );
> return $self->ua->proxy($protocol,$proxy);
> }
>
>
> On Sep 21, 2005, at 9:40 AM, Sachin Pundhir wrote:
>
> > Hi
> > I have a problem regarding performing remote blast through
> > RemoteBlast.pmmodule if Bioperl. I am getting the error
> > 500 Can't connect to www.ncbi.nlm.nih.gov:80
> > (Bad hostname '
> > www.ncbi.nlm.nih.gov  <
> http://www.ncbi.nlm.nih.gov>')
> > I am not able to set the proxy setting, which i have done
> > successfully to
> > retrieve a sequence from the genbank.
> > It will be great help from your side.
> > waiting for ur timely help.
> > Sachin
> >
> > _______________________________________________
> > Bioperl-l mailing list
> > Bioperl-l@portal.open-bio.org
> > http://portal.open-bio.org/mailman/listinfo/bioperl-l
> >
>
> --
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
>
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

From xuying at sibs.ac.cn  Tue Sep 27 03:20:11 2005
From: xuying at sibs.ac.cn (xuying)
Date: Tue Sep 27 04:12:46 2005
Subject: [Bioperl-l] a stupid question
Message-ID: <20050927072412.0E3AE10DE11@smtp.sibs.ac.cn>

Dear All:
        I have a file containing wanted genes' GeneIDs. How can I map this GeneID to its Fasta sequence (genomic sequence of the gene)? Although There is position and contig information in the gene2accession file... Is there any simple way? Thanks!
	

Best Regards!
 				

¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡xuying
¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡xuying@sibs.ac.cn
¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡2005-09-27

From sdavis2 at mail.nih.gov  Tue Sep 27 06:36:47 2005
From: sdavis2 at mail.nih.gov (Sean Davis)
Date: Tue Sep 27 06:39:07 2005
Subject: [Bioperl-l] a stupid question
In-Reply-To: <20050927072412.0E3AE10DE11@smtp.sibs.ac.cn>
Message-ID: 

On 9/27/05 3:20 AM, "xuying"  wrote:

> Dear All:
>       I have a file containing wanted genes' GeneIDs. How can I map this
> GeneID to its Fasta sequence (genomic sequence of the gene)? Although There is
> position and contig information in the gene2accession file... Is there any
> simple way? Thanks!

You truly want the genomic sequence for a given gene, or do you want the
spliced transcript?  The spliced transcripts are called refseqs in NCBI
parlance and there may be zero to many refseqs for each Gene ID.  There are
a number of ways to get the refseq sequences.  You can use NCBI ftp to get
the mRNA for them, or you can use Ensembl or UCSC to get the genomic
versions of them (the spliced genomic sequence).  If you truly want the
"locus" associated with a given Gene ID, I don't know where that information
is stored in an easily-retrievable, standardized place, but Stefan may be
able to tell you how to get it from the ASN1 files from NCBI.  (Stefan?)

Sean

From gilbertd at bio.indiana.edu  Mon Sep 26 15:35:08 2005
From: gilbertd at bio.indiana.edu (Don Gilbert)
Date: Tue Sep 27 08:13:33 2005
Subject: [Bioperl-l] Re: flybase release 4.2 gff
Message-ID: <200509261935.j8QJZ8F17875@cricket.bio.indiana.edu>


Michael,

The GFF  data from flybase is version 3 format, and at a quick look
the current 4.2 release is as valid  GFF3 as earlier 4.x releases. I
don't know what version of BioPerl added GFF3 support. I'm using 1.5.x
which will read the flybase release 4 GFF3 ok.

Did you have problems with just this recent dmel 4.2 release?

Though I'm no longer with the flybase project, the data dumper they
are  using is the one I wrote for dumping GMOD Bulkfiles from Chado
databases (and it works for other Chado databases). Find this software
at http://cvs.sourceforge.net/viewcvs.py/gmod/schema/GMODTools/

Sometime this will be packaged as a simpler-to-use Chado data dumper.
If this isn't producing proper GFF3 output, I'll be happy to correct
it.

BTW, I've loaded dmel release 4.1 GFF into GBrowse v1.63
in multiple database adapators for tests.  Find configurations for 
D.melanogaster features in GBrowse at
ftp://eugenes.org/eugenes/gbrowse/conf/gbrowse.conf/
  07.dmel_mysql.conf  == for MySQL database
  06.dmel_bdb.conf    == BerkelyDB database
  10.dmel_lucene.conf == Lucene database 
  05.dmel_lucegene.conf = Lucegene database 
Both of these Lucene adaptors  are as fast or faster than MySQL, and
you can copy the data indices and run locally with minimal setup, along with 
all the other Drosophila species annotations I've put up at
http://insects.eugenes.org/species/maps/
More info at
ftp://eugenes.org/eugenes/gbrowse/lucene-gbrowse-lite.txt

-- Don Gilbert

>From Michael Eisen mbeisen at lbl.gov
> Wed Sep 21 18:00:24 EDT 2005
> 
> Has anyone written a script to convert flybases release 4.2 Drosophila 
> melanogaster annotations to gff suitable for bioperl?


Data from ftp://flybase.net/genomes/dmel/dmel_r4.2_20050909/gff/
##gff-version   3
##sequence-region       2L      1       22407834
#organism       dmel
#source FlyBase Chado DB r4.2.1
#date   20050807
 

$gbl/bin/bp_load_gff.pl --adaptor dbi::mysqlopt --user dgg 
  --dsn 'dbi:mysql:database=dmel_r42_20050909;host=localhost' 
  --create $w/dmel420/gffb/*gff.gz
/bio/argos/flybase/work.local/dmel420/gffb/dmel-2L-r4.2.1.gff.gz: loading...
/bio/argos/flybase/work.local/dmel420/gffb/dmel-2L-r4.2.1.gff.gz: 557362 records loaded

-- d.gilbert--bioinformatics--indiana-u--bloomington-in-47405
-- gilbertd@indiana.edu--http://marmot.bio.indiana.edu/

From golharam at umdnj.edu  Tue Sep 27 08:25:58 2005
From: golharam at umdnj.edu (Ryan Golhar)
Date: Tue Sep 27 09:25:30 2005
Subject: [Bioperl-l] a stupid question
In-Reply-To: <20050927072412.0E3AE10DE11@smtp.sibs.ac.cn>
Message-ID: <001901c5c35e$9e4e2230$2f01a8c0@GOLHARMOBILE1>

I have code that does this for Accession #.  If you have the Accession #
(I assume that's what you mean by GeneID), then  the script will get the
GenBank entry and extract the CDS.  Let me know if that's what you are
looking for, and I'll post it here.

Ryan


-----Original Message-----
From: bioperl-l-bounces@portal.open-bio.org
[mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of xuying
Sent: Tuesday, September 27, 2005 3:20 AM
To: bioperl-l
Subject: [Bioperl-l] a stupid question


Dear All:
        I have a file containing wanted genes' GeneIDs. How can I map
this GeneID to its Fasta sequence (genomic sequence of the gene)?
Although There is position and contig information in the gene2accession
file... Is there any simple way? Thanks!
	

Best Regards!
 				

????????xuying
????????xuying@sibs.ac.cn
??????????2005-09-27

_______________________________________________
Bioperl-l mailing list
Bioperl-l@portal.open-bio.org
http://portal.open-bio.org/mailman/listinfo/bioperl-l

From govind.chandra at bbsrc.ac.uk  Tue Sep 27 11:15:51 2005
From: govind.chandra at bbsrc.ac.uk (Govind Chandra)
Date: Tue Sep 27 11:23:45 2005
Subject: [Bioperl-l] Bio::Tools::SeqStats count_codons
Message-ID: <1127834151.27294.23.camel@pc25231.jic.bbsrc.ac.uk>

The count_codons method in Bio::Tools::SeqStats seems to be case
sensitive. See script below. Is this intended? Or am I doing something
silly.

### script begin ###
use Bio::SeqIO;
use Bio::Seq;
use Bio::Tools::SeqStats;
$seqio=Bio::SeqIO->new('-file' => 'Ssc.fas',
                       '-format' => 'fasta');

$seqobj=$seqio->next_seq();

open(ORFS, ") {
chomp();
($strand, $start, $end, $nt_len, $aa_len)=split(/\s+/, $_);
#print("$strand   $start   $end   $nt_len   $aa_len\n");

if($strand==1) {
$cdsobj=$seqobj->trunc($start, $end);
}
elsif($strand==-1) {
$cdsobj=$seqobj->trunc($start, $end)->revcom();
}

$tseq=uc($cdsobj->seq());  # works
#$tseq=$cdsobj->seq(); # does not work. given and ambiguous count only

$codobj=Bio::Seq->new('-seq' => $tseq,
		      '-alphabet' => 'dna'
		      );

print(">$strand $aa_len\n",$cdsobj->seq(),"\n");

$ss=Bio::Tools::SeqStats->new(-seq => $codobj);

$refcount = $ss->count_codons();

foreach $codon (keys(%$refcount)) {
print("$codon   $refcount->{$codon}\n");
}
}

### script end ###

Cheers

Govind
John Innes Centre
Norwich UK.


From govind.chandra at bbsrc.ac.uk  Tue Sep 27 11:15:51 2005
From: govind.chandra at bbsrc.ac.uk (Govind Chandra)
Date: Tue Sep 27 11:24:40 2005
Subject: [Bioperl-l] Bio::Tools::SeqStats count_codons
Message-ID: <1127834151.27294.23.camel@pc25231.jic.bbsrc.ac.uk>

The count_codons method in Bio::Tools::SeqStats seems to be case
sensitive. See script below. Is this intended? Or am I doing something
silly.

### script begin ###
use Bio::SeqIO;
use Bio::Seq;
use Bio::Tools::SeqStats;
$seqio=Bio::SeqIO->new('-file' => 'Ssc.fas',
                       '-format' => 'fasta');

$seqobj=$seqio->next_seq();

open(ORFS, ") {
chomp();
($strand, $start, $end, $nt_len, $aa_len)=split(/\s+/, $_);
#print("$strand   $start   $end   $nt_len   $aa_len\n");

if($strand==1) {
$cdsobj=$seqobj->trunc($start, $end);
}
elsif($strand==-1) {
$cdsobj=$seqobj->trunc($start, $end)->revcom();
}

$tseq=uc($cdsobj->seq());  # works
#$tseq=$cdsobj->seq(); # does not work. given and ambiguous count only

$codobj=Bio::Seq->new('-seq' => $tseq,
		      '-alphabet' => 'dna'
		      );

print(">$strand $aa_len\n",$cdsobj->seq(),"\n");

$ss=Bio::Tools::SeqStats->new(-seq => $codobj);

$refcount = $ss->count_codons();

foreach $codon (keys(%$refcount)) {
print("$codon   $refcount->{$codon}\n");
}
}

### script end ###

Cheers

Govind
John Innes Centre
Norwich UK.


From jsun at utdallas.edu  Tue Sep 27 13:09:28 2005
From: jsun at utdallas.edu (Sun, Jian)
Date: Tue Sep 27 13:31:42 2005
Subject: [Bioperl-l] from protein gi number to CDS seqs.
Message-ID: 

Dear all, I got some reference code from this board as attached below to get the CDS sequence from protein gi number. But for most of my protein gi #, I got the erroe message. Could you please help me to point out what's the problem is?
 
Thanks in advance.
Jian Sun
 
The codes I got from the bBioperl Board are :
 
#!C:\Perl\bin\perl.exe
use lib "C:\Perl\lib";
use strict;
use Bio::DB::GenBank;
use Bio::DB::GenPept;
use Bio::DB::FileCache;
use Bio::Factory::FTLocationFactory;
use Bio::SeqFeature::Generic;
 
my $ntdb = new Bio::DB::GenBank;
my $pepdb= new Bio::DB::GenPept;
 
# do some caching in the event you're pulling up the same
# chromosome and/or you are debugging
my $cachent = new Bio::DB::FileCache(-kept => 1,
                                    -file => './tmp/nt.idx',
                                    -seqdb => $ntdb);
 
my $cachepep = new Bio::DB::FileCache(-kept => 1,
                                     -file => './tmp/pep.idx',
                                     -seqdb => $pepdb);
 
# obj to turn strings into Bio::Location object
my $locfactory = new Bio::Factory::FTLocationFactory;
 
# you might get these from a file (and they can be accessions too)
# protein gi number (10956263)
my @protgis = (23172508);  
 
foreach my $gi ( @protgis ) {    #id
  my $protseq = $cachepep->get_Seq_by_id($gi);
  if( ! $protseq ) { print STDERR "could not find a seq for gi:$gi\n";
                    next;
                   }
  foreach my $cds (  grep { $_->primary_tag eq 'CDS' }
                          $protseq->get_SeqFeatures() )
  {
     next unless( $cds->has_tag('coded_by') ); # skip CDSes with no coded_by
     my ($codedby) = $cds->each_tag_value('coded_by');
     my ($ntacc,$loc) = split(/\:/, $codedby);
     $ntacc =~ s/(\.\d+)//; # genbank wants an accession not a versioned one
     my $cdslocation = $locfactory->from_string($loc);
     my $cdsfeature = new Bio::SeqFeature::Generic(-location => $cdslocation);
     my $ntseq = $cachent->get_Seq_by_acc($ntacc);
     next unless $ntseq;
     $ntseq->add_SeqFeature($cdsfeature); # locate the feature on a seq
     my $cdsseq = $cdsfeature->spliced_seq();
     print "cds seq is : \n", $cdsseq->seq(), "\n";
     my $startP = (109-1) * 3 + 1;
     my $endP = (116-1) * 3 + 1 ;
     my $mypiece = $cdsseq->subseq($startP,$endP);
     print "\n my seq. piece is: ", $mypiece;
 }
}
******************************************************************
And the error message I got is:
 

----------EXCEPTION-------------------------------

MSG: acc does not exist

STACK BIO::DB::WebDBSeqI::get_Seq_by acc  C:/perl/site/Lib/Bio/DB/WebDBSeqI.pm :176.

STACK BIO::DB::WebDBSeqI::get_Seq_by acc  C:/perl/site/Lib/Bio/DB/WebDBSeqI.pm :170.

 

 --------------------------------------

 

 

From pleo at mail.nih.gov  Tue Sep 27 13:19:15 2005
From: pleo at mail.nih.gov (Leo, Paul (NIH/NHGRI))
Date: Tue Sep 27 13:34:16 2005
Subject: [Bioperl-l] a stupid question
Message-ID: 

The species specific gene cross ref files ipi.gene.*.xrefs  (tab delimited)
which you can get from
http://www.ebi.ac.uk/IPI/geneXrefs.html
Relate the gene to refseq accession(s)  (and many more) and hold some gene
location info. Perhaps this might give you the some of the info you require.

Cheers
PAul


Paul Leo
NHGRI/NIH

-----Original Message-----
From: Davis, Sean (NIH/NHGRI) 
Sent: Tuesday, September 27, 2005 6:37 AM
To: xuying; Bioperl
Subject: Re: [Bioperl-l] a stupid question

On 9/27/05 3:20 AM, "xuying"  wrote:

> Dear All:
>       I have a file containing wanted genes' GeneIDs. How can I map this
> GeneID to its Fasta sequence (genomic sequence of the gene)? Although
There is
> position and contig information in the gene2accession file... Is there any
> simple way? Thanks!

You truly want the genomic sequence for a given gene, or do you want the
spliced transcript?  The spliced transcripts are called refseqs in NCBI
parlance and there may be zero to many refseqs for each Gene ID.  There are
a number of ways to get the refseq sequences.  You can use NCBI ftp to get
the mRNA for them, or you can use Ensembl or UCSC to get the genomic
versions of them (the spliced genomic sequence).  If you truly want the
"locus" associated with a given Gene ID, I don't know where that information
is stored in an easily-retrievable, standardized place, but Stefan may be
able to tell you how to get it from the ASN1 files from NCBI.  (Stefan?)

Sean

_______________________________________________
Bioperl-l mailing list
Bioperl-l@portal.open-bio.org
http://portal.open-bio.org/mailman/listinfo/bioperl-l
From hartzell at kestrel.alerce.com  Tue Sep 27 13:48:31 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Tue Sep 27 13:48:18 2005
Subject: [Bioperl-l] What's DrawGram.t supposed to do?
Message-ID: <17209.34287.832209.174956@satchel.alerce.com>


I'm updating the freebsd bioperl ports to match the 1.5.1 release
candidates.

I'm working my way through the bioperl run tests.

Drawgram.t doesn't pass unless I do just the right thing when the
preview window pops up, which is troubling because the code seems to
be striving to avoid a preview window.

The arguments that Drawgram.t feeds to drawgram strike me as odd.
It sends a tree file and a font file, which makes sense.

Then it sends an "L", which says we want to change the angle of the
labels.

Then it sends an "N", while the program is looking for a number "from
90 to 0"

Now, "N" doesn't seem to kill anything, one just ends up back at the
main menu.

Then the "Y" fires off a preview, and if one tells the preview window
to "plot", then the tests work.  If one just tells it to 'quit', then
the bioperl code throws an exception and the test gets ugly.

But, I think that the _setparams method is broken.

I think that the sequence should end up being (w/out the comments) :

  treefile
  fontfile
  P # to set the plotting device
  L # to select postscript output
  V # to select the previewing device
  N # to disable previewing
  Y # to plot the plot.

If that makes sense, the _setparams needs to be touched up, here's a
patch:

*** Bio/Tools/Run/Phylo/Phylip/DrawGram.pm.orig	Tue Sep 27 10:41:18 2005
--- Bio/Tools/Run/Phylo/Phylip/DrawGram.pm	Tue Sep 27 10:43:27 2005
***************
*** 341,347 ****
  	$attr = uc($attr);
  	next unless (defined $value);
! 	if ($attr eq 'PLOTTER' ||
! 	    $attr eq 'SCREEN' ) {
! 	    # take first char of the input
  	    $param_string .= uc(substr($value,0,1))."\n";
  	    next;
--- 341,351 ----
  	$attr = uc($attr);
  	next unless (defined $value);
! 	if ($attr eq 'PLOTTER') {
! 	    $param_string .= "P\n";
! 	    $param_string .= uc(substr($value,0,1))."\n";
! 	    next;
! 	}
! 	if ($attr eq 'SCREEN' ) {
! 	    $param_string .= "V\n";
  	    $param_string .= uc(substr($value,0,1))."\n";
  	    next;

With this patch applied, I pass the test w/out having to respond to a
window.

I'm using drawgram 3.63, from phylip-3.6, built from ports on FreeBSD
5.4-STABLE.

Is this a current release, or am I working with something that's
foobar'ed?

g.
From brian_osborne at cognia.com  Tue Sep 27 15:45:44 2005
From: brian_osborne at cognia.com (Brian Osborne)
Date: Tue Sep 27 15:51:31 2005
Subject: [Bioperl-l] from protein gi number to CDS seqs.
In-Reply-To: 
Message-ID: 

Jian,

There's a simpler example in the FAQ
(http://bioperl.org/Core/Latest/faq.html#Q5.4), I suggest you use that
because the use of FileCache may be part of the problem, it is on my machine
anyway (I don't think the module, or Storable, is capable of creating a
directory that doesn't exist). Also, make sure that the GI is for a protein,
the GI in the code below is for a nucleotide sequence.

Brian O.


On 9/27/05 1:09 PM, "Sun, Jian"  wrote:

> Dear all, I got some reference code from this board as attached below to get
> the CDS sequence from protein gi number. But for most of my protein gi #, I
> got the erroe message. Could you please help me to point out what's the
> problem is?
>  
> Thanks in advance.
> Jian Sun
>  
> The codes I got from the bBioperl Board are :
>  
> #!C:\Perl\bin\perl.exe
> use lib "C:\Perl\lib";
> use strict;
> use Bio::DB::GenBank;
> use Bio::DB::GenPept;
> use Bio::DB::FileCache;
> use Bio::Factory::FTLocationFactory;
> use Bio::SeqFeature::Generic;
>  
> my $ntdb = new Bio::DB::GenBank;
> my $pepdb= new Bio::DB::GenPept;
>  
> # do some caching in the event you're pulling up the same
> # chromosome and/or you are debugging
> my $cachent = new Bio::DB::FileCache(-kept => 1,
>                                     -file => './tmp/nt.idx',
>                                     -seqdb => $ntdb);
>  
> my $cachepep = new Bio::DB::FileCache(-kept => 1,
>                                      -file => './tmp/pep.idx',
>                                      -seqdb => $pepdb);
>  
> # obj to turn strings into Bio::Location object
> my $locfactory = new Bio::Factory::FTLocationFactory;
>  
> # you might get these from a file (and they can be accessions too)
> # protein gi number (10956263)
> my @protgis = (23172508);
>  
> foreach my $gi ( @protgis ) {    #id
>   my $protseq = $cachepep->get_Seq_by_id($gi);
>   if( ! $protseq ) { print STDERR "could not find a seq for gi:$gi\n";
>                     next;
>                    }
>   foreach my $cds (  grep { $_->primary_tag eq 'CDS' }
>                           $protseq->get_SeqFeatures() )
>   {
>      next unless( $cds->has_tag('coded_by') ); # skip CDSes with no coded_by
>      my ($codedby) = $cds->each_tag_value('coded_by');
>      my ($ntacc,$loc) = split(/\:/, $codedby);
>      $ntacc =~ s/(\.\d+)//; # genbank wants an accession not a versioned one
>      my $cdslocation = $locfactory->from_string($loc);
>      my $cdsfeature = new Bio::SeqFeature::Generic(-location => $cdslocation);
>      my $ntseq = $cachent->get_Seq_by_acc($ntacc);
>      next unless $ntseq;
>      $ntseq->add_SeqFeature($cdsfeature); # locate the feature on a seq
>      my $cdsseq = $cdsfeature->spliced_seq();
>      print "cds seq is : \n", $cdsseq->seq(), "\n";
>      my $startP = (109-1) * 3 + 1;
>      my $endP = (116-1) * 3 + 1 ;
>      my $mypiece = $cdsseq->subseq($startP,$endP);
>      print "\n my seq. piece is: ", $mypiece;
>  }
> }
> ******************************************************************
> And the error message I got is:
>  
> 
> ----------EXCEPTION-------------------------------
> 
> MSG: acc does not exist
> 
> STACK BIO::DB::WebDBSeqI::get_Seq_by acc  C:/perl/site/Lib/Bio/DB/WebDBSeqI.pm
> :176.
> 
> STACK BIO::DB::WebDBSeqI::get_Seq_by acc  C:/perl/site/Lib/Bio/DB/WebDBSeqI.pm
> :170.
> 
>  
> 
>  --------------------------------------
> 
>  
> 
>  
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l


From hartzell at kestrel.alerce.com  Tue Sep 27 15:56:17 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Tue Sep 27 15:56:07 2005
Subject: [Bioperl-l] sanity check an update the bioperl-run's t/ProtDist.t
Message-ID: <17209.41953.896669.89682@satchel.alerce.com>


I'm wrenching on some of the rc2 bioperl-run code, touching it up to
work better with Phylip 3.6.

After tuning up PhylipConf.pm, I'm getting this for one of the tests:

  # Test 9 got: "0.277077" (t/ProtDist.t at line 98)
  #   Expected: "0.27708"
  #  t/ProtDist.t line 98 is: ok($matrix->get_entry('ENSP000003','SINFRUP001'),0.27708);
  
I'm inclined to excuse the difference as my perl providing another
digit's worth of detail (accuracy? ;)).

Do folks agree, or is there something else going on?

g.

From hartzell at kestrel.alerce.com  Tue Sep 27 17:00:40 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Tue Sep 27 17:00:32 2005
Subject: [Bioperl-l] pointer to pseudowise ?
Message-ID: <17209.45816.939324.983892@satchel.alerce.com>


bioperl-run has support for pseudowise, but I can't find it.  It
doesn't seem to be in the wise2.20, 2.1.23c, or 2.1.16b distributions.

Anyone know what's up?

g.
From hartzell at kestrel.alerce.com  Tue Sep 27 17:47:28 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Tue Sep 27 17:47:25 2005
Subject: [Bioperl-l] What version of EMBOSS should bioperl-run work with?
Message-ID: <17209.48624.466406.712127@satchel.alerce.com>


The EMBOSS support in bioperl-run seems to be version specific.

The Freebsd ports tree uses 2.10.0, which doesn't seem to sync. up
with the test code very well.

I see that there's a 3.0.0 that was released July 15, 2005 on
emboss.sourceforge.net/emboss.open-bio.org.  Would that be more
appropriate?

thanks,

g.
From jason.stajich at duke.edu  Tue Sep 27 21:09:19 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Tue Sep 27 21:08:20 2005
Subject: [Bioperl-l] What version of EMBOSS should bioperl-run work with?
In-Reply-To: <17209.48624.466406.712127@satchel.alerce.com>
References: <17209.48624.466406.712127@satchel.alerce.com>
Message-ID: <95DE0984-04D6-445D-B7AE-67CBFB28B9DD@duke.edu>

I tested it in 2.8.0 and 3.0.0 - I just added the support but I think  
that was post rc2 - maybe double check the problem exists in CVS code  
first?
-jason
On Sep 27, 2005, at 5:47 PM, George Hartzell wrote:

>
> The EMBOSS support in bioperl-run seems to be version specific.
>
> The Freebsd ports tree uses 2.10.0, which doesn't seem to sync. up
> with the test code very well.
>
> I see that there's a 3.0.0 that was released July 15, 2005 on
> emboss.sourceforge.net/emboss.open-bio.org.  Would that be more
> appropriate?
>
> thanks,
>
> g.
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From bmoore at genetics.utah.edu  Wed Sep 28 00:23:21 2005
From: bmoore at genetics.utah.edu (Barry Moore)
Date: Wed Sep 28 00:20:44 2005
Subject: [Bioperl-l] a stupid question
Message-ID: 

Depends on what your Gene IDs are.  If they are IDs to contigs or
bacterial genomes or something like that and you want fasta sequence
then just past a comma separated list of them into Entrez and Bob's your
uncle.  If your sequences are for cDNA, EST then use UCSC's Table
Browser to pull the equivalent sequences off the genome for you.

Barry

-----Original Message-----
From: bioperl-l-bounces@portal.open-bio.org
[mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Sean Davis
Sent: Tuesday, September 27, 2005 4:37 AM
To: xuying; Bioperl
Subject: Re: [Bioperl-l] a stupid question

On 9/27/05 3:20 AM, "xuying"  wrote:

> Dear All:
>       I have a file containing wanted genes' GeneIDs. How can I map
this
> GeneID to its Fasta sequence (genomic sequence of the gene)? Although
There is
> position and contig information in the gene2accession file... Is there
any
> simple way? Thanks!

You truly want the genomic sequence for a given gene, or do you want the
spliced transcript?  The spliced transcripts are called refseqs in NCBI
parlance and there may be zero to many refseqs for each Gene ID.  There
are
a number of ways to get the refseq sequences.  You can use NCBI ftp to
get
the mRNA for them, or you can use Ensembl or UCSC to get the genomic
versions of them (the spliced genomic sequence).  If you truly want the
"locus" associated with a given Gene ID, I don't know where that
information
is stored in an easily-retrievable, standardized place, but Stefan may
be
able to tell you how to get it from the ASN1 files from NCBI.  (Stefan?)

Sean

_______________________________________________
Bioperl-l mailing list
Bioperl-l@portal.open-bio.org
http://portal.open-bio.org/mailman/listinfo/bioperl-l

From birney at ebi.ac.uk  Wed Sep 28 09:03:21 2005
From: birney at ebi.ac.uk (Ewan Birney)
Date: Wed Sep 28 09:20:00 2005
Subject: [Bioperl-l] pointer to pseudowise ?
In-Reply-To: <17209.45816.939324.983892@satchel.alerce.com>
References: <17209.45816.939324.983892@satchel.alerce.com>
Message-ID: <433A9499.4050205@ebi.ac.uk>



George Hartzell wrote:
> bioperl-run has support for pseudowise, but I can't find it.  It
> doesn't seem to be in the wise2.20, 2.1.23c, or 2.1.16b distributions.
> 
> Anyone know what's up?
> 

:) it is in the 2.2.3-rc7 release which has not made the light of day
for the last 1.5 years. you know who you can blame :)


you can pick it up at


http://www.sanger.ac.uk/Users/birney/wise2.2.3-rc7.tar.gz


I need to make a .4 release before the end of 2005. Fingers crossed.


> g.
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
From fernan at iib.unsam.edu.ar  Wed Sep 28 10:50:58 2005
From: fernan at iib.unsam.edu.ar (Fernan Aguero)
Date: Wed Sep 28 11:15:11 2005
Subject: [Bioperl-l] What version of EMBOSS should bioperl-run work with?
In-Reply-To: <17209.48624.466406.712127@satchel.alerce.com>
References: <17209.48624.466406.712127@satchel.alerce.com>
Message-ID: <20050928145058.GR27409@iib.unsam.edu.ar>

+----[ George Hartzell  (27.Sep.2005 19:01):
| 
| The EMBOSS support in bioperl-run seems to be version specific.
| 
| The Freebsd ports tree uses 2.10.0, which doesn't seem to sync. up
| with the test code very well.
| 
| I see that there's a 3.0.0 that was released July 15, 2005 on
| emboss.sourceforge.net/emboss.open-bio.org.  Would that be more
| appropriate?
| 
| thanks,
| 
| g.
|
+----]

George,

the EMBOSS FreeBSD port would be updated to 3.0.0 soon. The
delay in the update was caused by:

i) we have to updated the biology/EMBASSY port as they need
to be in sync and,
ii) we wanted to use this opportunity to make EMBOSS install
to a different PREFIX, because right now it is conflicting
with a number of other ports that install executables with
the same name

Fernan, 
using my hat of maintainer of the FreeBSD emboss and bioperl ports :)

PS: I haven't started work on the update of the bioperl port
to 1.5.1, as I'm waiting for a final release, so perhaps the
best path would be to sync the updates of the bioperl and
EMBOSS ports. Since you've already tested the latest bioperl
RCs on FreeBSD, maybe you can help with this? Do you have
experience with ports?

From heikki at ebi.ac.uk  Wed Sep 28 11:22:24 2005
From: heikki at ebi.ac.uk (Heikki Lehvaslaiho)
Date: Wed Sep 28 11:22:10 2005
Subject: [Bioperl-l] Bio::Tools::SeqStats count_codons
In-Reply-To: <1127834151.27294.23.camel@pc25231.jic.bbsrc.ac.uk>
References: <1127834151.27294.23.camel@pc25231.jic.bbsrc.ac.uk>
Message-ID: <200509281622.25111.heikki@ebi.ac.uk>


Govind,

Not having your data files, I truncated your code down to essentials:

#=============================================
use Bio::Seq;
use Bio::Tools::SeqStats;

$tseq = "atcgatgctagcwgcatgcatgctagwctag";
#$tseq = "ATCGATGCTAGCWGCATGCATGCTAGWCTAG";

$codobj=Bio::Seq->new('-seq' => $tseq,
        '-alphabet' => 'dna'
        );
$ss=Bio::Tools::SeqStats->new(-seq => $codobj);
$refcount = $ss->count_codons();

foreach $codon (sort keys(%$refcount)) {
    print("$codon   $refcount->{$codon}\n");
}
#================================================


I understand that you get different results depending case. Try this with both 
$tseq values. I get a warning and same number of codons in both cases 
(ignoring the case). Do you?

 -Heikki

On Tuesday 27 September 2005 16:15, Govind Chandra wrote:
> The count_codons method in Bio::Tools::SeqStats seems to be case
> sensitive. See script below. Is this intended? Or am I doing something
> silly.
>
> ### script begin ###
> use Bio::SeqIO;
> use Bio::Seq;
> use Bio::Tools::SeqStats;
> $seqio=Bio::SeqIO->new('-file' => 'Ssc.fas',
>                        '-format' => 'fasta');
>
> $seqobj=$seqio->next_seq();
>
> open(ORFS, "
> while() {
> chomp();
> ($strand, $start, $end, $nt_len, $aa_len)=split(/\s+/, $_);
> #print("$strand   $start   $end   $nt_len   $aa_len\n");
>
> if($strand==1) {
> $cdsobj=$seqobj->trunc($start, $end);
> }
> elsif($strand==-1) {
> $cdsobj=$seqobj->trunc($start, $end)->revcom();
> }
>
> $tseq=uc($cdsobj->seq());  # works
> #$tseq=$cdsobj->seq(); # does not work. given and ambiguous count only
>
> $codobj=Bio::Seq->new('-seq' => $tseq,
>         '-alphabet' => 'dna'
>         );
>
> print(">$strand $aa_len\n",$cdsobj->seq(),"\n");
>
> $ss=Bio::Tools::SeqStats->new(-seq => $codobj);
>
> $refcount = $ss->count_codons();
>
> foreach $codon (keys(%$refcount)) {
> print("$codon   $refcount->{$codon}\n");
> }
> }
>
> ### script end ###
>
> Cheers
>
> Govind
> John Innes Centre
> Norwich UK.
>
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l

-- 
______ _/      _/_____________________________________________________
      _/      _/                      http://www.ebi.ac.uk/mutations/
     _/  _/  _/  Heikki Lehvaslaiho    heikki at_ebi _ac _uk
    _/_/_/_/_/  EMBL Outstation, European Bioinformatics Institute
   _/  _/  _/  Wellcome Trust Genome Campus, Hinxton
  _/  _/  _/  Cambridge, CB10 1SD, United Kingdom
     _/      Phone: +44 (0)1223 494 644   FAX: +44 (0)1223 494 468
___ _/_/_/_/_/________________________________________________________
From hartzell at kestrel.alerce.com  Wed Sep 28 12:13:52 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Wed Sep 28 12:14:23 2005
Subject: [Bioperl-l] What version of EMBOSS should bioperl-run work with?
In-Reply-To: <20050928145058.GR27409@iib.unsam.edu.ar>
References: <17209.48624.466406.712127@satchel.alerce.com>
	<20050928145058.GR27409@iib.unsam.edu.ar>
Message-ID: <17210.49473.11658.213763@satchel.alerce.com>

Fernan Aguero writes:
 > [...]
 > Fernan, 
 > using my hat of maintainer of the FreeBSD emboss and bioperl ports :)
 > 
 > PS: I haven't started work on the update of the bioperl port
 > to 1.5.1, as I'm waiting for a final release, so perhaps the
 > best path would be to sync the updates of the bioperl and
 > EMBOSS ports. Since you've already tested the latest bioperl
 > RCs on FreeBSD, maybe you can help with this? Do you have
 > experience with ports?
 > [...]

Yep,

I have ports for p5-bioperl-devel (based on 1.5.1-rc1) and
p5-bioperl-run (based on rc2, but will be looking at some stuff that
Jason's checked into HEAD).

I'll send them your way once I've ironed out some wrinkles.

g.
From brian_osborne at cognia.com  Wed Sep 28 16:46:56 2005
From: brian_osborne at cognia.com (Brian Osborne)
Date: Wed Sep 28 16:46:56 2005
Subject: [Bioperl-l] FW: Bioperl question - please help!!!
In-Reply-To: <259a224c05092813457a7f8ed5@mail.gmail.com>
Message-ID: 


------ Forwarded Message
From: Olena Morozova 
Reply-To: Olena Morozova 
Date: Wed, 28 Sep 2005 16:45:30 -0400
To: , Brian Osborne , Heikki
Lehvaslaiho 
Subject: Bioperl question - please help!!!

Hello,

Could you please help me out with the following: I have GeneIDs and
gene names of sequences from the Entrez Gene database, and I need to
retrieve the corresponding coding sequences from RefSeq. I have tried
using Bio::DB::GenBank to get the accession numbers, which I could
then use to retrieve the sequences from RefSeq, but apparently Entrez
Gene GIs are not the same as GenBank GIs and I am getting sequences of
totally different genes by this method. I would really appreciate any
comments or suggestions.

Thank you very much
Best Regards, Olena

------ End of Forwarded Message


From hartzell at kestrel.alerce.com  Wed Sep 28 18:24:51 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Wed Sep 28 18:24:47 2005
Subject: [Bioperl-l] Yet another 'what version's supposed to work?' question?
Message-ID: <17211.6195.912170.888632@satchel.alerce.com>


I'm digging into bioperl-run on FreeBSD.

I've built a port for exonerate-1.0.0, and it passes all of it's tests
(but not with --enable-assertions, I've asked Guy about that...).

t/Exonerate.t blows up all over the place, but I think that the
problem is that the cDNA<->genomic alignments that are coming back
aren't quite what the test expect to see.  They seem reasonable
though, leading and/or trailing hsp's seem to have been broken into
smaller parts.

Sim4 gives answers that generally agree with both the test expected
and the calculated data.

Actually, looking at the exonerate text output and what I'm seeing in
the perl debugger, it looks like some part of the current bioperl
parser is treating this:

    4 : GTTGTGCT-GGGGGGGTCCGCGCGCCCTGCAGTCCCGAACCCGCTACGCGCTCCGTCGGCCC :   64
        |||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||
   29 : GTTGTGCTGGGGGGGGTCCGCGCGCCCTGCAGTCCCGAACCCGCTACGCGCTCCGTCGGCCC :   90

As two hsps, one from 4->11/29->36, then 12->/38->....  The exonerate
expected data expects it as a single HSP.

Does anyone out there have any experience with the exonerate and how
well it works?

g.

From jason.stajich at duke.edu  Wed Sep 28 18:42:14 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Wed Sep 28 18:41:20 2005
Subject: [Bioperl-l] Yet another 'what version's supposed to work?'
	question?
In-Reply-To: <17211.6195.912170.888632@satchel.alerce.com>
References: <17211.6195.912170.888632@satchel.alerce.com>
Message-ID: 

Exonerate works fine, I don't think this is the problem  The tests  
pass for me on exonerate 1.0.0 and with the latest code in CVS -- I  
spent more than a few hours on this on Monday so you need to make  
sure you've got .

$ exonerate --version
exonerate from exonerate version 1.0.0
Using glib version 1.2.10
Built on May  4 2005
Branch: unnamed branch

[jes12@head2 run]$ make test_Exonerate
PERL_DL_NONLAZY=1 /usr/bin/perl -Iblib/arch -Iblib/lib -I/usr/lib/ 
perl5/5.8.0/i386-linux-thread-multi -I/usr/lib/perl5/5.8.0 -e 'use  
Test::Harness qw(&runtests $verbose); $verbose=0; runtests @ARGV;' t/ 
Exonerate.t
t/Exonerate....ok
All tests successful.

Please be sure you have the latest code from CVS for both bioperl- 
live and bioperl-run, I checked in changes to Bio/SearchIO/ 
exonerate.pm so that it properly parses VULGAR and CIGAR.  So  
bioperl-1.5.1-RC1 is

You may want to subscribe to bioperl-guts-l to see the changes as  
they come in if you are going to be working on the bleeding edge/ 
fixing bugs that other folks are working on too.

If you are wanting verify things, run exonerate with --showtargetgff  
yes --showquerygff yes
and you'll see GFF (although note that reverse strand features will  
be in reverse coordinates, see posts to the mailiing list about this)


-jason
On Sep 28, 2005, at 6:24 PM, George Hartzell wrote:

>
> I'm digging into bioperl-run on FreeBSD.
>
> I've built a port for exonerate-1.0.0, and it passes all of it's tests
> (but not with --enable-assertions, I've asked Guy about that...).
>
> t/Exonerate.t blows up all over the place, but I think that the
> problem is that the cDNA<->genomic alignments that are coming back
> aren't quite what the test expect to see.  They seem reasonable
> though, leading and/or trailing hsp's seem to have been broken into
> smaller parts.
>
> Sim4 gives answers that generally agree with both the test expected
> and the calculated data.
>
> Actually, looking at the exonerate text output and what I'm seeing in
> the perl debugger, it looks like some part of the current bioperl
> parser is treating this:
>
>     4 : GTTGTGCT- 
> GGGGGGGTCCGCGCGCCCTGCAGTCCCGAACCCGCTACGCGCTCCGTCGGCCC :   64
>         |||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||
>    29 :  
> GTTGTGCTGGGGGGGGTCCGCGCGCCCTGCAGTCCCGAACCCGCTACGCGCTCCGTCGGCCC :   90
>
> As two hsps, one from 4->11/29->36, then 12->/38->....  The exonerate
> expected data expects it as a single HSP.
>
> Does anyone out there have any experience with the exonerate and how
> well it works?
>
> g.
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From heikki.lehvaslaiho at gmail.com  Thu Sep 29 03:31:32 2005
From: heikki.lehvaslaiho at gmail.com (Heikki Lehvaslaiho)
Date: Thu Sep 29 06:24:17 2005
Subject: [Bioperl-l] Bio::Tools::SeqStats count_codons
In-Reply-To: <200509281622.25111.heikki@ebi.ac.uk>
References: <1127834151.27294.23.camel@pc25231.jic.bbsrc.ac.uk>
	<200509281622.25111.heikki@ebi.ac.uk>
Message-ID: <200509290831.32654.heikki.lehvaslaiho@gmail.com>


With further feedback from Govind, the count_codons() method is now fixed. The 
main problem was that codon counting was case sensitive. All codons are now 
canonised to upper case. Also, you can now set the verbosity level to 
sub-zero to suppress the warning about ambiguous characters.

 -Heikki

On Wednesday 28 September 2005 16:22, Heikki Lehvaslaiho wrote:
> Govind,
>
> Not having your data files, I truncated your code down to essentials:
>
> #=============================================
> use Bio::Seq;
> use Bio::Tools::SeqStats;
>
> $tseq = "atcgatgctagcwgcatgcatgctagwctag";
> #$tseq = "ATCGATGCTAGCWGCATGCATGCTAGWCTAG";
>
> $codobj=Bio::Seq->new('-seq' => $tseq,
>         '-alphabet' => 'dna'
>         );
> $ss=Bio::Tools::SeqStats->new(-seq => $codobj);
> $refcount = $ss->count_codons();
>
> foreach $codon (sort keys(%$refcount)) {
>     print("$codon   $refcount->{$codon}\n");
> }
> #================================================
>
>
> I understand that you get different results depending case. Try this with
> both $tseq values. I get a warning and same number of codons in both cases
> (ignoring the case). Do you?
>
>  -Heikki
>
> On Tuesday 27 September 2005 16:15, Govind Chandra wrote:
> > The count_codons method in Bio::Tools::SeqStats seems to be case
> > sensitive. See script below. Is this intended? Or am I doing something
> > silly.
> >
> > ### script begin ###
> > use Bio::SeqIO;
> > use Bio::Seq;
> > use Bio::Tools::SeqStats;
> > $seqio=Bio::SeqIO->new('-file' => 'Ssc.fas',
> >                        '-format' => 'fasta');
> >
> > $seqobj=$seqio->next_seq();
> >
> > open(ORFS, " >
> > while() {
> > chomp();
> > ($strand, $start, $end, $nt_len, $aa_len)=split(/\s+/, $_);
> > #print("$strand   $start   $end   $nt_len   $aa_len\n");
> >
> > if($strand==1) {
> > $cdsobj=$seqobj->trunc($start, $end);
> > }
> > elsif($strand==-1) {
> > $cdsobj=$seqobj->trunc($start, $end)->revcom();
> > }
> >
> > $tseq=uc($cdsobj->seq());  # works
> > #$tseq=$cdsobj->seq(); # does not work. given and ambiguous count only
> >
> > $codobj=Bio::Seq->new('-seq' => $tseq,
> >         '-alphabet' => 'dna'
> >         );
> >
> > print(">$strand $aa_len\n",$cdsobj->seq(),"\n");
> >
> > $ss=Bio::Tools::SeqStats->new(-seq => $codobj);
> >
> > $refcount = $ss->count_codons();
> >
> > foreach $codon (keys(%$refcount)) {
> > print("$codon   $refcount->{$codon}\n");
> > }
> > }
> >
> > ### script end ###
> >
> > Cheers
> >
> > Govind
> > John Innes Centre
> > Norwich UK.
> >
> >
> > _______________________________________________
> > Bioperl-l mailing list
> > Bioperl-l@portal.open-bio.org
> > http://portal.open-bio.org/mailman/listinfo/bioperl-l

-- 
______ _/      _/_____________________________________________________
      _/      _/                      http://www.ebi.ac.uk/mutations/
     _/  _/  _/  Heikki Lehvaslaiho    heikki at_ebi _ac _uk
    _/_/_/_/_/  EMBL Outstation, European Bioinformatics Institute
   _/  _/  _/  Wellcome Trust Genome Campus, Hinxton
  _/  _/  _/  Cambridge, CB10 1SD, United Kingdom
     _/      Phone: +44 (0)1223 494 644   FAX: +44 (0)1223 494 468
___ _/_/_/_/_/________________________________________________________
From xuying at sibs.ac.cn  Wed Sep 28 00:06:25 2005
From: xuying at sibs.ac.cn (xuying)
Date: Thu Sep 29 09:25:21 2005
Subject: [Bioperl-l] a stupid question
Message-ID: <20050928041026.72B6D10DE19@smtp.sibs.ac.cn>

Hi Rayn:
I have many files containing GeneIDs (entrezgene uid) such as the attached file. And I want to extract the full gene sequence from NCBI, not just CDS. But you script should be helpful. Would you like to share your code here? Thanks! 

	

======= 2005-09-27 20:25:58 ÄúÔÚÀ´ÐÅÖÐдµÀ£º=======

>I have code that does this for Accession #.  If you have the Accession #
>(I assume that's what you mean by GeneID), then  the script will get the
>GenBank entry and extract the CDS.  Let me know if that's what you are
>looking for, and I'll post it here.
>
>Ryan
>
>
>-----Original Message-----
>From: bioperl-l-bounces@portal.open-bio.org
>[mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of xuying
>Sent: Tuesday, September 27, 2005 3:20 AM
>To: bioperl-l
>Subject: [Bioperl-l] a stupid question
>
>
>Dear All:
>        I have a file containing wanted genes' GeneIDs. How can I map
>this GeneID to its Fasta sequence (genomic sequence of the gene)?
>Although There is position and contig information in the gene2accession
>file... Is there any simple way? Thanks!
>	
>
>Best Regards!
> 				
>
>¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡xuying
>¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡xuying@sibs.ac.cn
>¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡2005-09-27
>
>_______________________________________________
>Bioperl-l mailing list
>Bioperl-l@portal.open-bio.org
>http://portal.open-bio.org/mailman/listinfo/bioperl-l
>
>
>

= = = = = = = = = = = = = = = = = = = =
			

¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡ÖÂ
Àñ£¡
 
				 
¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡xuying
¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡xuying@sibs.ac.cn
¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡2005-09-28

-------------- next part --------------
A non-text attachment was scrubbed...
Name: Embryonic_Stem_Cell.out
Type: application/octet-stream
Size: 280 bytes
Desc: not available
Url : http://portal.open-bio.org/pipermail/bioperl-l/attachments/20050928/e7c689aa/Embryonic_Stem_Cell.obj
From kgb11 at psu.edu  Wed Sep 28 15:38:21 2005
From: kgb11 at psu.edu (Kevin Beckmann)
Date: Thu Sep 29 09:25:24 2005
Subject: [Bioperl-l] remove_Node leaves parenthesis after deleting internal
	leaf
Message-ID: <200509281938.PAA04120@webmail7.cac.psu.edu>

This bug is listed as Bug 1870 under Bugzilla:

I've come across a bug in TreeIO:
Using this as a model tree (file is named "model_tree.phy"):
(Arabidopsis,(BNGI,(PPLGI,(csa,(GMGI,MTGI)))));

I run this script:

#!/usr/bin/perl -w
### remove_Node_bug.pl ###
# Created: Wed Sep 28 13:10:00 EDT 2005
# creator- Kevin Beckmann

use strict;
use Bio::TreeIO;

my $file = "model_tree.phy";

my $treein = new Bio::TreeIO(-file => $file, -format => "newick");
my $tree = $treein->next_tree();
my $treestart = new Bio::TreeIO(-format => 'tabtree');
print "Starting tree:\n";
$treestart->write_tree($tree);

foreach my $node ( $tree->get_leaf_nodes() ) {
        my $leaf_id = $node->id();
        next if ($leaf_id ne "csa");

        $tree->remove_Node($node);
}

my $treeout = new Bio::TreeIO(-format => 'tabtree');
print "Tree w/ deleted node:\n";
$treeout->write_tree($tree);

$treeout = new Bio::TreeIO(-format => 'newick');
print "Extra set of parentheses:\n";
$treeout->write_tree($tree);
print "\n";
exit;
##########

The script searches through the leaf nodes of the tree to delete the node
labelled "csa".
When it does so, it leaves in the parenthesis that surround that node and
produces a tree:
(Arabidopsis,(BNGI,(PPLGI,((GMGI,MTGI)))));
instead of a tree:
(Arabidopsis,(BNGI,(PPLGI,(GMGI,MTGI))));
-------------- next part --------------
A non-text attachment was scrubbed...
Name: model_tree.phy
Type: application/octet-stream
Size: 48 bytes
Desc: not available
Url : http://portal.open-bio.org/pipermail/bioperl-l/attachments/20050928/a7c125f7/model_tree.obj
-------------- next part --------------
A non-text attachment was scrubbed...
Name: remove_Node_bug.pl
Type: application/octet-stream
Size: 806 bytes
Desc: not available
Url : http://portal.open-bio.org/pipermail/bioperl-l/attachments/20050928/a7c125f7/remove_Node_bug.obj
From olenka.m at gmail.com  Wed Sep 28 16:46:18 2005
From: olenka.m at gmail.com (Olena Morozova)
Date: Thu Sep 29 09:25:26 2005
Subject: [Bioperl-l] Bioperl question - please help!!!
Message-ID: <259a224c05092813466ba2c671@mail.gmail.com>

Hello,

Could you please help me out with the following: I have GeneIDs and
gene names of sequences from the Entrez Gene database, and I need to
retrieve the corresponding coding sequences from RefSeq. I have tried
using Bio::DB::GenBank to get the accession numbers, which I could
then use to retrieve the sequences from RefSeq, but apparently Entrez
Gene GIs are not the same as GenBank GIs and I am getting sequences of
totally different genes by this method. I would really appreciate any
comments or suggestions.

Thank you very much
Best Regards, Olena

From jason.stajich at duke.edu  Thu Sep 29 09:36:03 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Thu Sep 29 09:34:57 2005
Subject: [Bioperl-l] RC3 candidates
Message-ID: <987E70F7-86CA-4243-9C6B-1A7C821C0F5C@duke.edu>

To avoid any confusion these are both tagged RC3 and should be used  
together.

(BTW Hilmar are you interested in bioperl-db being also tagged as  
1.5.X and released?)


RC3 candidates of both bioperl core and bioperl-run are up.

http://bioperl.org/DIST/bioperl-1.5.1-rc3.tar.gz
http://bioperl.org/DIST/bioperl-run-1.5.1-rc3.tar.gz

OR zips for those inclined
http://bioperl.org/DIST/bioperl-1.5.1-rc3.zip
http://bioperl.org/DIST/bioperl-run-1.5.1-rc3.zip

Test, fix, repeat... =)

-jason

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From skirov at utk.edu  Thu Sep 29 10:16:25 2005
From: skirov at utk.edu (Stefan Kirov)
Date: Thu Sep 29 10:17:31 2005
Subject: [Bioperl-l] Bioperl question - please help!!!
In-Reply-To: <259a224c05092813466ba2c671@mail.gmail.com>
References: <259a224c05092813466ba2c671@mail.gmail.com>
Message-ID: <433BF739.8040205@utk.edu>

Olena,
I assume you have EntrezGene id (which is very different from GI, GI 
being unique sequence identifier). You need to fetch first the RefSeq GI 
or accession based in the EG id (which might be one-to-many 
relationship). There are number of ways to do that. First, you can use 
ftp://ftp.ncbi.nlm.nih.gov/gene/DATA/gene2refseq.gz file to do that. You 
can also parse the appropriate file from 
ftp://ftp.ncbi.nlm.nih.gov/gene/DATA/ASN_BINARY/ (I don't know what 
organism you are interested in), parse the data with 
Bio::SeqIO::entrezgene parser and extract the RefSeq identifiers. 
Finally, you can use a database such as EnsMART or GeneKeyDB. If this is 
a one time thing you can use web-based conversion tool, for example:
go to genereg.ornl.gov/gkdb, click on 'gateway to example scripts', 
select id converter and convert from LocusLink (being the older name for 
EG id) to refseq, copy the output, save it to a text file and
hen use Bio::DB::RefSeq to fetch those accession numbers. I am sure 
there other services like that, you can google for them I guess.
Hope this helps. Let me know if you have more questions
Stefan


Olena Morozova wrote:

>Hello,
>
>Could you please help me out with the following: I have GeneIDs and
>gene names of sequences from the Entrez Gene database, and I need to
>retrieve the corresponding coding sequences from RefSeq. I have tried
>using Bio::DB::GenBank to get the accession numbers, which I could
>then use to retrieve the sequences from RefSeq, but apparently Entrez
>Gene GIs are not the same as GenBank GIs and I am getting sequences of
>totally different genes by this method. I would really appreciate any
>comments or suggestions.
>
>Thank you very much
>Best Regards, Olena
>
>_______________________________________________
>Bioperl-l mailing list
>Bioperl-l@portal.open-bio.org
>http://portal.open-bio.org/mailman/listinfo/bioperl-l
>  
>

-- 
Stefan Kirov, Ph.D.
University of Tennessee/Oak Ridge National Laboratory
5700 bldg, PO BOX 2008 MS6164
Oak Ridge TN 37831-6164
USA
tel +865 576 5120
fax +865-576-5332
e-mail: skirov@utk.edu
sao@ornl.gov

"And the wars go on with brainwashed pride
For the love of God and our human rights
And all these things are swept aside"

From sdavis2 at mail.nih.gov  Thu Sep 29 10:35:03 2005
From: sdavis2 at mail.nih.gov (Sean Davis)
Date: Thu Sep 29 10:36:05 2005
Subject: [Bioperl-l] a stupid question
In-Reply-To: <20050928041026.72B6D10DE19@smtp.sibs.ac.cn>
Message-ID: 

On 9/28/05 12:06 AM, "xuying"  wrote:

> Hi Rayn:
> I have many files containing GeneIDs (entrezgene uid) such as the attached
> file. And I want to extract the full gene sequence from NCBI, not just CDS.
> But you script should be helpful. Would you like to share your code here?
> Thanks! 

If I were you, I would just go to:

http://www.ensembl.org/Multi/martview

Then, choose your organism and database (probably ensembl 33).  Click
"next".  Part way down the next page, you will see a box called "GENE".  In
this box, click "ID list limit" check box.  Paste in your gene id list.
Then click "next".  Select "Sequences" from the attribute page drop-down.
Then, select the type of sequence you want.  Then, you can click "export" to
get your sequences in fasta format.

Hope this helps.

Sean

From paul.boutros at utoronto.ca  Thu Sep 29 10:48:21 2005
From: paul.boutros at utoronto.ca (paul.boutros@utoronto.ca)
Date: Thu Sep 29 10:53:42 2005
Subject: [Bioperl-l] 1.5.1 RC3 Tests
Message-ID: <1128005301.433bfeb56defd@webmail.utoronto.ca>

On:
AIX 5.2.0.0
Perl 5.8.7

=====================================
All tests successful, 32 subtests skipped.
Files=221, Tests=9936, 325 wallclock secs (125.00 cusr + 21.72 csys = 146.72 
CPU)
=====================================

I do get a few warnings -- not sure if some of these are caused by the 1.4.0 
that's already installed?  Let me know if any of these shouldn't be there and I 
can track them down....
Paul

==========================================================================
t/embl.......................ok 13/44
-------------------- WARNING ---------------------
MSG: Bio::PrimarySeq=HASH(0x3061f1ec) is not a SeqI compliant sequence object!
---------------------------------------------------

-------------------- WARNING ---------------------
MSG: test is not a SeqI compliant sequence object!
---------------------------------------------------
t/FeatureIO..................ok 2/22
-------------------- WARNING ---------------------
MSG: '##feature-ontology' directive handling not yet implemented
---------------------------------------------------

-------------------- WARNING ---------------------
MSG: '##attribute-ontology' directive handling not yet implemented
---------------------------------------------------

-------------------- WARNING ---------------------
MSG: '##source-ontology' directive handling not yet implemented
---------------------------------------------------
t/Index......................ok 15/47
-------------------- WARNING ---------------------
MSG: overwriting a current value stored for AJ288898

---------------------------------------------------

-------------------- WARNING ---------------------
MSG: overwriting a current value stored for AI129902

---------------------------------------------------

-------------------- WARNING ---------------------
MSG: overwriting a current value stored for BAB68554

---------------------------------------------------
t/simpleGOparser.............ok 1/101
-------------------- WARNING ---------------------
MSG: MPATH:38 exists in the dblink of _default
---------------------------------------------------

-------------------- WARNING ---------------------
MSG: MPATH:41 exists in the dblink of _default
---------------------------------------------------
All tests successful, 32 subtests skipped.
Files=221, Tests=9936, 325 wallclock secs (125.00 cusr + 21.72 csys = 146.72 
CPU)
==========================================================================
From brian_osborne at cognia.com  Thu Sep 29 11:40:31 2005
From: brian_osborne at cognia.com (Brian Osborne)
Date: Thu Sep 29 11:50:00 2005
Subject: [Bioperl-l] 1.5.1 RC3 Tests
In-Reply-To: <1128005301.433bfeb56defd@webmail.utoronto.ca>
Message-ID: 

Paul,

Don't know about all of them but this one:

MSG: Bio::PrimarySeq=HASH(0x3061f1ec) is not a SeqI compliant sequence
object!

Is the expected result, the test is asking whether the object is
SeqI-compliant and expecting the answer to be false.

This one:

MSG: overwriting a current value stored for AJ288898

Has been around for a very long time, prior to 1.4 I believe.


Brian O.


On 9/29/05 10:48 AM, "paul.boutros@utoronto.ca" 
wrote:

> On:
> AIX 5.2.0.0
> Perl 5.8.7
> 
> =====================================
> All tests successful, 32 subtests skipped.
> Files=221, Tests=9936, 325 wallclock secs (125.00 cusr + 21.72 csys = 146.72
> CPU)
> =====================================
> 
> I do get a few warnings -- not sure if some of these are caused by the 1.4.0
> that's already installed?  Let me know if any of these shouldn't be there and
> I 
> can track them down....
> Paul
> 
> ==========================================================================
> t/embl.......................ok 13/44
> -------------------- WARNING ---------------------
> MSG: Bio::PrimarySeq=HASH(0x3061f1ec) is not a SeqI compliant sequence object!
> ---------------------------------------------------
> 
> -------------------- WARNING ---------------------
> MSG: test is not a SeqI compliant sequence object!
> ---------------------------------------------------
> t/FeatureIO..................ok 2/22
> -------------------- WARNING ---------------------
> MSG: '##feature-ontology' directive handling not yet implemented
> ---------------------------------------------------
> 
> -------------------- WARNING ---------------------
> MSG: '##attribute-ontology' directive handling not yet implemented
> ---------------------------------------------------
> 
> -------------------- WARNING ---------------------
> MSG: '##source-ontology' directive handling not yet implemented
> ---------------------------------------------------
> t/Index......................ok 15/47
> -------------------- WARNING ---------------------
> MSG: overwriting a current value stored for AJ288898
> 
> ---------------------------------------------------
> 
> -------------------- WARNING ---------------------
> MSG: overwriting a current value stored for AI129902
> 
> ---------------------------------------------------
> 
> -------------------- WARNING ---------------------
> MSG: overwriting a current value stored for BAB68554
> 
> ---------------------------------------------------
> t/simpleGOparser.............ok 1/101
> -------------------- WARNING ---------------------
> MSG: MPATH:38 exists in the dblink of _default
> ---------------------------------------------------
> 
> -------------------- WARNING ---------------------
> MSG: MPATH:41 exists in the dblink of _default
> ---------------------------------------------------
> All tests successful, 32 subtests skipped.
> Files=221, Tests=9936, 325 wallclock secs (125.00 cusr + 21.72 csys = 146.72
> CPU)
> ==========================================================================
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l


From arareko at campus.iztacala.unam.mx  Thu Sep 29 12:30:24 2005
From: arareko at campus.iztacala.unam.mx (Mauricio Herrera Cuadra)
Date: Thu Sep 29 12:45:58 2005
Subject: [Bioperl-l] FreeBSD ports
Message-ID: <433C16A0.2010901@campus.iztacala.unam.mx>

Due to the recent threads about the FreeBSD ports, I've come up with 
some questions:

- Fern?n: are you working only on p5-bioperl? (I've sent XML::DOM::XPath 
a few weeks ago, so you have one less dependency to worry about ;) )
- George: are you planning to send/maintain p5-bioperl-run and 
p5-bioperl-devel (and their respective dependencies)?
- Anyone else is preparing ports for FreeBSD?

I'm working on p5-bioperl-ext (and its dependencies). I hope to have it 
ready for the 1.6.0 release.

It would be nice to know who is doing what, so we can be coordinated and 
avoid duplicating efforts.

Regards,
Mauricio.
-- 
MAURICIO HERRERA CUADRA
arareko@campus.iztacala.unam.mx
Laboratorio de Gen?tica
Unidad de Morfofisiolog?a y Funci?n
Facultad de Estudios Superiores Iztacala, UNAM

From hartzell at kestrel.alerce.com  Thu Sep 29 13:02:09 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Thu Sep 29 13:02:30 2005
Subject: [Bioperl-l] FreeBSD ports
In-Reply-To: <433C16A0.2010901@campus.iztacala.unam.mx>
References: <433C16A0.2010901@campus.iztacala.unam.mx>
Message-ID: <17212.7697.291176.750558@satchel.alerce.com>

Mauricio Herrera Cuadra writes:
 > Due to the recent threads about the FreeBSD ports, I've come up with 
 > some questions:
 > 
 > - Fern?n: are you working only on p5-bioperl? (I've sent XML::DOM::XPath 
 > a few weeks ago, so you have one less dependency to worry about ;) )
 > - George: are you planning to send/maintain p5-bioperl-run and 
 > p5-bioperl-devel (and their respective dependencies)?
 > - Anyone else is preparing ports for FreeBSD?
 > 
 > I'm working on p5-bioperl-ext (and its dependencies). I hope to have it 
 > ready for the 1.6.0 release.

I have ports and/or updates for p5-bioperl-devel and p5-bioperl-run
(been using them for a while now, updating for 1.5.1), tidying up one
for exonerate (making sure it passes everything w/ assertions
enabled), fasta3 (update), and first drafts for mdust and seg
(pains-in-the-ass because of how the src files are made available on
the web...).

I have an almost working -ext, except that it was splatting it's libs
in odd places and I was in a hurry, so I just put them where they
belonged by hand.

Depending on how stable the location of the "release candidate" is for
wise 2.2.3-rc7 (in other words, if Ewan doesn't object), I'll roll up
a wise-devel port to support p5-bioperl-run.

I'll send all of this in as PR's and am happy to maintain them as
necessary.

I'm happy to build others if folks suggest them and as time allows.

g.

From fernan at iib.unsam.edu.ar  Thu Sep 29 14:30:54 2005
From: fernan at iib.unsam.edu.ar (Fernan Aguero)
Date: Thu Sep 29 14:57:40 2005
Subject: [Bioperl-l] FreeBSD ports
In-Reply-To: <17212.7697.291176.750558@satchel.alerce.com>
References: <433C16A0.2010901@campus.iztacala.unam.mx>
	<17212.7697.291176.750558@satchel.alerce.com>
Message-ID: <20050929183054.GF61107@iib.unsam.edu.ar>

+----[ George Hartzell  (29.Sep.2005 14:24):
|
| Mauricio Herrera Cuadra writes:
|  > Due to the recent threads about the FreeBSD ports, I've come up with 
|  > some questions:
|  > 
|  > - Fern?n: are you working only on p5-bioperl? (I've sent XML::DOM::XPath 
|  > a few weeks ago, so you have one less dependency to worry about ;) )

Thanks for the help! I'm maintaining a number of ports,
besides bioperl:
http://portsmon.droso.net/portsconcordanceformaintainer.py?maintainer=fernan

|  > - George: are you planning to send/maintain p5-bioperl-run and 
|  > p5-bioperl-devel (and their respective dependencies)?
|  > - Anyone else is preparing ports for FreeBSD?

I was about to ask the same question. Maybe we can
coordinate our efforts and/or help each other in the
maintainance of these ports and to add new ports? 

If other bioperl-l@ readers are using FreeBSD and want to
volunteer, speak up. No previous experience required, we can
get you started quickly :)

I'm also afraid that this discussion doesn't belong to
bioperl-l@ so perhaps we should seek to bring freebsd-bio@
to live again?

|  > I'm working on p5-bioperl-ext (and its dependencies). I hope to have it 
|  > ready for the 1.6.0 release.
| 
| I have ports and/or updates for p5-bioperl-devel and p5-bioperl-run
| (been using them for a while now, updating for 1.5.1), tidying up one
| for exonerate (making sure it passes everything w/ assertions
| enabled), fasta3 (update), and first drafts for mdust and seg
| (pains-in-the-ass because of how the src files are made available on
| the web...).

thanks for the fasta3 update :) I've been fighting with it
for some time and never got to finish it 

| I have an almost working -ext, except that it was splatting it's libs
| in odd places and I was in a hurry, so I just put them where they
| belonged by hand.
| 
| Depending on how stable the location of the "release candidate" is for
| wise 2.2.3-rc7 (in other words, if Ewan doesn't object), I'll roll up
| a wise-devel port to support p5-bioperl-run.

Great!

| I'll send all of this in as PR's and am happy to maintain them as
| necessary.

OK.

| I'm happy to build others if folks suggest them and as time allows.
| 
| g.
|
+----]

I've been working on ports for mpiblast, poa/poaviz, the
vienna RNA package, codonw and wemboss, but time has been
scarce as of late.

But definitely we should have this discussion in freebsd-bio@
or some other place that is both FreeBSD AND bio specific :)

Regards,

Fernan
From jason.stajich at duke.edu  Thu Sep 29 15:05:49 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Thu Sep 29 15:06:10 2005
Subject: [Bioperl-l] sanity check an update the bioperl-run's t/ProtDist.t
In-Reply-To: <17209.41953.896669.89682@satchel.alerce.com>
References: <17209.41953.896669.89682@satchel.alerce.com>
Message-ID: <8E31F64A-EDB1-431D-A01A-04EE9306445D@duke.edu>

Totally rounding either at the perl level or depending on how your  
phylip is built.Can you put some sprintfs in there and just test on 3  
sigfigs?

ok(sprintf("%.3f", $matrix->get_entry('ENSP000003','SINFRUP001')),  
0.277);

Thanks,
-jason

On Sep 27, 2005, at 3:56 PM, George Hartzell wrote:

>
> I'm wrenching on some of the rc2 bioperl-run code, touching it up to
> work better with Phylip 3.6.
>
> After tuning up PhylipConf.pm, I'm getting this for one of the tests:
>
>   # Test 9 got: "0.277077" (t/ProtDist.t at line 98)
>   #   Expected: "0.27708"
>   #  t/ProtDist.t line 98 is: ok($matrix->get_entry 
> ('ENSP000003','SINFRUP001'),0.27708);
>
> I'm inclined to excuse the difference as my perl providing another
> digit's worth of detail (accuracy? ;)).
>
> Do folks agree, or is there something else going on?
>
> g.
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From hartzell at kestrel.alerce.com  Thu Sep 29 15:18:27 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Thu Sep 29 15:19:08 2005
Subject: [Bioperl-l] sanity check an update the bioperl-run's t/ProtDist.t
In-Reply-To: <8E31F64A-EDB1-431D-A01A-04EE9306445D@duke.edu>
References: <17209.41953.896669.89682@satchel.alerce.com>
	<8E31F64A-EDB1-431D-A01A-04EE9306445D@duke.edu>
Message-ID: <17212.15875.697006.881467@satchel.alerce.com>

Jason Stajich writes:
 > Totally rounding either at the perl level or depending on how your  
 > phylip is built.Can you put some sprintfs in there and just test on 3  
 > sigfigs?
 > 
 > ok(sprintf("%.3f", $matrix->get_entry('ENSP000003','SINFRUP001')),  
 > 0.277);

Will do.

g.
From arareko at campus.iztacala.unam.mx  Thu Sep 29 15:44:08 2005
From: arareko at campus.iztacala.unam.mx (Mauricio Herrera Cuadra)
Date: Thu Sep 29 15:48:46 2005
Subject: [Bioperl-l] FreeBSD ports
In-Reply-To: <20050929183054.GF61107@iib.unsam.edu.ar>
References: <433C16A0.2010901@campus.iztacala.unam.mx>
	<17212.7697.291176.750558@satchel.alerce.com>
	<20050929183054.GF61107@iib.unsam.edu.ar>
Message-ID: <433C4408.3040600@campus.iztacala.unam.mx>

Fernan Aguero wrote:
> +----[ George Hartzell  (29.Sep.2005 14:24):
> |
> | Mauricio Herrera Cuadra writes:
> |  > Due to the recent threads about the FreeBSD ports, I've come up with 
> |  > some questions:
> |  > 
> |  > - Fern?n: are you working only on p5-bioperl? (I've sent XML::DOM::XPath 
> |  > a few weeks ago, so you have one less dependency to worry about ;) )
> 
> Thanks for the help! I'm maintaining a number of ports,
> besides bioperl:
> http://portsmon.droso.net/portsconcordanceformaintainer.py?maintainer=fernan

Your welcome.

> 
> |  > - George: are you planning to send/maintain p5-bioperl-run and 
> |  > p5-bioperl-devel (and their respective dependencies)?
> |  > - Anyone else is preparing ports for FreeBSD?
> 
> I was about to ask the same question. Maybe we can
> coordinate our efforts and/or help each other in the
> maintainance of these ports and to add new ports? 

Sure we can. What other subdirs of bioperl are more or less 
functional/stable, so they can be ported also? Perhaps bioperl-db and 
biosql-schema?

> 
> If other bioperl-l@ readers are using FreeBSD and want to
> volunteer, speak up. No previous experience required, we can
> get you started quickly :)
> 
> I'm also afraid that this discussion doesn't belong to
> bioperl-l@ so perhaps we should seek to bring freebsd-bio@
> to live again?
> 

I totally agree with you. What do we need to bring it back?

> |  > I'm working on p5-bioperl-ext (and its dependencies). I hope to have it 
> |  > ready for the 1.6.0 release.
> | 
> | I have ports and/or updates for p5-bioperl-devel and p5-bioperl-run
> | (been using them for a while now, updating for 1.5.1), tidying up one
> | for exonerate (making sure it passes everything w/ assertions
> | enabled), fasta3 (update), and first drafts for mdust and seg
> | (pains-in-the-ass because of how the src files are made available on
> | the web...).
> 
> thanks for the fasta3 update :) I've been fighting with it
> for some time and never got to finish it 
> 
> | I have an almost working -ext, except that it was splatting it's libs
> | in odd places and I was in a hurry, so I just put them where they
> | belonged by hand.

Ok, so I better stop working on it. If you need any help please tell me 
George.

> | 
> | Depending on how stable the location of the "release candidate" is for
> | wise 2.2.3-rc7 (in other words, if Ewan doesn't object), I'll roll up
> | a wise-devel port to support p5-bioperl-run.
> 
> Great!
> 
> | I'll send all of this in as PR's and am happy to maintain them as
> | necessary.
> 
> OK.
> 
> | I'm happy to build others if folks suggest them and as time allows.
> | 
> | g.
> |
> +----]
> 
> I've been working on ports for mpiblast, poa/poaviz, the
> vienna RNA package, codonw and wemboss, but time has been
> scarce as of late.

I'm also working on clustalx. Hope to send it soon.

> 
> But definitely we should have this discussion in freebsd-bio@
> or some other place that is both FreeBSD AND bio specific :)
> 
> Regards,
> 
> Fernan
> 

Regards,

-- 
MAURICIO HERRERA CUADRA
arareko@campus.iztacala.unam.mx
Laboratorio de Gen?tica
Unidad de Morfofisiolog?a y Funci?n
Facultad de Estudios Superiores Iztacala, UNAM

From jason.stajich at duke.edu  Thu Sep 29 15:04:03 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Thu Sep 29 16:26:20 2005
Subject: [Bioperl-l] remove_Node leaves parenthesis after deleting
	internal leaf
In-Reply-To: <200509281938.PAA04120@webmail7.cac.psu.edu>
References: <200509281938.PAA04120@webmail7.cac.psu.edu>
Message-ID: <45370354-B963-4E9D-92CB-B2310170F1A0@duke.edu>

I replied to the bug - this should be already fixed.  Can you try  
with Bioperl 1.5.1-RC3?

http://bioperl.org/DIST/bioperl-1.5.1-rc3.tar.gz
http://bioperl.org/DIST/bioperl-1.5.1-rc3.zip

-jason
On Sep 28, 2005, at 3:38 PM, Kevin Beckmann wrote:

> This bug is listed as Bug 1870 under Bugzilla:
>
> I've come across a bug in TreeIO:
> Using this as a model tree (file is named "model_tree.phy"):
> (Arabidopsis,(BNGI,(PPLGI,(csa,(GMGI,MTGI)))));
>
> I run this script:
>
> #!/usr/bin/perl -w
> ### remove_Node_bug.pl ###
> # Created: Wed Sep 28 13:10:00 EDT 2005
> # creator- Kevin Beckmann
>
> use strict;
> use Bio::TreeIO;
>
> my $file = "model_tree.phy";
>
> my $treein = new Bio::TreeIO(-file => $file, -format => "newick");
> my $tree = $treein->next_tree();
> my $treestart = new Bio::TreeIO(-format => 'tabtree');
> print "Starting tree:\n";
> $treestart->write_tree($tree);
>
> foreach my $node ( $tree->get_leaf_nodes() ) {
>         my $leaf_id = $node->id();
>         next if ($leaf_id ne "csa");
>
>         $tree->remove_Node($node);
> }
>
> my $treeout = new Bio::TreeIO(-format => 'tabtree');
> print "Tree w/ deleted node:\n";
> $treeout->write_tree($tree);
>
> $treeout = new Bio::TreeIO(-format => 'newick');
> print "Extra set of parentheses:\n";
> $treeout->write_tree($tree);
> print "\n";
> exit;
> ##########
>
> The script searches through the leaf nodes of the tree to delete  
> the node
> labelled "csa".
> When it does so, it leaves in the parenthesis that surround that  
> node and
> produces a tree:
> (Arabidopsis,(BNGI,(PPLGI,((GMGI,MTGI)))));
> instead of a tree:
> (Arabidopsis,(BNGI,(PPLGI,(GMGI,MTGI))));
> 
> 
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From hartzell at kestrel.alerce.com  Thu Sep 29 17:28:18 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Thu Sep 29 17:28:13 2005
Subject: [Bioperl-l] pointer to pseudowise ?
In-Reply-To: <433A9499.4050205@ebi.ac.uk>
References: <17209.45816.939324.983892@satchel.alerce.com>
	<433A9499.4050205@ebi.ac.uk>
Message-ID: <17212.23666.335872.146123@satchel.alerce.com>

Ewan Birney writes:
 > 
 > 
 > George Hartzell wrote:
 > > bioperl-run has support for pseudowise, but I can't find it.  It
 > > doesn't seem to be in the wise2.20, 2.1.23c, or 2.1.16b distributions.
 > > 
 > > Anyone know what's up?
 > > 
 > 
 > :) it is in the 2.2.3-rc7 release which has not made the light of day
 > for the last 1.5 years. you know who you can blame :)
 > 
 > [...]

I picked up the 2.2.3-rc7 release and it passes it's tests.

bioperl-run's t/Pseudowise.t isn't working out so well.

It looks like it's expecting pseudowise to find a single gene with two
exons from 163 to 626, but running pseudowise by hand based on the
BIOPERLDEBUG output just generates a single-exon gene from 865-900
(which is properly represented in the bioperl objects).

Does it work for other folk?

Any suggests for straightening this out?

g.
From hartzell at kestrel.alerce.com  Thu Sep 29 17:43:03 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Thu Sep 29 17:42:45 2005
Subject: genewise [was Re: [Bioperl-l] pointer to pseudowise ?]
In-Reply-To: <433A9499.4050205@ebi.ac.uk>
References: <17209.45816.939324.983892@satchel.alerce.com>
	<433A9499.4050205@ebi.ac.uk>
Message-ID: <17212.24551.533479.690829@satchel.alerce.com>


On a related note, now that I have a wise-2.2.3-rc7 which passes it's
tests, I'm trying Promoterwise.t (which passes, yay!) and Genewise.t
(which doesn't, sigh...).

The Version string in my version of genewise doesn't return anything
useful, so the Genewise.t code compares the results to what it has
stashed for 2.2.3-rc7.

Oddly enough, the answers that I'm seeing seem to be an amalgam of
those expect for 2-2-0 and 2.2.3-rc7.

I've included the output from running genewise by hand (as reported by
running with -verbose => 1).

Anyone see something I'm doing wrong?

g.

genewise $Name:  $ (unreleased release)
This program is freely distributed under a GPL. See source directory
Copyright (c) GRL limited: portions of the code are from separate copyright

Query protein:       roa1_drome
Comp Matrix:         BLOSUM62.bla
Gap open:            12
Gap extension:       2
Start/End            default
Target Sequence      HSHNRNPA
Strand:              forward
Start/End (protein)  default
Gene Parameter file: gene.stat
Splice site model:   Position Weight Matrix
Pseudo counts 5'SS   1.00
Pseudo counts 3'SS   1.00
Minimum SS collar    -5.00
Maximum SS collar    5.00
Splice site offset   1.50
Codon Table:         codon.table
Subs error:          1e-06
Indel error:         1e-06
Null model           syn
Algorithm            623

genewise output
Score 319.10 bits over entire alignment
Scores as bits over a synchronous coding model

Warning: The bits scores is not probablistically correct for single seqs
See WWW help for more info

roa1_drome        26 EPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVV              
                     EPE +RKLFIGGL + TTDE+L++HFE+WG + D V              
                     EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCV              
HSHNRNPA        1386 gcgccaactaggtatgaaggacaactgctgacagtg              
                     acaatgatttggtgtaccaagtggataaggctcagt              
                     gcaggggcctaggctaattgcggcttgagagcgctg              


roa1_drome        62                            VMKDPRTKRSRGFGFITYSHSS 
                                                VM+DP TKRSRGFGF+TY+    
                                                VMRDPNTKRSRGFGFVTYATVE 
HSHNRNPA        1494 GTAAGAT  Intron 1       CAGgaagcaaactagtgtgatgagg 
                     <0-----[1494   :   1788]-0>ttgacacagcggtgttcaccta 
                                                agataccgctgctgtcatctgg 


roa1_drome        84 MIDEAQKSRPHKIDGRVVEPKRAVPRQ                       
                      +D A  +RPHK+DGRVVEPKRAV R+                       
                     EVDAAMNARPHKVDGRVVEPKRAVSRE                       
HSHNRNPA        1855 gggggaagaccagggagggcaaggtag                       
                     atacctacgcaataggttacagctcga                       
                     ggtatgtagacggtaatgaagatccaa                       


roa1_drome       111                            DIDSPNAGATVKKLFVGALKDD 
                                                D   P A  TVKK+FVG +K+D 
                                                DSQRPGAHLTVKKIFVGGIKED 
HSHNRNPA        1936 GTGAGTG  Intron 2       TAGgtcacggctagaaatgggaagg 
                     <0-----[1936   :   2083]-0>acagcgcatctaatttggtaaa 
                                                ttaaatccatgagatttctaac 


roa1_drome       133 HDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVV  
                      +E  +RDYF+ +G I  I I+ D+ +GKKRGFAFV FDD+D VDK+V  
                     TEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIV  
HSHNRNPA        2150 aggcccagttgctgaaggagaaagcgagaaagtgtgatggcgtggaag  
                     caaaatgaataaagatattattcaggggaaggtcttctaaaactaatt  
                     taatcaatttagtaatagtacgtcactcgagctctactcctccgtgtc  


roa1_drome       181                               QKQHQLNGKMVDVKKALP  
                                                   QK H +NG   +V+KAL   
                               L:I[att]            QKYHTVNGHNCEVRKALS  
HSHNRNPA        2294 AGTAAGTA  Intron 3       TAGTTcatcagagcatggaagct  
                      <1-----[2295   :   2387]-1>  aaaactagaagatgactc  
                                                   gacttgtccctataacga  


roa1_drome       200                               QN                  
                                                   Q                   
                                K:N[aac]           QR                  
HSHNRNPA        2444 AAGCAAGAG  Intron 4       CAGCca                  
                       <2-----[2446   :   2472]-2> ag                  
                                                   aa                  


roa1_drome       203                               QQGGGGGRGGPGGRAGGNR 
                                                   + G G   GG GG  GGN  
                               D:G[ggt]            RSGSGNFGGGRGGGFGGND 
HSHNRNPA        2480 GGTATGCT  Intron 5       AAGGTcagtgatgggcgggtggag 
                      <1-----[2481   :   2566]-1>  gggcgatgggggggtggaa 
                                                   atttactttttattctgtc 


roa1_drome       223 GNMGGGNYGNQN                              GGGNWNN 
                         GGN+  +                               GG   +  
                     NFGRGGNFSGRG           -:I[ata]           GGFGGSR 
HSHNRNPA        2626 atgcggatagcgATGTATGGT  Intron 6       TACAggtggac 
                     atggggatgggg  <2-----[2664   :   2791]-2> ggtgggg 
                     ccttaacctttt                              tcttcct 


roa1_drome       242 GGNNWGNNRGGNDNWGNN                              F 
                     GG  +G +  G + +GN+                                
                     GGGGYGGSGDGYNGFGND          S:G[gga]            S 
HSHNRNPA        2814 ggggtggagggtagtgagGGTAAGTT  Intron 7       GAGGAa 
                     ggggaggggagaagtgaa <1-----[2869   :   3108]-1>  g 
                     tttattctgtcttatctt                              c 


roa1_drome       262 GGGGGGGGGYGGGNNSWGNNNPWD--NGNGGGNFGGGG            
                      G G GG GYG   + +G +  +D  N  GGG FGGG             
                     RGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGS            
HSHNRNPA        3114 agtgaggcgtgacgagtggagatgataagggggtggga            
                     ggaggggagagaagggagggggaagaaagggggtgggg            
                     actattagttacgctctcgtcctcctccacacctcttt            


roa1_drome       298                               NNWNNGG--NDFGGYQ-QN 
                                                    N+  GG  NDFG Y  Q+ 
                               -:G[gga]            SNFGGGGSYNDFGNYNNQS 
HSHNRNPA        3228 GGTAGGTA  Intron 8       TAGGAaatggggatagtgataact 
                      <1-----[3229   :   3805]-1>  gatgggggaaatgaaaaac 
                                                   cttattacctttgtcctgt 


roa1_drome       314 YGGGPQRGGGNFNNNRMQPYQGGGGFKAGGGNQ                 
                        GP +GG NF      PY GGG + A   NQ                 
                     SNFGPMKGG-NFGGRSSGPYGGGGQYFAKPRNQ                 
HSHNRNPA        3865 tatgcaagg atggaatgctggggcttgaccac                 
                     catgctagg atggggcgcaggggaatcacgaa                 
                     attacggaa ttacactcctctacactaaaaca                 


roa1_drome       347                               NYGGNNQGFNNGGNNRRY  
                                                    YGG++    + G+ RR+  
                               G:G[ggt]            GYGGSSSS-SSYGSGRRF  
HSHNRNPA        3961 GGTATGGT  Intron 9       CAGGTgtggtaaa aatgagaat  
                      <1-----[3962   :   4251]-1>  gaggcggg ggagggggt  
                                                   ctctcccc tctctcaat  


//
Gene 1
Gene 1386 4304 
  Exon 1386 1493 phase 0
     Supporting 1386 1493 26 61
  Exon 1789 1935 phase 0
     Supporting 1789 1935 62 110
  Exon 2084 2294 phase 0
     Supporting 2084 2293 111 180
  Exon 2388 2445 phase 1
     Supporting 2390 2443 182 199
  Exon 2473 2480 phase 2
     Supporting 2474 2479 201 202
  Exon 2567 2663 phase 1
     Supporting 2569 2661 204 234
  Exon 2792 2868 phase 2
     Supporting 2793 2867 235 259
  Exon 3109 3228 phase 1
     Supporting 3111 3185 261 285
     Supporting 3192 3227 286 297
  Exon 3806 3961 phase 1
     Supporting 3808 3828 298 304
     Supporting 3835 3855 305 311
     Supporting 3859 3891 312 322
     Supporting 3892 3960 324 346
  Exon 4252 4304 phase 1
     Supporting 4254 4277 348 355
     Supporting 4278 4304 357 365
//
From lupey+ at pitt.edu  Thu Sep 29 09:56:19 2005
From: lupey+ at pitt.edu (Paul G Cantalupo)
Date: Thu Sep 29 17:49:01 2005
Subject: [Bioperl-l] bioperl-live CVS installation
Message-ID: 

Hello,

I am using the CVS bioperl-live repository and trying to understand how to 
properly use CVS. After I typed 'cvs update', I got the following:

? Makefile
? blib
? pm_to_blib
? maintenance/symlink_scripts.pl
cvs update: Updating .
cvs update: Updating Bio..............

Is it necessary to delete the files/directories that are preceeded with a 
question mark (?) before 'cvs update'?

Also, after I perform a 'cvs update', is it necessary to run the usual:

   perl Makefile.PL
   make
   make test
   make install


Thank you,

Paul

Paul Cantalupo
Research Specialist/Systems Programmer
559 Crawford Hall
Department of Biological Sciences
University of Pittsburgh
Pittsburgh, PA 15260
Work: 412-624-4687
Fax: 412-624-4759

Ask me about Toastmasters: www.toastmasters.org
Midday Club Treasurer
From hartzell at kestrel.alerce.com  Thu Sep 29 18:10:37 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Thu Sep 29 18:11:29 2005
Subject: [Bioperl-l] feedback on small patch for bioperl-run's t/Neighbor.t
Message-ID: <17212.26205.316247.984618@satchel.alerce.com>


t/Neighbor.t fails for me, the patch below fixes it.

I'm running w/ -live and -run from CVS this morning, and Phylip3.6
(and the proper env. variable set).

I'm getting four nodes, one of which has an id that's ''.  By touching
up the test code so that the id field must be defined and non-empty,
things work, and the existence of that filter suggests that it's ok
for there to be more than the three expected nodes in the list.

Does this patch make sense, or am I missing something subtle?

g.

Index: t/Neighbor.t
===================================================================
RCS file: /home/repository/bioperl/bioperl-run/t/Neighbor.t,v
retrieving revision 1.7
diff -c -3 -r1.7 Neighbor.t
*** t/Neighbor.t	18 Dec 2002 13:43:45 -0000	1.7
--- t/Neighbor.t	29 Sep 2005 21:15:22 -0000
***************
*** 77,83 ****
  
  ($tree) = $tree_factory->create_tree($inputfilename);
  my @nodes = sort { $a->id cmp $b->id } 
!             grep { defined $_->id} $tree->get_nodes();
  
  ok($nodes[2]->id, 'SINFRUP002');
  ok($nodes[1]->id, 'SINFRUP001');
--- 77,83 ----
  
  ($tree) = $tree_factory->create_tree($inputfilename);
  my @nodes = sort { $a->id cmp $b->id } 
!             grep { defined $_->id and $_->id} $tree->get_nodes();
  
  ok($nodes[2]->id, 'SINFRUP002');
  ok($nodes[1]->id, 'SINFRUP001');
From jason.stajich at duke.edu  Thu Sep 29 21:36:20 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Thu Sep 29 21:35:09 2005
Subject: [Bioperl-l] feedback on small patch for bioperl-run's t/Neighbor.t
In-Reply-To: <17212.26205.316247.984618@satchel.alerce.com>
References: <17212.26205.316247.984618@satchel.alerce.com>
Message-ID: <016BD9B1-7944-4967-B8D3-DFFDF5A6B892@duke.edu>

sure - we're testing if we can run neighbor not rigorously testing  
whether or not it gives us the right answer , etc.  There should only  
be 3 leaves so another way to do it is, but testing in the grep on  
the 'id' is fine since that is what we're using later on.

my @nodes = sort { $a->id cmp $b->id }  grep { $_->is_Leaf } $tree- 
 >get_nodes;

-j
On Sep 29, 2005, at 6:10 PM, George Hartzell wrote:

>
> t/Neighbor.t fails for me, the patch below fixes it.
>
> I'm running w/ -live and -run from CVS this morning, and Phylip3.6
> (and the proper env. variable set).
>
> I'm getting four nodes, one of which has an id that's ''.  By touching
> up the test code so that the id field must be defined and non-empty,
> things work, and the existence of that filter suggests that it's ok
> for there to be more than the three expected nodes in the list.
>
> Does this patch make sense, or am I missing something subtle?
>
> g.
>
> Index: t/Neighbor.t
> ===================================================================
> RCS file: /home/repository/bioperl/bioperl-run/t/Neighbor.t,v
> retrieving revision 1.7
> diff -c -3 -r1.7 Neighbor.t
> *** t/Neighbor.t    18 Dec 2002 13:43:45 -0000    1.7
> --- t/Neighbor.t    29 Sep 2005 21:15:22 -0000
> ***************
> *** 77,83 ****
>
>   ($tree) = $tree_factory->create_tree($inputfilename);
>   my @nodes = sort { $a->id cmp $b->id }
> !             grep { defined $_->id} $tree->get_nodes();
>
>   ok($nodes[2]->id, 'SINFRUP002');
>   ok($nodes[1]->id, 'SINFRUP001');
> --- 77,83 ----
>
>   ($tree) = $tree_factory->create_tree($inputfilename);
>   my @nodes = sort { $a->id cmp $b->id }
> !             grep { defined $_->id and $_->id} $tree->get_nodes();
>
>   ok($nodes[2]->id, 'SINFRUP002');
>   ok($nodes[1]->id, 'SINFRUP001');
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From jason.stajich at duke.edu  Thu Sep 29 21:38:18 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Thu Sep 29 21:37:05 2005
Subject: genewise [was Re: [Bioperl-l] pointer to pseudowise ?]
In-Reply-To: <17212.24551.533479.690829@satchel.alerce.com>
References: <17209.45816.939324.983892@satchel.alerce.com>
	<433A9499.4050205@ebi.ac.uk>
	<17212.24551.533479.690829@satchel.alerce.com>
Message-ID: 


On Sep 29, 2005, at 5:43 PM, George Hartzell wrote:

>
> On a related note, now that I have a wise-2.2.3-rc7 which passes it's
> tests, I'm trying Promoterwise.t (which passes, yay!) and Genewise.t
> (which doesn't, sigh...).
>
> The Version string in my version of genewise doesn't return anything
> useful, so the Genewise.t code compares the results to what it has
> stashed for 2.2.3-rc7.

I know, Ewan will fix that before the release.

I assume that without a version that it is 2.2.3-rc7 for testing  
purposes.


>
> Oddly enough, the answers that I'm seeing seem to be an amalgam of
> those expect for 2-2-0 and 2.2.3-rc7.
>

There should be an if/elsif in the t/Genewise.t do you have that?

I think I got interrupted before finishing these tests as looks like  
I transposed some nums, should pass on both versions now.

> I've included the output from running genewise by hand (as reported by
> running with -verbose => 1).
>
> Anyone see something I'm doing wrong?
>
> g.
>
> genewise $Name:  $ (unreleased release)
> This program is freely distributed under a GPL. See source directory
> Copyright (c) GRL limited: portions of the code are from separate  
> copyright
>
> Query protein:       roa1_drome
> Comp Matrix:         BLOSUM62.bla
> Gap open:            12
> Gap extension:       2
> Start/End            default
> Target Sequence      HSHNRNPA
> Strand:              forward
> Start/End (protein)  default
> Gene Parameter file: gene.stat
> Splice site model:   Position Weight Matrix
> Pseudo counts 5'SS   1.00
> Pseudo counts 3'SS   1.00
> Minimum SS collar    -5.00
> Maximum SS collar    5.00
> Splice site offset   1.50
> Codon Table:         codon.table
> Subs error:          1e-06
> Indel error:         1e-06
> Null model           syn
> Algorithm            623
>
> genewise output
> Score 319.10 bits over entire alignment
> Scores as bits over a synchronous coding model
>
> Warning: The bits scores is not probablistically correct for single  
> seqs
> See WWW help for more info
>
> roa1_drome        26 EPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVV
>                      EPE +RKLFIGGL + TTDE+L++HFE+WG + D V
>                      EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCV
> HSHNRNPA        1386 gcgccaactaggtatgaaggacaactgctgacagtg
>                      acaatgatttggtgtaccaagtggataaggctcagt
>                      gcaggggcctaggctaattgcggcttgagagcgctg
>
>
> roa1_drome        62                            VMKDPRTKRSRGFGFITYSHSS
>                                                 VM+DP TKRSRGFGF+TY+
>                                                 VMRDPNTKRSRGFGFVTYATVE
> HSHNRNPA        1494 GTAAGAT  Intron 1       CAGgaagcaaactagtgtgatgagg
>                      <0-----[1494   :   1788]-0>ttgacacagcggtgttcaccta
>                                                 agataccgctgctgtcatctgg
>
>
> roa1_drome        84 MIDEAQKSRPHKIDGRVVEPKRAVPRQ
>                       +D A  +RPHK+DGRVVEPKRAV R+
>                      EVDAAMNARPHKVDGRVVEPKRAVSRE
> HSHNRNPA        1855 gggggaagaccagggagggcaaggtag
>                      atacctacgcaataggttacagctcga
>                      ggtatgtagacggtaatgaagatccaa
>
>
> roa1_drome       111                            DIDSPNAGATVKKLFVGALKDD
>                                                 D   P A  TVKK+FVG +K+D
>                                                 DSQRPGAHLTVKKIFVGGIKED
> HSHNRNPA        1936 GTGAGTG  Intron 2       TAGgtcacggctagaaatgggaagg
>                      <0-----[1936   :   2083]-0>acagcgcatctaatttggtaaa
>                                                 ttaaatccatgagatttctaac
>
>
> roa1_drome       133 HDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVV
>                       +E  +RDYF+ +G I  I I+ D+ +GKKRGFAFV FDD+D VDK+V
>                      TEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIV
> HSHNRNPA        2150 aggcccagttgctgaaggagaaagcgagaaagtgtgatggcgtggaag
>                      caaaatgaataaagatattattcaggggaaggtcttctaaaactaatt
>                      taatcaatttagtaatagtacgtcactcgagctctactcctccgtgtc
>
>
> roa1_drome       181                               QKQHQLNGKMVDVKKALP
>                                                    QK H +NG   +V+KAL
>                                L:I[att]            QKYHTVNGHNCEVRKALS
> HSHNRNPA        2294 AGTAAGTA  Intron 3       TAGTTcatcagagcatggaagct
>                       <1-----[2295   :   2387]-1>  aaaactagaagatgactc
>                                                    gacttgtccctataacga
>
>
> roa1_drome       200                               QN
>                                                    Q
>                                 K:N[aac]           QR
> HSHNRNPA        2444 AAGCAAGAG  Intron 4       CAGCca
>                        <2-----[2446   :   2472]-2> ag
>                                                    aa
>
>
> roa1_drome       203                               QQGGGGGRGGPGGRAGGNR
>                                                    + G G   GG GG  GGN
>                                D:G[ggt]            RSGSGNFGGGRGGGFGGND
> HSHNRNPA        2480 GGTATGCT  Intron 5       AAGGTcagtgatgggcgggtggag
>                       <1-----[2481   :   2566]-1>  gggcgatgggggggtggaa
>                                                    atttactttttattctgtc
>
>
> roa1_drome       223 GNMGGGNYGNQN                              GGGNWNN
>                          GGN+  +                               GG   +
>                      NFGRGGNFSGRG           -:I[ata]           GGFGGSR
> HSHNRNPA        2626 atgcggatagcgATGTATGGT  Intron 6       TACAggtggac
>                      atggggatgggg  <2-----[2664   :   2791]-2> ggtgggg
>                      ccttaacctttt                              tcttcct
>
>
> roa1_drome       242 GGNNWGNNRGGNDNWGNN                              F
>                      GG  +G +  G + +GN+
>                      GGGGYGGSGDGYNGFGND          S:G[gga]            S
> HSHNRNPA        2814 ggggtggagggtagtgagGGTAAGTT  Intron 7       GAGGAa
>                      ggggaggggagaagtgaa <1-----[2869   :   3108]-1>  g
>                      tttattctgtcttatctt                              c
>
>
> roa1_drome       262 GGGGGGGGGYGGGNNSWGNNNPWD--NGNGGGNFGGGG
>                       G G GG GYG   + +G +  +D  N  GGG FGGG
>                      RGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGS
> HSHNRNPA        3114 agtgaggcgtgacgagtggagatgataagggggtggga
>                      ggaggggagagaagggagggggaagaaagggggtgggg
>                      actattagttacgctctcgtcctcctccacacctcttt
>
>
> roa1_drome       298                               NNWNNGG--NDFGGYQ-QN
>                                                     N+  GG  NDFG Y  Q+
>                                -:G[gga]            SNFGGGGSYNDFGNYNNQS
> HSHNRNPA        3228 GGTAGGTA  Intron 8       TAGGAaatggggatagtgataact
>                       <1-----[3229   :   3805]-1>  gatgggggaaatgaaaaac
>                                                    cttattacctttgtcctgt
>
>
> roa1_drome       314 YGGGPQRGGGNFNNNRMQPYQGGGGFKAGGGNQ
>                         GP +GG NF      PY GGG + A   NQ
>                      SNFGPMKGG-NFGGRSSGPYGGGGQYFAKPRNQ
> HSHNRNPA        3865 tatgcaagg atggaatgctggggcttgaccac
>                      catgctagg atggggcgcaggggaatcacgaa
>                      attacggaa ttacactcctctacactaaaaca
>
>
> roa1_drome       347                               NYGGNNQGFNNGGNNRRY
>                                                     YGG++    + G+ RR+
>                                G:G[ggt]            GYGGSSSS-SSYGSGRRF
> HSHNRNPA        3961 GGTATGGT  Intron 9       CAGGTgtggtaaa aatgagaat
>                       <1-----[3962   :   4251]-1>  gaggcggg ggagggggt
>                                                    ctctcccc tctctcaat
>
>
> //
> Gene 1
> Gene 1386 4304
>   Exon 1386 1493 phase 0
>      Supporting 1386 1493 26 61
>   Exon 1789 1935 phase 0
>      Supporting 1789 1935 62 110
>   Exon 2084 2294 phase 0
>      Supporting 2084 2293 111 180
>   Exon 2388 2445 phase 1
>      Supporting 2390 2443 182 199
>   Exon 2473 2480 phase 2
>      Supporting 2474 2479 201 202
>   Exon 2567 2663 phase 1
>      Supporting 2569 2661 204 234
>   Exon 2792 2868 phase 2
>      Supporting 2793 2867 235 259
>   Exon 3109 3228 phase 1
>      Supporting 3111 3185 261 285
>      Supporting 3192 3227 286 297
>   Exon 3806 3961 phase 1
>      Supporting 3808 3828 298 304
>      Supporting 3835 3855 305 311
>      Supporting 3859 3891 312 322
>      Supporting 3892 3960 324 346
>   Exon 4252 4304 phase 1
>      Supporting 4254 4277 348 355
>      Supporting 4278 4304 357 365
> //
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From jason.stajich at duke.edu  Thu Sep 29 22:02:11 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Thu Sep 29 22:00:55 2005
Subject: [Bioperl-l] protdist changes
Message-ID: 

George are you running phylip 3.61 ?

The order of distance methods for me is:

Protein distance algorithm, version 3.61

Settings for this run:
   P  Use JTT, PMB, PAM, Kimura, categories model?  Jones-Taylor- 
Thornton matrix
   G  Gamma distribution of rates among positions?  No
   C           One category of substitution rates?  Yes
   W                    Use weights for positions?  No
   M                   Analyze multiple data sets?  No
   I                  Input sequences interleaved?  Yes
   0                 Terminal type (IBM PC, ANSI)?  ANSI
   1            Print out the data at start of run  No
   2          Print indications of progress of run  Yes


Which means in the PhylipConf.pm file would need to be this:
       'MODEL'  => {
           'PMB'        =>"P\n",
           'PAM'        =>"P\nP\n",
           'KIMURA'     =>"P\nP\nP\n",
           'CAT'        =>"P\nP\nP\nP\n",
           'JTT'        =>"Y\n",
}

I've checked this in, let me know if it works?


-jason
--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From sdshlxh at gmail.com  Thu Sep 29 19:35:52 2005
From: sdshlxh at gmail.com (Ping Yao)
Date: Thu Sep 29 23:28:21 2005
Subject: [Bioperl-l] HOW TO REMOTE BLAST UCSC DATABASE ?
Message-ID: 

Hi,group:
Dose anyone know how to remote blast UCSC Blat database by perl or bioperl ?

PING

From hlapp at gmx.net  Fri Sep 30 01:49:51 2005
From: hlapp at gmx.net (Hilmar Lapp)
Date: Fri Sep 30 01:56:27 2005
Subject: [Bioperl-l] RC3 candidates
In-Reply-To: <987E70F7-86CA-4243-9C6B-1A7C821C0F5C@duke.edu>
References: <987E70F7-86CA-4243-9C6B-1A7C821C0F5C@duke.edu>
Message-ID: 


On Sep 29, 2005, at 6:36 AM, Jason Stajich wrote:

> (BTW Hilmar are you interested in bioperl-db being also tagged as 
> 1.5.X and released?)

Not sure (tag) and yes (release). I.e., the question is whether 
bioperl-db releases should be numbered the same as Bioperl, or receive 
its own release numbering.

(The BioSQL release is also imminent to semi-coincide w/ the paper, but 
will be called 1.0.)

	-hilmar
-- 
-------------------------------------------------------------
Hilmar Lapp                            email: lapp at gnf.org
GNF, San Diego, Ca. 92121              phone: +1-858-812-1757
-------------------------------------------------------------


From Marc.Logghe at DEVGEN.com  Fri Sep 30 06:38:28 2005
From: Marc.Logghe at DEVGEN.com (Marc Logghe)
Date: Fri Sep 30 06:50:33 2005
Subject: [Bioperl-l] Issue with Bio::Index::AbstractSeq::fetch
Message-ID: <0C528E3670D8CE4B8E013F6749231AA62F55CF@ANTARESIA.be.devgen.com>

Hi all,
We bumped into an issue with the fetch() method of
Bio::Index::AbstractSeq. The gi number gets lost when you fetch it from
an indexed genbank database. When you fetch the very same record from a
the genbank flat file using Bio::SeqIO directly, the primary_id is set
to the GI number correctly.
The problem is obvious when you look at the fetch() method:
sub fetch {
    my( $self, $id ) = @_;
    my $db = $self->db();
    my $seq;

    if (my $rec = $db->{ $id }) {
        my ($file, $begin) = $self->unpack_record( $rec );
        
        # Get the (possibly cached) SeqIO object
        my $seqio = $self->_get_SeqIO_object( $file );
        my $fh = $seqio->_fh();

        # move to start of record
        #$begin-- if( $^O =~ /mswin/i); # workaround for Win DB_File bug
        seek($fh, $begin, 0);
        
        $seq = $seqio->next_seq();
    }

    # we essentially assumme that the primary_id for the database
    # is the display_id
    $seq->primary_id($seq->display_id()) if( defined $seq && ref($seq)
&&
 
$seq->isa('Bio::PrimarySeqI') );

    return $seq;
}


You can see that the gi number (goes into primary_id) is overwritten by
the display_id.
I don't know what is de desired behaviour, actually.
I would just do
$seq->primary_id($seq->display_id()) if($seq->primary_id);
Is that OK ?
Cheers,
Marc


From Marc.Logghe at DEVGEN.com  Fri Sep 30 08:32:47 2005
From: Marc.Logghe at DEVGEN.com (Marc Logghe)
Date: Fri Sep 30 08:32:45 2005
Subject: [Bioperl-l] Issue with Bio::Index::AbstractSeq::fetch
Message-ID: <0C528E3670D8CE4B8E013F6749231AA62F55D5@ANTARESIA.be.devgen.com>

> You can see that the gi number (goes into primary_id) is 
> overwritten by the display_id.
> I don't know what is de desired behaviour, actually.
> I would just do
> $seq->primary_id($seq->display_id()) if($seq->primary_id); Is 
I meant 
$seq->primary_id($seq->display_id()) unless($seq->primary_id);

From jason.stajich at duke.edu  Fri Sep 30 08:44:40 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Fri Sep 30 08:43:27 2005
Subject: [Bioperl-l] RC3 candidates
In-Reply-To: 
References: <987E70F7-86CA-4243-9C6B-1A7C821C0F5C@duke.edu>
	
Message-ID: <3BA04920-9F07-4D7A-BF1F-24EC2A74175C@duke.edu>

We can call it 0.9 if it is not quite ready to be the release for the  
paper.   I guess I mean do you want it to go out at the same time as  
we make this dev release regardless of what we call it.

-j
On Sep 30, 2005, at 1:49 AM, Hilmar Lapp wrote:

>
> On Sep 29, 2005, at 6:36 AM, Jason Stajich wrote:
>
>
>> (BTW Hilmar are you interested in bioperl-db being also tagged as  
>> 1.5.X and released?)
>>
>
> Not sure (tag) and yes (release). I.e., the question is whether  
> bioperl-db releases should be numbered the same as Bioperl, or  
> receive its own release numbering.
>
> (The BioSQL release is also imminent to semi-coincide w/ the paper,  
> but will be called 1.0.)
>
>     -hilmar
> -- 
> -------------------------------------------------------------
> Hilmar Lapp                            email: lapp at gnf.org
> GNF, San Diego, Ca. 92121              phone: +1-858-812-1757
> -------------------------------------------------------------
>
>
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From t-nakazato at muj.biglobe.ne.jp  Fri Sep 30 07:53:18 2005
From: t-nakazato at muj.biglobe.ne.jp (t-nakazato@muj.biglobe.ne.jp)
Date: Fri Sep 30 09:00:33 2005
Subject: [Bioperl-l] can't parse GenBank correctly (SeqIO or included
	modules)
Message-ID: <20050930205318.UPQDC0A82745.C71F0C8A@wpop.biglobe.ne.jp>

Hi,

I'll report the case that BioPerl can't parse GenBank file
correctly.
BioPerl (SeqIO or included modules) confuses REMARK and PUBMED
line in GenBank file.
I'm running Ver.1.5 on RedHat 9.


I wrote script as follows to retrieve PMID from GenBank file.

-----
#!/usr/bin/perl

use Bio::SeqIO;

my $file_in = shift;

my $in_obj  = Bio::SeqIO->new( -file   => "$file_in",
                               -format => "GenBank" );

while ( my $each_obj = $in_obj->next_seq) {
    @ref_objarray = $each_obj->annotation->get_Annotations("reference");

    foreach $ref_obj (@ref_objarray) {
        print $ref_obj->pubmed();
    }
}
-----

Most of GenBank file is parsed correctly, but I can't get PMID
from AC091629 or AC002397 (GenBank Accession No.).  (Nothing is
printed.)


Original GenBank file is as follows.
(in the case of AC091629)

-----
...
REFERENCE   1  (bases 1 to 161334)
  AUTHORS   Poorkaj,P., Kas,A., D'Souza,I., Zhou,Y., Pham,Q., Stone,M.,
            Olson,M.V. and Schellenberg,G.D.
  TITLE     A genomic sequence analysis of the mouse and human
            microtubule-associated protein tau
  JOURNAL   Mamm. Genome 12 (9), 700-712 (2001)
  REMARK    Contact: Gerald D. Schellenberg (zachdad@u.washington.edu)
   PUBMED   11641718
...
-----


So, I'll try "print $ref_obj->comment();".

-----
Contact: Gerald D. Schellenberg (zachdad@u.washington.edu) PUBMED   11641718
-----

I checked BioPerl confuses "comment" and "pubmed" in $each_obj
(in my script, SeqIO object) with Data::Dumper.


Ver.1.4 confuses JOURNAL and PUBMED line.
This problem was fixed in 1.5, but it seems to remain.


Best regards,
Takeru


From amackey at pcbi.upenn.edu  Fri Sep 30 08:53:49 2005
From: amackey at pcbi.upenn.edu (Aaron J. Mackey)
Date: Fri Sep 30 10:32:16 2005
Subject: [Bioperl-l] RC3 candidates
In-Reply-To: <3BA04920-9F07-4D7A-BF1F-24EC2A74175C@duke.edu>
References: <987E70F7-86CA-4243-9C6B-1A7C821C0F5C@duke.edu>
	
	<3BA04920-9F07-4D7A-BF1F-24EC2A74175C@duke.edu>
Message-ID: <7957CF35-1F34-402C-8758-08FE7F25DAC9@pcbi.upenn.edu>

I would highly recommend that stuff in the bioperl-* namespace be co- 
numbered, so that we can simply say BioPerl 1.5.1 and know what we're  
talking about, regardless of the CVS packaging.  BioSQL, an  
independent project, can have any numbering it desires.

This is akin to, say, MySQL releases that get broken into mysql- 
server, mysql-client, mysql-libraries, mysql-devel, etc. -- they all  
get the same version number (regardless of whether there have been  
changes), but you may choose to only install some of them.

-Aaron

On Sep 30, 2005, at 8:44 AM, Jason Stajich wrote:

> We can call it 0.9 if it is not quite ready to be the release for  
> the paper.   I guess I mean do you want it to go out at the same  
> time as we make this dev release regardless of what we call it.
>
> -j
> On Sep 30, 2005, at 1:49 AM, Hilmar Lapp wrote:
>
>
>>
>> On Sep 29, 2005, at 6:36 AM, Jason Stajich wrote:
>>
>>
>>
>>> (BTW Hilmar are you interested in bioperl-db being also tagged as  
>>> 1.5.X and released?)
>>>
>>>
>>
>> Not sure (tag) and yes (release). I.e., the question is whether  
>> bioperl-db releases should be numbered the same as Bioperl, or  
>> receive its own release numbering.
>>
>> (The BioSQL release is also imminent to semi-coincide w/ the  
>> paper, but will be called 1.0.)
>>
>>     -hilmar
>> -- 
>> -------------------------------------------------------------
>> Hilmar Lapp                            email: lapp at gnf.org
>> GNF, San Diego, Ca. 92121              phone: +1-858-812-1757
>> -------------------------------------------------------------
>>
>>
>>
>>
>
> --
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
>
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Aaron J. Mackey, Ph.D.
Project Manager, ApiDB Bioinformatics Resource Center
Penn Genomics Institute, University of Pennsylvania
email:  amackey@pcbi.upenn.edu
office: 215-898-1205 (Goddard) / 215-746-7018 (PCBI)
fax:    215-746-6697
postal: Penn Genomics Institute
         Goddard Labs 212
         415 S. University Avenue
         Philadelphia, PA  19104-6017


From mseewald at gmail.com  Fri Sep 30 08:31:15 2005
From: mseewald at gmail.com (Michael Seewald)
Date: Fri Sep 30 11:17:51 2005
Subject: [Bioperl-l] Re: entrezgene binary ASN
In-Reply-To: <433006AE.5040406@utk.edu>
References: <432B16DC.6040901@utk.edu>
	 <433006AE.5040406@utk.edu>
Message-ID: 

Hi Stefan,

There are ways to capture these errors. Perl exception handling might
be way to do it.

On the other hand: Wouldn"t incomplete .gz downloads throw an error
right away? I have to check (but can't right now).

Michael

On 9/20/05, Stefan Kirov  wrote:
> Michael,
> What if gene2xml fails (incomplete downloads, etc.)? I would prefer to
> keep it separate, but I see some people would prefer your way. My
> intention was not to rewrite the parser- it should work fine on the
> converted ags file. Thanks for the contribution!
> Stefan
>
> Michael Seewald wrote:
>
> >
> > Hi Stefan,
> >
> > The most convenient way would be to open it as a pipe:
> >
> > my $parser = Bio::ASN1::EntrezGene->new('file' => "gene2xml -i
> > Homo_sapiens.ags.gz -c -x -b | ");
> > while(my $result = $parser->next_seq) {
> > #...
> > }
> >
> > It may be actually faster than before, because you save disk I/O. And
> > even better, there is no need to rewrite the parsers.
> >
> > Best wishes,
> > Michael
> >
> >
> > On 9/16/05, *Stefan Kirov* >
> > wrote:
> >
> >     NCBI provides now only the binary ASN format. Entrezgene parser
> >     will not
> >     parse it, but you can convert with gene2xml:
> >
> >     RT - Shiryayev, Sergey (NIH/NLM/NCBI) wrote:
> >
> >
> >     >>Stefan,
> >     >>
> >     >>Try this:
> >     >>
> >     >>./gene2xml -i All_Data.ags.gz -c -x -b | more
> >     >>
> >     >>
> >     >>Sergey Shiryayev
> >     >>NCBI Contractor
> >     >
> >     Note that you shoul proceed the gzipped file.
> >     Stefan
> >     _______________________________________________
> >     Bioperl-l mailing list
> >     Bioperl-l@portal.open-bio.org 
> >     http://portal.open-bio.org/mailman/listinfo/bioperl-l
> >     
> >
> >
> > --
> > Dr. Michael Seewald
> > Bioinformatics
> > Bayer HealthCare AG
>
>
> --
> Stefan Kirov, Ph.D.
> University of Tennessee/Oak Ridge National Laboratory
> 5700 bldg, PO BOX 2008 MS6164
> Oak Ridge TN 37831-6164
> USA
> tel +865 576 5120
> fax +865-576-5332
> e-mail: skirov@utk.edu
> sao@ornl.gov
>
> "And the wars go on with brainwashed pride
> For the love of God and our human rights
> And all these things are swept aside"
>
>


--
Dr. Michael Seewald
Bioinformatics
Bayer HealthCare AG

From brian_osborne at cognia.com  Fri Sep 30 11:29:05 2005
From: brian_osborne at cognia.com (Brian Osborne)
Date: Fri Sep 30 11:29:05 2005
Subject: [Bioperl-l] can't parse GenBank correctly (SeqIO or included
	modules)
In-Reply-To: <20050930205318.UPQDC0A82745.C71F0C8A@wpop.biglobe.ne.jp>
Message-ID: 

Takeru,

Please submit this as a bug to http://bugzilla.bioperl.org, bugs sent to
bioperl-l and not recorded tend to get lost.


Brian O.



On 9/30/05 7:53 AM, "t-nakazato@muj.biglobe.ne.jp"
 wrote:



From mingyi.liu at gpc-biotech.com  Fri Sep 30 11:28:21 2005
From: mingyi.liu at gpc-biotech.com (Mingyi Liu)
Date: Fri Sep 30 11:39:59 2005
Subject: [Bioperl-l] Re: entrezgene binary ASN
In-Reply-To: 
References: <432B16DC.6040901@utk.edu>	
	<433006AE.5040406@utk.edu>
	
Message-ID: <433D5995.3060204@gpc-biotech.com>

I'll try to handle it transparently (not difficult) and make sure it 
doesn't break anything.  Anyway this is only related to 
Bio::ASN1::EntrezGene, not Bio::SeqIO::entrezgene, which should not be 
concerned about the low level I/O in our structure.

Mingyi

Michael Seewald wrote:

>Hi Stefan,
>
>There are ways to capture these errors. Perl exception handling might
>be way to do it.
>
>On the other hand: Wouldn"t incomplete .gz downloads throw an error
>right away? I have to check (but can't right now).
>
>Michael
>
>On 9/20/05, Stefan Kirov  wrote:
>  
>
>>Michael,
>>What if gene2xml fails (incomplete downloads, etc.)? I would prefer to
>>keep it separate, but I see some people would prefer your way. My
>>intention was not to rewrite the parser- it should work fine on the
>>converted ags file. Thanks for the contribution!
>>Stefan
>>
>>Michael Seewald wrote:
>>
>>    
>>
>>>Hi Stefan,
>>>
>>>The most convenient way would be to open it as a pipe:
>>>
>>>my $parser = Bio::ASN1::EntrezGene->new('file' => "gene2xml -i
>>>Homo_sapiens.ags.gz -c -x -b | ");
>>>while(my $result = $parser->next_seq) {
>>>#...
>>>}
>>>
>>>It may be actually faster than before, because you save disk I/O. And
>>>even better, there is no need to rewrite the parsers.
>>>
>>>Best wishes,
>>>Michael
>>>
>>>
>>>On 9/16/05, *Stefan Kirov* >
>>>wrote:
>>>
>>>    NCBI provides now only the binary ASN format. Entrezgene parser
>>>    will not
>>>    parse it, but you can convert with gene2xml:
>>>
>>>    RT - Shiryayev, Sergey (NIH/NLM/NCBI) wrote:
>>>
>>>
>>>    >>Stefan,
>>>    >>
>>>    >>Try this:
>>>    >>
>>>    >>./gene2xml -i All_Data.ags.gz -c -x -b | more
>>>    >>
>>>    >>
>>>    >>Sergey Shiryayev
>>>    >>NCBI Contractor
>>>    >
>>>    Note that you shoul proceed the gzipped file.
>>>    Stefan
>>>    _______________________________________________
>>>    Bioperl-l mailing list
>>>    Bioperl-l@portal.open-bio.org 
>>>    http://portal.open-bio.org/mailman/listinfo/bioperl-l
>>>    
>>>
>>>
>>>--
>>>Dr. Michael Seewald
>>>Bioinformatics
>>>Bayer HealthCare AG
>>>      
>>>
>>--
>>Stefan Kirov, Ph.D.
>>University of Tennessee/Oak Ridge National Laboratory
>>5700 bldg, PO BOX 2008 MS6164
>>Oak Ridge TN 37831-6164
>>USA
>>tel +865 576 5120
>>fax +865-576-5332
>>e-mail: skirov@utk.edu
>>sao@ornl.gov
>>
>>"And the wars go on with brainwashed pride
>>For the love of God and our human rights
>>And all these things are swept aside"
>>
>>
>>    
>>
>
>
>--
>Dr. Michael Seewald
>Bioinformatics
>Bayer HealthCare AG
>
>_______________________________________________
>Bioperl-l mailing list
>Bioperl-l@portal.open-bio.org
>http://portal.open-bio.org/mailman/listinfo/bioperl-l
>  
>


From hlapp at gmx.net  Fri Sep 30 12:04:18 2005
From: hlapp at gmx.net (Hilmar Lapp)
Date: Fri Sep 30 12:05:13 2005
Subject: [Bioperl-l] RC3 candidates
In-Reply-To: <3BA04920-9F07-4D7A-BF1F-24EC2A74175C@duke.edu>
References: <987E70F7-86CA-4243-9C6B-1A7C821C0F5C@duke.edu>
	
	<3BA04920-9F07-4D7A-BF1F-24EC2A74175C@duke.edu>
Message-ID: 

Yes - let me know what you want me to do. It's stable and passes all 
tests against the bioperl main trunk, at least last time I checked. The 
only parts not supported yet are feature graphs and round-tripping 
fuzzy locations (they become simple locs).

	-hilmar

On Sep 30, 2005, at 5:44 AM, Jason Stajich wrote:

> We can call it 0.9 if it is not quite ready to be the release for the 
> paper.   I guess I mean do you want it to go out at the same time as 
> we make this dev release regardless of what we call it.
>
> -j
> On Sep 30, 2005, at 1:49 AM, Hilmar Lapp wrote:
>
>>
>> On Sep 29, 2005, at 6:36 AM, Jason Stajich wrote:
>>
>>
>>> (BTW Hilmar are you interested in bioperl-db being also tagged as 
>>> 1.5.X and released?)
>>>
>>
>> Not sure (tag) and yes (release). I.e., the question is whether 
>> bioperl-db releases should be numbered the same as Bioperl, or 
>> receive its own release numbering.
>>
>> (The BioSQL release is also imminent to semi-coincide w/ the paper, 
>> but will be called 1.0.)
>>
>>     -hilmar
>> -- 
>> -------------------------------------------------------------
>> Hilmar Lapp                            email: lapp at gnf.org
>> GNF, San Diego, Ca. 92121              phone: +1-858-812-1757
>> -------------------------------------------------------------
>>
>>
>>
>
> --
> Jason Stajich
> Duke University
> http://www.duke.edu/~jes12
>
>
>
-- 
-------------------------------------------------------------
Hilmar Lapp                            email: lapp at gnf.org
GNF, San Diego, Ca. 92121              phone: +1-858-812-1757
-------------------------------------------------------------


From mingyi.liu at gpc-biotech.com  Fri Sep 30 12:23:34 2005
From: mingyi.liu at gpc-biotech.com (Mingyi Liu)
Date: Fri Sep 30 12:24:12 2005
Subject: [Bioperl-l] Re: entrezgene binary ASN
In-Reply-To: 
References: <432B16DC.6040901@utk.edu>	
	<433006AE.5040406@utk.edu>
	
Message-ID: <433D6686.3000301@gpc-biotech.com>

I was half way through adding the support for pipe in 
Bio::ASN1::EntrezGene before I realized that this is not a good 
solution.  The problem I have with the pipe thing is that it merely 
added more troubles and did not really save anything.

I mean, one superficial advantage of using pipe directly would be that 
you don't need to first launch gene2xml.  But 1. Nobody needs to 
manually launch gene2xml.  In any shell/perl script that does the 
automatic download of the NCBI binary ASN files, just add a line to 
launch gene2xml right after download.  2. Having EntrezGene module deal 
with it transparently would force it to deal with multiple failure 
possibilities (no gene2xml installed? gene2xml choked? ...), let alone 
hassles of changing syntax in input_file.  Simply put, it's not worth it.

Another proposed advantage is saving disk I/O, in a sense it does (the 
gzipped binary files are much smaller), but that does not necessarily 
lead to shorter processing time since the time gene2xml doing its work 
on the fly should be counted as well.  Not to mention if gene2xml choked 
for whatever reason.

A major disadvantage of using pipe would be doing any sort of seeking 
operation on the file - the performance would be abysmal.  For indexing 
and indexed entry retrieval, one simply have to do the pre-conversion of 
those binary gzipped files.

As such I feel there are compelling reasons for one to first convert the 
binary gzip files to text files, then use the existing Bioperl modules 
to parse, index, retrieve.  Any further input/discussions on the matter 
is welcomed!

Thanks,

Mingyi

Michael Seewald wrote:

>Hi Stefan,
>
>There are ways to capture these errors. Perl exception handling might
>be way to do it.
>
>On the other hand: Wouldn"t incomplete .gz downloads throw an error
>right away? I have to check (but can't right now).
>
>Michael
>


From hlapp at gmx.net  Fri Sep 30 12:27:02 2005
From: hlapp at gmx.net (Hilmar Lapp)
Date: Fri Sep 30 12:36:16 2005
Subject: [Bioperl-l] RC3 candidates
In-Reply-To: <7957CF35-1F34-402C-8758-08FE7F25DAC9@pcbi.upenn.edu>
References: <987E70F7-86CA-4243-9C6B-1A7C821C0F5C@duke.edu>
	
	<3BA04920-9F07-4D7A-BF1F-24EC2A74175C@duke.edu>
	<7957CF35-1F34-402C-8758-08FE7F25DAC9@pcbi.upenn.edu>
Message-ID: <94187045705dcc6a55ee3ed587137908@gmx.net>

I'm sympathetic to your point - my only concern is that people get to 
believe that both packages have the same degree of maturity, in terms 
of time it's been around, level of documentation, mutual coverage etc.

This is what is different from the mysql-* packages, which get broken 
out from the same codebase I suppose.

Having said that, bioperl-db isn't really premature anymore. There's 
plenty of tests, and I use it on a pretty frequent basis without 
problems. The main deficiency is documentation of the more advanced 
usage for object-level querying (and that's where there are bugs too). 
So I'm ok with seeing my concern overridden if people think that the 
benefits of a consistent release numbering across the board outweighs 
the risk of possibly false expectations w.r.t. documentation.

	-hilmar

On Sep 30, 2005, at 5:53 AM, Aaron J. Mackey wrote:

> I would highly recommend that stuff in the bioperl-* namespace be 
> co-numbered, so that we can simply say BioPerl 1.5.1 and know what 
> we're talking about, regardless of the CVS packaging.  BioSQL, an 
> independent project, can have any numbering it desires.
>
> This is akin to, say, MySQL releases that get broken into 
> mysql-server, mysql-client, mysql-libraries, mysql-devel, etc. -- they 
> all get the same version number (regardless of whether there have been 
> changes), but you may choose to only install some of them.
>
> -Aaron
>
> On Sep 30, 2005, at 8:44 AM, Jason Stajich wrote:
>
>> We can call it 0.9 if it is not quite ready to be the release for the 
>> paper.   I guess I mean do you want it to go out at the same time as 
>> we make this dev release regardless of what we call it.
>>
>> -j
>> On Sep 30, 2005, at 1:49 AM, Hilmar Lapp wrote:
>>
>>
>>>
>>> On Sep 29, 2005, at 6:36 AM, Jason Stajich wrote:
>>>
>>>
>>>
>>>> (BTW Hilmar are you interested in bioperl-db being also tagged as 
>>>> 1.5.X and released?)
>>>>
>>>>
>>>
>>> Not sure (tag) and yes (release). I.e., the question is whether 
>>> bioperl-db releases should be numbered the same as Bioperl, or 
>>> receive its own release numbering.
>>>
>>> (The BioSQL release is also imminent to semi-coincide w/ the paper, 
>>> but will be called 1.0.)
>>>
>>>     -hilmar
>>> -- 
>>> -------------------------------------------------------------
>>> Hilmar Lapp                            email: lapp at gnf.org
>>> GNF, San Diego, Ca. 92121              phone: +1-858-812-1757
>>> -------------------------------------------------------------
>>>
>>>
>>>
>>>
>>
>> --
>> Jason Stajich
>> Duke University
>> http://www.duke.edu/~jes12
>>
>>
>> _______________________________________________
>> Bioperl-l mailing list
>> Bioperl-l@portal.open-bio.org
>> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>>
>
> --
> Aaron J. Mackey, Ph.D.
> Project Manager, ApiDB Bioinformatics Resource Center
> Penn Genomics Institute, University of Pennsylvania
> email:  amackey@pcbi.upenn.edu
> office: 215-898-1205 (Goddard) / 215-746-7018 (PCBI)
> fax:    215-746-6697
> postal: Penn Genomics Institute
>         Goddard Labs 212
>         415 S. University Avenue
>         Philadelphia, PA  19104-6017
>
>
>
-- 
-------------------------------------------------------------
Hilmar Lapp                            email: lapp at gnf.org
GNF, San Diego, Ca. 92121              phone: +1-858-812-1757
-------------------------------------------------------------


From sdavis2 at mail.nih.gov  Fri Sep 30 12:28:43 2005
From: sdavis2 at mail.nih.gov (Sean Davis)
Date: Fri Sep 30 13:01:44 2005
Subject: [Bioperl-l] HOW TO REMOTE BLAST UCSC DATABASE ?
In-Reply-To: 
Message-ID: 

On 9/29/05 7:35 PM, "Ping Yao"  wrote:

> Hi,group:
> Dose anyone know how to remote blast UCSC Blat database by perl or bioperl ?

You can use something like WWW::Mechanize to do this, constructing the
request by hand and then submitting it.  However, I would NOT recommend
doing this if you have more than a few sequences.  They have guidelines
about how often you can hit their site and will block access.

The faster way to do this is to download blat and run it locally.  It is
very fast and there are executables available for multiple platforms.

Sean

From hartzell at kestrel.alerce.com  Fri Sep 30 13:12:36 2005
From: hartzell at kestrel.alerce.com (George Hartzell)
Date: Fri Sep 30 13:14:47 2005
Subject: [Bioperl-l] RC3 candidates
In-Reply-To: <7957CF35-1F34-402C-8758-08FE7F25DAC9@pcbi.upenn.edu>
References: <987E70F7-86CA-4243-9C6B-1A7C821C0F5C@duke.edu>
	
	<3BA04920-9F07-4D7A-BF1F-24EC2A74175C@duke.edu>
	<7957CF35-1F34-402C-8758-08FE7F25DAC9@pcbi.upenn.edu>
Message-ID: <17213.29188.625806.994766@satchel.alerce.com>

Aaron J. Mackey writes:
 > I would highly recommend that stuff in the bioperl-* namespace be co- 
 > numbered, so that we can simply say BioPerl 1.5.1 and know what we're  
 > talking about, regardless of the CVS packaging.  BioSQL, an  
 > independent project, can have any numbering it desires.
 > [...]

Whatever version number you choose, it'd be really useful to assign a
tag in the repository that marks the release as part of the great
bioperl release of 1.5.1.

g.

From jason.stajich at duke.edu  Fri Sep 30 13:16:28 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Fri Sep 30 13:16:10 2005
Subject: [Bioperl-l] RC3 candidates
In-Reply-To: <17213.29188.625806.994766@satchel.alerce.com>
References: <987E70F7-86CA-4243-9C6B-1A7C821C0F5C@duke.edu>
	
	<3BA04920-9F07-4D7A-BF1F-24EC2A74175C@duke.edu>
	<7957CF35-1F34-402C-8758-08FE7F25DAC9@pcbi.upenn.edu>
	<17213.29188.625806.994766@satchel.alerce.com>
Message-ID: <58BA3273-1AC3-4C3A-96CE-6B75B773AB34@duke.edu>

Oh we will for sure, not to worry.  I just haven't been tagging the  
RC because we are going through them pretty fast.

-jason
On Sep 30, 2005, at 1:12 PM, George Hartzell wrote:

> Aaron J. Mackey writes:
>
>> I would highly recommend that stuff in the bioperl-* namespace be co-
>> numbered, so that we can simply say BioPerl 1.5.1 and know what we're
>> talking about, regardless of the CVS packaging.  BioSQL, an
>> independent project, can have any numbering it desires.
>> [...]
>>
>
> Whatever version number you choose, it'd be really useful to assign a
> tag in the repository that marks the release as part of the great
> bioperl release of 1.5.1.
>
> g.
>
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12


From mseewald at gmail.com  Fri Sep 30 14:46:21 2005
From: mseewald at gmail.com (Michael Seewald)
Date: Fri Sep 30 14:46:24 2005
Subject: [Bioperl-l] Re: entrezgene binary ASN
In-Reply-To: <433D6686.3000301@gpc-biotech.com>
References: <432B16DC.6040901@utk.edu>
	 <433006AE.5040406@utk.edu>
	
	<433D6686.3000301@gpc-biotech.com>
Message-ID: 

Hi Mingyi,

I am not sure, what you mean. The piping (in my example) did already work
nicely, not for you?

With respect to gene2xml failures: This is nothing the module has to care
about. It *might* check for correct ASN1 syntax, but this is as much as I
would go. Otherwise, I would just try to make sure, that any errors gene2xml
throws are caught and passed on. It is the duty of the module and/or the
person running the script to watch STDERR output!

With respect to the indexing: Again I do not think this would break
anything. Both gunzipping and transforming with gene2xml are transparent to
the module. The index must not care about it! The indexer should recognize,
however, if the index has to be rebuilt. (This is something that some
bioperl modules have problems with AFAICR.)

With respect to disc i/o: This is definitely a time-saver as more and more
of us are running multi-CPU machines.

Just my 2p,
Michael


On 9/30/05, Mingyi Liu  wrote:
>
> I was half way through adding the support for pipe in
> Bio::ASN1::EntrezGene before I realized that this is not a good
> solution. The problem I have with the pipe thing is that it merely
> added more troubles and did not really save anything.
>
> I mean, one superficial advantage of using pipe directly would be that
> you don't need to first launch gene2xml. But 1. Nobody needs to
> manually launch gene2xml. In any shell/perl script that does the
> automatic download of the NCBI binary ASN files, just add a line to
> launch gene2xml right after download. 2. Having EntrezGene module deal
> with it transparently would force it to deal with multiple failure
> possibilities (no gene2xml installed? gene2xml choked? ...), let alone
> hassles of changing syntax in input_file. Simply put, it's not worth it.
>
> Another proposed advantage is saving disk I/O, in a sense it does (the
> gzipped binary files are much smaller), but that does not necessarily
> lead to shorter processing time since the time gene2xml doing its work
> on the fly should be counted as well. Not to mention if gene2xml choked
> for whatever reason.
>
> A major disadvantage of using pipe would be doing any sort of seeking
> operation on the file - the performance would be abysmal. For indexing
> and indexed entry retrieval, one simply have to do the pre-conversion of
> those binary gzipped files.
>
> As such I feel there are compelling reasons for one to first convert the
> binary gzip files to text files, then use the existing Bioperl modules
> to parse, index, retrieve. Any further input/discussions on the matter
> is welcomed!
>
> Thanks,
>
> Mingyi
>
> Michael Seewald wrote:
>
> >Hi Stefan,
> >
> >There are ways to capture these errors. Perl exception handling might
> >be way to do it.
> >
> >On the other hand: Wouldn"t incomplete .gz downloads throw an error
> >right away? I have to check (but can't right now).
> >
> >Michael
> >
>

--
Dr. Michael Seewald
Bioinformatics
Bayer HealthCare AG

From skirov at utk.edu  Fri Sep 30 15:06:43 2005
From: skirov at utk.edu (Stefan Kirov)
Date: Fri Sep 30 15:07:00 2005
Subject: [Bioperl-l] Re: entrezgene binary ASN
In-Reply-To: 
References: <432B16DC.6040901@utk.edu>
	
	<433006AE.5040406@utk.edu>
	
	<433D6686.3000301@gpc-biotech.com>
	
Message-ID: <433D8CC3.3000601@utk.edu>

Michael,
Sean Davis had a problem, similar to what Mingyi is describing... The 
problem is mixing two possible types of error is something I would not 
like to have myself. Don't forger that many people that may use the 
parser are not really that proficient (and should not be).
As for the multiprocessor... You can distribute the parsing based on the 
species files (All_Data takes >12 hours to parse anyway), which will 
lead to far better results (especially if you have couple of machines 
with few processors each).
As for the indexing- if you have to rebuilt the index of All_Data... it 
will be a while. Better to have static file I think (if I understood 
correctly).

Best regars,
Stefan

Michael Seewald wrote:

>
> Hi Mingyi,
>
> I am not sure, what you mean. The piping (in my example) did already 
> work nicely, not for you?
>
> With respect to gene2xml failures: This is nothing the module has to 
> care about. It *might* check for correct ASN1 syntax, but this is as 
> much as I would go. Otherwise, I would just try to make sure, that any 
> errors gene2xml throws are caught and passed on. It is the duty of the 
> module and/or the person running the script to watch STDERR output!
>
> With respect to the indexing: Again I do not think this would break 
> anything. Both gunzipping and transforming with gene2xml are 
> transparent to the module. The index must not care about it! The 
> indexer should recognize, however, if the index has to be rebuilt. 
> (This is something that some bioperl modules have problems with AFAICR.)
>
> With respect to disc i/o: This is definitely a time-saver as more and 
> more of us are running multi-CPU machines.
>
> Just my 2p,
> Michael
>
>
> On 9/30/05, *Mingyi Liu*  > wrote:
>
>     I was half way through adding the support for pipe in
>     Bio::ASN1::EntrezGene before I realized that this is not a good
>     solution.  The problem I have with the pipe thing is that it merely
>     added more troubles and did not really save anything.
>
>     I mean, one superficial advantage of using pipe directly would be that
>     you don't need to first launch gene2xml.  But 1. Nobody needs to
>     manually launch gene2xml.  In any shell/perl script that does the
>     automatic download of the NCBI binary ASN files, just add a line to
>     launch gene2xml right after download.  2. Having EntrezGene module
>     deal
>     with it transparently would force it to deal with multiple failure
>     possibilities (no gene2xml installed? gene2xml choked? ...), let alone
>     hassles of changing syntax in input_file.  Simply put, it's not
>     worth it.
>
>     Another proposed advantage is saving disk I/O, in a sense it does (the
>     gzipped binary files are much smaller), but that does not necessarily
>     lead to shorter processing time since the time gene2xml doing its work
>     on the fly should be counted as well.  Not to mention if gene2xml
>     choked
>     for whatever reason.
>
>     A major disadvantage of using pipe would be doing any sort of seeking
>     operation on the file - the performance would be abysmal.  For
>     indexing
>     and indexed entry retrieval, one simply have to do the
>     pre-conversion of
>     those binary gzipped files.
>
>     As such I feel there are compelling reasons for one to first
>     convert the
>     binary gzip files to text files, then use the existing Bioperl modules
>     to parse, index, retrieve.  Any further input/discussions on the
>     matter
>     is welcomed!
>
>     Thanks,
>
>     Mingyi
>
>     Michael Seewald wrote:
>
>     >Hi Stefan,
>     >
>     >There are ways to capture these errors. Perl exception handling might
>     >be way to do it.
>     >
>     >On the other hand: Wouldn"t incomplete .gz downloads throw an error
>     >right away? I have to check (but can't right now).
>     >
>     >Michael
>     >
>
>
> -- 
> Dr. Michael Seewald
> Bioinformatics
> Bayer HealthCare AG


-- 
Stefan Kirov, Ph.D.
University of Tennessee/Oak Ridge National Laboratory
5700 bldg, PO BOX 2008 MS6164
Oak Ridge TN 37831-6164
USA
tel +865 576 5120
fax +865-576-5332
e-mail: skirov@utk.edu
sao@ornl.gov

"And the wars go on with brainwashed pride
For the love of God and our human rights
And all these things are swept aside"

From mingyi.liu at gpc-biotech.com  Fri Sep 30 15:16:05 2005
From: mingyi.liu at gpc-biotech.com (Mingyi Liu)
Date: Fri Sep 30 15:15:58 2005
Subject: [Bioperl-l] Re: entrezgene binary ASN
In-Reply-To: 
References: <432B16DC.6040901@utk.edu>	
	
	<433006AE.5040406@utk.edu>	
		
	<433D6686.3000301@gpc-biotech.com>
	
Message-ID: <433D8EF5.7000003@gpc-biotech.com>

Michael Seewald wrote:

>
> Hi Mingyi,
>
> I am not sure, what you mean. The piping (in my example) did already 
> work nicely, not for you?

I was gonna add support such that a gzipped file would automatically be 
considered binary ASN file and trigger the launch of gene2xml.  This way 
user does not have to worry about the syntax of launching gene2xml.  At 
the same time, user can still call the module with the pipe syntax you 
used.  I never said it wouldn't work.  But I thought you wanted the 
parsers to handle the pipe thing (after reading your previous mail, I 
found I missed the part where you said "no need to rewrite the 
parsers").  So I guess my justifications for not adding gene2xml-based 
binary ASN support in EntrezGene.pm is a moot point.  But the academic 
discussion continues ... :)

>
> With respect to gene2xml failures: This is nothing the module has to 
> care about. It *might* check for correct ASN1 syntax, but this is as 
> much as I would go. Otherwise, I would just try to make sure, that any 
> errors gene2xml throws are caught and passed on. It is the duty of the 
> module and/or the person running the script to watch STDERR output!

Sure, and that's of course already built in.

>
> With respect to the indexing: Again I do not think this would break 
> anything. Both gunzipping and transforming with gene2xml are 
> transparent to the module. The index must not care about it! The 
> indexer should recognize, however, if the index has to be rebuilt. 
> (This is something that some bioperl modules have problems with AFAICR.)
>
I didn't say indexing would break, but the performance of retrieval 
would be horrible.  That's why in most situations there's no need to use 
pipe - after all, any one who needs to use index & ID-based retrieval 
would convert the binary ASN to text file anyway (using a script, 
hopefully).

> With respect to disc i/o: This is definitely a time-saver as more and 
> more of us are running multi-CPU machines.

There would be some negligible savings.  The disk I/O itself takes very 
little time compared to the parsing (I've run benchmark before using the 
human entrezgene file).  So unless one needs to save disk space and only 
need to run entrezgene once (ever), I'd say converting to text file 
first would save more time.

Mingyi

From mseewald at gmail.com  Fri Sep 30 15:55:00 2005
From: mseewald at gmail.com (Michael Seewald)
Date: Fri Sep 30 15:54:52 2005
Subject: [Bioperl-l] Re: entrezgene binary ASN
In-Reply-To: <433D8EF5.7000003@gpc-biotech.com>
References: <432B16DC.6040901@utk.edu>
	 <433006AE.5040406@utk.edu>
	
	<433D6686.3000301@gpc-biotech.com>
	
	<433D8EF5.7000003@gpc-biotech.com>
Message-ID: 

On 9/30/05, Mingyi Liu  wrote:
>
> I didn't say indexing would break, but the performance of retrieval
> would be horrible. That's why in most situations there's no need to use
> pipe - after all, any one who needs to use index & ID-based retrieval
> would convert the binary ASN to text file anyway (using a script,
> hopefully).


Absolutely right, seeking would be horrible.

Best wishes,
Michael

PS: And thanks for providing this great parser!!

From golharam at umdnj.edu  Fri Sep 30 16:43:48 2005
From: golharam at umdnj.edu (Ryan Golhar)
Date: Fri Sep 30 17:43:32 2005
Subject: [Bioperl-l] How to read in FASTA formatted sequence without fasta
	header?
Message-ID: <016501c5c5ff$a91cdaa0$2f01a8c0@GOLHARMOBILE1>

I'm looking for the easier way to read in a fasta file that doesn't
contain the fasta header, ie the ">..." line.

I tried just specifying fasta, but then the first line of the sequence
is taken as the name of the sequence.  I also tried specifying raw, but
then only the first line is read.  

Is there any (easy) way to do this without reformatting the fasta file
or creating a new one?  Thanks,

Ryan

From rsucgang at bcm.tmc.edu  Fri Sep 30 17:59:29 2005
From: rsucgang at bcm.tmc.edu (Richard Sucgang, PhD)
Date: Fri Sep 30 18:21:49 2005
Subject: [Bioperl-l] How to read in FASTA formatted sequence without fasta
	header?
In-Reply-To: <016501c5c5ff$a91cdaa0$2f01a8c0@GOLHARMOBILE1>
References: <016501c5c5ff$a91cdaa0$2f01a8c0@GOLHARMOBILE1>
Message-ID: 


Well, maybe I am mistaken, but isn't the header line the item that  
makes a FASTA file a FASTA file?
As in, now you have a raw sequence.


On Sep 30, 2005, at 3:43 PM, Ryan Golhar wrote:

> I'm looking for the easier way to read in a fasta file that doesn't
> contain the fasta header, ie the ">..." line.
>
> I tried just specifying fasta, but then the first line of the sequence
> is taken as the name of the sequence.  I also tried specifying raw,  
> but
> then only the first line is read.
>
> Is there any (easy) way to do this without reformatting the fasta file
> or creating a new one?  Thanks,
>
> Ryan
From sdavis2 at mail.nih.gov  Fri Sep 30 18:06:52 2005
From: sdavis2 at mail.nih.gov (Sean Davis)
Date: Fri Sep 30 18:22:00 2005
Subject: [Bioperl-l] How to read in FASTA formatted sequence without
	fasta header?
In-Reply-To: <016501c5c5ff$a91cdaa0$2f01a8c0@GOLHARMOBILE1>
Message-ID: 

On 9/30/05 4:43 PM, "Ryan Golhar"  wrote:

> I'm looking for the easier way to read in a fasta file that doesn't
> contain the fasta header, ie the ">..." line.
> 
> I tried just specifying fasta, but then the first line of the sequence
> is taken as the name of the sequence.  I also tried specifying raw, but
> then only the first line is read.
> 
> Is there any (easy) way to do this without reformatting the fasta file
> or creating a new one?  Thanks,

Unfortunately, fasta format is NOT equal to strings of "actg".  Instead, it
includes the >... line.  Therefore, if you want to do anything using
fasta-based tools, then you really need fasta format.  I may stand
corrected, but I think the easiest thing to do is to write a quick piece of
code to insert the > lines with names like seq1, seq2, etc., if the
sequences do not have proper names.

Sean

From golharam at umdnj.edu  Fri Sep 30 19:16:42 2005
From: golharam at umdnj.edu (Ryan Golhar)
Date: Fri Sep 30 20:16:00 2005
Subject: [Bioperl-l] How to read in FASTA formatted sequence without
	fastaheader?
In-Reply-To: 
Message-ID: <016f01c5c615$0579ac00$2f01a8c0@GOLHARMOBILE1>

True.  Ok, so I have a raw sequence instead of fasta...when I try to
read in the sequence using raw format, it only reads in the first line.

I'm thinking of modifying the raw module and making a multilineraw
module that will stop reading on a newline or EOF.

I don't want to modify the actual files because they might screw up all
my other scripts.  I could write one to insert the fasta header in a tmp
file then concatente the sequence to the file, but it just doesn't seem
like a clean solution to me.



-----Original Message-----
From: bioperl-l-bounces@portal.open-bio.org
[mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Richard
Sucgang, PhD
Sent: Friday, September 30, 2005 5:59 PM
To: golharam@umdnj.edu
Cc: 'Bioperl List'
Subject: Re: [Bioperl-l] How to read in FASTA formatted sequence without
fastaheader?



Well, maybe I am mistaken, but isn't the header line the item that  
makes a FASTA file a FASTA file?
As in, now you have a raw sequence.


On Sep 30, 2005, at 3:43 PM, Ryan Golhar wrote:

> I'm looking for the easier way to read in a fasta file that doesn't 
> contain the fasta header, ie the ">..." line.
>
> I tried just specifying fasta, but then the first line of the sequence

> is taken as the name of the sequence.  I also tried specifying raw,
> but
> then only the first line is read.
>
> Is there any (easy) way to do this without reformatting the fasta file

> or creating a new one?  Thanks,
>
> Ryan
_______________________________________________
Bioperl-l mailing list
Bioperl-l@portal.open-bio.org
http://portal.open-bio.org/mailman/listinfo/bioperl-l

From jason.stajich at duke.edu  Fri Sep 30 23:12:54 2005
From: jason.stajich at duke.edu (Jason Stajich)
Date: Fri Sep 30 23:11:59 2005
Subject: [Bioperl-l] How to read in FASTA formatted sequence without
	fastaheader?
In-Reply-To: <016f01c5c615$0579ac00$2f01a8c0@GOLHARMOBILE1>
References: <016f01c5c615$0579ac00$2f01a8c0@GOLHARMOBILE1>
Message-ID: <6767588B-529B-4144-9AA6-8C3DCC7E0B33@duke.edu>


On Sep 30, 2005, at 7:16 PM, Ryan Golhar wrote:

> True.  Ok, so I have a raw sequence instead of fasta...when I try to
> read in the sequence using raw format, it only reads in the first  
> line.
>
> I'm thinking of modifying the raw module and making a multilineraw
> module that will stop reading on a newline or EOF.
>
Well technically will have to detect the presence of multiple  
consecutive newlines as it currently separates on single newlines,  
hence your problem.

Seems like it is easier to use a standard file format in the future  
(and dare I say *standard* for anyone who might come along after you  
on a project), but you could probably modify raw.pm locally to  
separate on multiline newline.

Thinking about this I'm not sure how much help SeqIO is.  You just  
need a function that will give you back Bio::PrimarySeq objectsm  
isn't much more complicated than this below.
If you just add this to your perl script you will be able to split a  
sequence on double newlines and use the 'raw' format.

use strict;
use Bio::SeqIO;
use Bio::SeqIO::raw;


sub Bio::SeqIO::raw::next_seq{
    my ($self,@args) = @_;
    local $_ = "\n\n";
    my $nextline = $self->_readline();
    if( !defined $nextline ){ return undef; }

    my $sequence = uc($nextline);
    $sequence =~ s/\W//g;

    return  $self->sequence_factory->create(-seq => $sequence);
}

# your perl code now that will eventually do a Bio::SeqIO->new(- 
format => 'raw', .... );

> I don't want to modify the actual files because they might screw up  
> all
> my other scripts.  I could write one to insert the fasta header in  
> a tmp
> file then concatente the sequence to the file, but it just doesn't  
> seem
> like a clean solution to me.
>
>
>
> -----Original Message-----
> From: bioperl-l-bounces@portal.open-bio.org
> [mailto:bioperl-l-bounces@portal.open-bio.org] On Behalf Of Richard
> Sucgang, PhD
> Sent: Friday, September 30, 2005 5:59 PM
> To: golharam@umdnj.edu
> Cc: 'Bioperl List'
> Subject: Re: [Bioperl-l] How to read in FASTA formatted sequence  
> without
> fastaheader?
>
>
>
> Well, maybe I am mistaken, but isn't the header line the item that
> makes a FASTA file a FASTA file?
> As in, now you have a raw sequence.
>
>
> On Sep 30, 2005, at 3:43 PM, Ryan Golhar wrote:
>
>
>> I'm looking for the easier way to read in a fasta file that doesn't
>> contain the fasta header, ie the ">..." line.
>>
>> I tried just specifying fasta, but then the first line of the  
>> sequence
>>
>
>
>> is taken as the name of the sequence.  I also tried specifying raw,
>> but
>> then only the first line is read.
>>
>> Is there any (easy) way to do this without reformatting the fasta  
>> file
>>
>
>
>> or creating a new one?  Thanks,
>>
>> Ryan
>>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>
> _______________________________________________
> Bioperl-l mailing list
> Bioperl-l@portal.open-bio.org
> http://portal.open-bio.org/mailman/listinfo/bioperl-l
>

--
Jason Stajich
Duke University
http://www.duke.edu/~jes12/


From kvddrift at earthlink.net  Fri Sep 30 22:57:10 2005
From: kvddrift at earthlink.net (Koen van der Drift)
Date: Fri Sep 30 23:29:45 2005
Subject: [Bioperl-l] RC3 candidates
In-Reply-To: <200509291419.j8TEJQnr004949@portal.open-bio.org>
References: <200509291419.j8TEJQnr004949@portal.open-bio.org>
Message-ID: <5208B7A6-1F03-40AC-9409-1C1175081544@earthlink.net>


On Sep 29, 2005, at 10:19 AM, bioperl-l-request@portal.open-bio.org  
wrote:

> To avoid any confusion these are both tagged RC3 and should be used
> together.
>
> (BTW Hilmar are you interested in bioperl-db being also tagged as
> 1.5.X and released?)
>
>
> RC3 candidates of both bioperl core and bioperl-run are up.
>
> http://bioperl.org/DIST/bioperl-1.5.1-rc3.tar.gz
> http://bioperl.org/DIST/bioperl-run-1.5.1-rc3.tar.gz
>
> OR zips for those inclined
> http://bioperl.org/DIST/bioperl-1.5.1-rc3.zip
> http://bioperl.org/DIST/bioperl-run-1.5.1-rc3.zip
>
> Test, fix, repeat... =)
>


Both build and install fine on Mac OS X, 10.4.2, using fink.

- Koen.