[Biojava-l] SeqIOTools deprecated, looking for alternatives // RichSeq.IOTools
Richard Holland
holland at eaglegenomics.com
Fri Nov 13 06:21:47 EST 2009
Hello,
The file you are parsing is not a valid EMBL format file. The EMBL format is specified here:
http://www.ebi.ac.uk/embl/Documentation/User_manual/usrman.html#3_4
and this is what the file should look like for your accession:
http://www.ebi.ac.uk/cgi-bin/emblfetch?style=html&id=AJ243265&Submit=Go
The most obvious problems in your file are the absence of the required 'XX' section delimiters, and an invalid ID line. There might be other problems too but I haven't checked the whole file, just the first few lines.
The deprecated SeqIOTools really didn't care if the file was valid or not, they basically just made a copy of all the lines in an internal token/value map. They made no attempt to parse or understand the data in each line. The new RichSequence-based parsers actually attempt to enforce the file format definitions and break down and understand the contents of each line. This means that they will reject any file that does not strictly conform to the specified format.
cheers,
Richard
On 12 Nov 2009, at 13:18, Oliver Stolpe wrote:
> Hello *,
>
> the cookbook uses in its examples the SeqIOTools-class for reading the files. But in the API it is marked as deprecated. Now I am looking for alternatives, so I searched the list and internet and found out that biojavax provides methods and classes for reading the files (RichSequence.IOTools).
>
> For example, I try to read an EMBL-file:
>
> --begin:code--
>
> BufferedReader br = new BufferedReader(new FileReader(filename));
> Namespace ns = RichObjectFactory.getDefaultNamespace();
> RichSequenceIterator seqs = RichSequence.IOTools.readEMBLDNA(br, ns);
>
> while (seqs.hasNext()) {
> RichSequence seq = seqs.nextRichSequence();
> System.out.println(seq.getName() + ":" + seq.getAnnotation().asMap());
> }
>
> --end:code--
>
> But I always get this error message:
>
> --begin:error--
>
> org.biojava.bio.BioException: Could not read sequence
> at org.biojavax.bio.seq.io.RichStreamReader.nextRichSequence(RichStreamReader.java:113)
> at ReadGenbankFile.EMBL(ReadGenbankFile.java:42)
> at ReadGenbankFile.main(ReadGenbankFile.java:85)
> Caused by: org.biojava.bio.seq.io.ParseException:
>
> A Exception Has Occurred During Parsing.
> Please submit the details that follow to biojava-l at biojava.org or post a bug report to http://bugzilla.open-bio.org/
>
> Format_object=org.biojavax.bio.seq.io.EMBLFormat
> Accession=null
> Id=not set
> Comments=
> Parse_block=ID AJ243265_2; parent: AJ243265AC AJ243265;FT CDS join(<1082..1272,2484..2638,4926..>5041)
> /codon_start=3
> /gene="PGM1"
> /product="phosphoglucomutase 1"
> /function="carbohydrate metabolism"
> /EC_number="5.4.2.2"
> /db_xref="GOA:Q9H1D2"
> /db_xref="HGNC:8905"
> /db_xref="HSSP:3PMG"
> /db_xref="InterPro:IPR016055"
> /db_xref="UniProtKB/TrEMBL:Q9H1D2"
> /protein_id="CAC19809.1"
> /translation="VGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLV
> ETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANTFSIPYFQQTGVRGFA
> RSMPTSGALDRVASATKIALYETPTGWKFFGNLMDASKLSLCGEESFGT"SQ Sequence 462 BP;
> Stack trace follows ....
>
>
> at org.biojavax.bio.seq.io.EMBLFormat.readSection(EMBLFormat.java:775)
> at org.biojavax.bio.seq.io.EMBLFormat.readRichSequence(EMBLFormat.java:284)
> at org.biojavax.bio.seq.io.RichStreamReader.nextRichSequence(RichStreamReader.java:110)
> ... 2 more
> Caused by: java.lang.StringIndexOutOfBoundsException: String index out of range: -3
> at java.lang.String.substring(String.java:1949)
> at java.lang.String.substring(String.java:1916)
> at org.biojavax.bio.seq.io.EMBLFormat.readSection(EMBLFormat.java:761)
> ... 4 more
>
> --end:error--
>
> The file looks all ok I think and works well with the deprecated SeqIOTools:
>
> --begin:embl-file--
> ID AJ243265_2; parent: AJ243265
> AC AJ243265;
> FT CDS join(<1082..1272,2484..2638,4926..>5041)
> FT /codon_start=3
> FT /gene="PGM1"
> FT /product="phosphoglucomutase 1"
> FT /function="carbohydrate metabolism"
> FT /EC_number="5.4.2.2"
> FT /db_xref="GOA:Q9H1D2"
> FT /db_xref="HGNC:8905"
> FT /db_xref="HSSP:3PMG"
> FT /db_xref="InterPro:IPR016055"
> FT /db_xref="UniProtKB/TrEMBL:Q9H1D2"
> FT /protein_id="CAC19809.1"
> FT /translation="VGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLV
> FT ETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANTFSIPYFQQTGVRGFA
> FT RSMPTSGALDRVASATKIALYETPTGWKFFGNLMDASKLSLCGEESFGT"
> SQ Sequence 462 BP;
> ttgtgggacc gtatgtaaag aagatcctct gtgaagaact cggtgcccct gcgaactcgg 60
> cagttaactg cgttcctctg gaggactttg gaggccacca ccctgacccc aacctcacct 120
> atgcagctga cctggtggag accatgaagt caggagagca tgattttggg gctgcctttg 180
> atggagatgg ggatcgaaac atgattctgg gcaagcatgg gttctttgtg aacccttcag 240
> actctgtggc tgtcattgct gccaacacct tcagcattcc gtatttccag cagactgggg 300
> tccgcggttt tgcacggagc atgcccacga gtggtgctct ggaccgggtg gctagtgcta 360
> caaagattgc tttgtatgag accccaactg gctggaagtt ttttgggaat ttgatggacg 420
> cgagcaaact gtccctttgt ggggaggaga gcttcgggac cg 462
> //
> --end:embl-file--
>
> The parser always crashes before reading the sequence (ttgt..., directly after the BP;).
>
> Any suggestions how I get this work?
> Or are there other alternatives for substituting the deprecated SeqIOTools-class?
>
> Thanks in advance,
>
> with best regards,
>
> Oliver
> _______________________________________________
> Biojava-l mailing list - Biojava-l at lists.open-bio.org
> http://lists.open-bio.org/mailman/listinfo/biojava-l
--
Richard Holland, BSc MBCS
Operations and Delivery Director, Eagle Genomics Ltd
T: +44 (0)1223 654481 ext 3 | E: holland at eaglegenomics.com
http://www.eaglegenomics.com/
More information about the Biojava-l
mailing list