[Biojava-l] Question about StructureTools and PDBFileReader
Martin Heusel
mheusel at gmail.com
Sat Jan 12 08:16:48 EST 2008
Hi Andreas,
thanks for your fast help. Sorry it was my fault, i was irritated by a
SCOP sequence:
>d1a4ka1 b.1.1.1 (A:1-112) Immunoglobulin light chain kappa variable
domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
ELVMTQTPLSLPVSLGDQASISCRSSQSLLHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQVTHVPPTFGGGTKLEIKRTVAA
it says chain A sequence numbers 1-112 but the sequence is 117 long.
At sequence number 27 there is
ATOM 3506 CA GLN A 27 32.507 26.162 -0.401 1.00 42.73 C
and five additional residues afterwards (only CA)
ATOM 3515 CA SER A1027 30.776 25.929 -3.769 1.00 31.11 C
ATOM 3521 CA LEU A2027 27.714 23.743 -3.444 1.00 23.42 C
ATOM 3529 CA LEU A3027 28.008 22.622 -7.045 1.00 26.03 C
ATOM 3537 CA HIS A4027 28.614 18.875 -6.927 1.00 27.10 C
ATOM 3547 CA SER A5027 31.052 17.066 -9.205 1.00 31.92 C
so there is a sequence number 27 and five additional numbers 1027 - 5027
Then it goes further with 28
ATOM 3553 CA ASN A 28 27.957 15.242 -10.411 1.00 26.69 C
So if i iterate over a CA Atom array from 1 to 28 in this case, i
correctly get the first 28 CAs. So my assumption that i don't get
these additional CAs was not correct, i missed the last five. I'm
sorry i should have debugged more closely.
My question is now if it's possible to get the CAs or groups in a
sequence number interval?
Also i wonder what these additional groups between 27 and 28 are.
best regards
Martin
More information about the Biojava-l
mailing list